# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24374.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABE40040.1  [L=344]
Description: rpal2 ABE40040.1 GIB00345CH01 "Pyruvate dehydrogenase (lipoamide)"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   4.6e-104  350.0   0.4   5.3e-104  349.8   0.2    1.0  1  PF00676  Dehydrogenase E1 component
    0.00066   22.0   0.7     0.0013   21.0   0.5    1.5  1  PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP bindi
  ------ inclusion threshold ------
       0.11   13.9   0.0       0.15   13.5   0.0    1.2  1  PF00456  Transketolase, thiamine diphosphate binding domain
        6.9    9.5   0.1         12    8.8   0.1    1.4  1  PF10768  Class II flagellar assembly regulator
        9.1    8.3   0.8         19    7.3   0.5    1.4  1  PF12438  Protein of unknown function (DUF3679)
         11    8.3   0.0         15    7.8   0.0    1.2  1  PF04919  Protein of unknown function, DUF655
         15    8.4   0.1         28    7.5   0.1    1.4  1  PF07739  TipAS antibiotic-recognition domain
         15    7.1   0.0         22    6.5   0.0    1.2  1  PF10103  Uncharacterised conserved protein (DUF2342)
         27    6.8   0.1         69    5.4   0.0    1.7  1  PF09802  Preprotein translocase subunit Sec66
         38    6.7   0.0         98    5.4   0.0    1.6  1  PF00947  Picornavirus core protein 2A
         43    6.5   0.0    1.2e+02    5.0   0.0    1.7  1  PF10437  Bacterial lipoate protein ligase C-terminus
         50    6.1   0.7    1.2e+02    4.9   0.0    2.0  1  PF05488  PAAR motif
         51    7.3   0.2         88    6.5   0.2    1.3  1  PF07303  Occludin homology domain
         52    6.4   0.0    1.2e+02    5.2   0.0    1.6  1  PF04273  Putative phosphatase (DUF442)
         69    5.9   0.0    1.3e+02    5.0   0.0    1.4  1  PF01486  K-box region
         76    5.3   0.3    1.4e+02    4.4   0.2    1.3  1  PF03731  Ku70/Ku80 N-terminal alpha/beta domain
         76    7.0   0.0    1.8e+02    5.9   0.0    1.6  1  PF12413  Homeobox protein distal-less-like N terminal
         85    5.6   0.0    1.9e+02    4.5   0.0    1.5  1  PF08652  RAI1 like
      1e+02    5.9   0.4    1.6e+02    5.2   0.2    1.3  1  PF05531  Nucleopolyhedrovirus P10 protein
      1e+02    5.3   0.0    1.9e+02    4.5   0.0    1.3  1  PF11687  Domain of unknown function (DUF3284)
    1.2e+02    5.1   0.4    2.3e+02    4.1   0.3    1.5  1  PF03406  Phage tail fibre repeat
    1.3e+02    5.0   0.1    3.9e+02    3.5   0.1    1.8  1  PF07644  Planctomycete PGAMP
    1.4e+02    4.9   0.0      3e+02    3.8   0.0    1.4  1  PF07456  Heptaprenyl diphosphate synthase component I
    1.5e+02    4.0   0.0    2.5e+02    3.3   0.0    1.2  1  PF04157  EAP30/Vps36 family
    1.6e+02    2.9   0.0    2.4e+02    2.3   0.0    1.1  1  PF02438  Late 100kD protein
    1.8e+02    4.7   0.0    3.8e+02    3.7   0.0    1.6  1  PF07966  A1 Propeptide
    1.9e+02    4.7   0.0    3.6e+02    3.8   0.0    1.4  1  PF08855  Domain of unknown function (DUF1825)
    1.9e+02    4.6   0.0    4.5e+02    3.4   0.0    1.5  1  PF06608  Protein of unknown function (DUF1143)
    2.1e+02    4.8   0.1    3.8e+02    3.9   0.1    1.4  1  PF00700  Bacterial flagellin C-terminal helical region
    2.2e+02    4.3   0.0    4.2e+02    3.4   0.0    1.3  1  PF06320  GCN5-like protein 1 (GCN5L1)
    2.3e+02    4.6   3.1    1.2e+02    5.5   0.0    2.2  1  PF10529  Histidine-rich Calcium-binding repeat region
    2.4e+02    5.2   4.1         95    6.4   0.1    2.3  1  PF09598  Stm1
      3e+02    3.8   0.1      5e+02    3.1   0.1    1.3  1  PF03695  Uncharacterised protein family (UPF0149)
      3e+02    4.7   0.0    5.8e+02    3.8   0.0    1.4  1  PF11421  ATP synthase F1 beta subunit
    3.4e+02    2.9   0.0    5.3e+02    2.2   0.0    1.2  1  PF00632  HECT-domain (ubiquitin-transferase)
    3.9e+02    2.5   0.0    5.8e+02    2.0   0.0    1.2  1  PF10951  Protein of unknown function (DUF2776)
    4.1e+02    3.0   0.1    7.1e+02    2.2   0.0    1.3  1  PF08597  Translation initiation factor eIF3 subunit
      5e+02    1.7   0.1    8.4e+02    1.0   0.0    1.2  1  PF04388  Hamartin protein
    5.1e+02    3.4   0.1    9.9e+02    2.5   0.1    1.5  1  PF08108  Halocidin family
    6.1e+02    3.4   1.4    2.4e+03    1.6   1.0    2.1  1  PF08257  Sulfakinin family
    7.8e+02    2.2   0.1    1.4e+03    1.4   0.1    1.4  1  PF07601  Protein of unknown function (DUF1562)
    2.3e+03    0.1   0.0    3.7e+03   -0.6   0.0    1.2  1  PF10250  GDP-fucose protein O-fucosyltransferase


Domain and alignment annotation for each model:
>> PF00676  Dehydrogenase E1 component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  349.8   0.2  2.2e-107  5.3e-104       2     299 ..      39     335 ..      38     336 .. 0.98

  Alignments for each domain:
  == domain 1    score: 349.8 bits;  conditional E-value: 2.2e-107
                 HHHHHHHHHHHHHHHHHHTTSSS--------HHHHHHHHHCS-TTSEEE-STT-HHHHHHTT--HHHHHHHHHT-T....T-TT----TT---BTT--B CS
     PF00676   2 klmllrrmedalaalykrkkrigfvhlsagqealqvgiaaalekeDlvistYRehgvllargvsleevlaeltgke....kgkggsmheisyaekksrf 96 
                 ++ l+rr+e+++ +ly    + gf+hl+ gqea+ vg+++al ++D vi++YR+hg++la  ++ + v+aeltg++    kgkggsmh +++ ek   f
  ABE40040.1  39 DMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTGRRggysKGKGGSMH-MFSMEKH--F 134
                 799*************************************************************************************.8867766..* PP

                 ----S--SHHTTHHH--HHHHHH------EEEEE----TTSHHHHHHHHHHHHTT--EEEEEEEESEETTECCGHC-S-S-CGGGGGG---EEEEE--- CS
     PF00676  97 lggngivgaqvplvaGialaakyegkkevailliGDGatnqGqffealnlAalwklpvifvveNNqyaisteaerssaskelakkargvgipgirVdGn 195
                 +gg+givgaqv+l++Gia+a +y+++ +v+++++GDGa+nqGq++e++n+A+lwklpv++v+eNN+ya++t++ rssa ++++k+++ ++ipg +VdG+
  ABE40040.1 135 YGGHGIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGM 233
                 *************************************************************************************************** PP

                 -HHHHHHHHHHHHHHHH-----EEEEEEE------STT-CGGGTSHCHHHHHHHHCC-HHHHHHHHHHHTTSS-HHHHHHHHHHHHHHHHHHHHHHHTS CS
     PF00676 196 DvlAvyqAvkeAaeraregkgPvLielvtYRyggHsesDdpstyrtreeveevrkkkdpikrlkehlvkkgvvseeelkeiekevrkeieeavkkaeek 294
                 Dv Av++A  +A+ ++r+g+gP ++e+ tYRy+gHs+sD p +yrtreev+++r  +dpi++ +++l+ +++ +e+ lk+i++evrk+++ea ++a+++
  ABE40040.1 234 DVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSD-PAKYRTREEVDKIRNDQDPIEQVRQRLLGSDM-TEDDLKKIDAEVRKIVNEAADFAQND 330
                 ***************************************.899*************************9996.7899********************** PP

                 ----H CS
     PF00676 295 kepev 299
                 +ep++
  ABE40040.1 331 PEPDP 335
                 **987 PP

>> PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.0   0.5   5.5e-07    0.0013      19     101 ..     133     220 ..     119     260 .. 0.68

  Alignments for each domain:
  == domain 1    score: 21.0 bits;  conditional E-value: 5.5e-07
                 EEEE--SS--TT-HHHHHHHHTTT....STTS-EEEEE----TCTT.GGGHHHHHHT.T.-EEEEEEE-SB-..HHHH.HHHH-SS-.GG CS
     PF02775  19 syltsgglgtmGyglpaAiGakla....kpdrevvaivGDGgflmi.lqelatavrr.nlpitvvvlnNegygmtggq.qepfggkrksg 101
                 ++  +gg+g  G +++ ++G+++a    ++++   a+ GDG+     + e  ++++  +lp+++v+ nN++ + t    ++ +++ +k g
  ABE40040.1 133 HF--YGGHGIVGAQVSLGTGIAFAnryrDNGSVCLAYFGDGASNQGqVYESFNMAELwKLPVVYVIENNRYAMGTSVTrSSAQTDFSKRG 220
                 44..56*****************7444233578899******888889999999999567*****9999987666655433333333333 PP

>> PF00456  Transketolase, thiamine diphosphate binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.5   0.0   6.4e-05      0.15     148     249 ..     165     268 ..     139     329 .. 0.75

  Alignments for each domain:
  == domain 1    score: 13.5 bits;  conditional E-value: 6.4e-05
                 EEEE----TT---HHHHHHH--------EEEEEEE-S------G.GGT--S-HHHHHHH---EEEEEE----HHHHHHHHHHHCC-...TTS-EEEEEE CS
     PF00456 148 yvllgDgclmEGvssEaislagvlkLgkLialyDdNkisidget.eisftedvakrfeaygWhvievedgedveeiakAieeAkae...kdkPtlikvk 242
                  +  gDg  + G ++E+ ++a + kL  ++ + ++N+ ++  ++ + s ++d +kr  +++    +v dg dv+++++A ++A a+    + P +++++
  ABE40040.1 165 LAYFGDGASNQGQVYESFNMAELWKLP-VVYVIENNRYAMGTSVtRSSAQTDFSKRGVSFNIPGEQV-DGMDVRAVKAAGDKAVAHcraGNGPYILEMQ 261
                 4568**********************7.5667789999988775156789999***99998877776.********99888876541113678888888 PP

                 ------- CS
     PF00456 243 tviGfgs 249
                 t   +g 
  ABE40040.1 262 TYRYRGH 268
                 8776665 PP

>> PF10768  Class II flagellar assembly regulator
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.1     0.005        12      43     116 ..     239     325 ..     198     330 .. 0.67

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.005
     PF10768  43 aasaaaavagvdA.....LLalQev.......ed.plerrrravrrgeelLDvLdeLkialLsGevskaklerLaeavaerkeasgD 116
                 +a++ +ava   A     +L +Q          d ++ r r +v++ ++  D +++++  lL+ ++ +++l+++ + v++  ++++D
  ABE40040.1 239 KAAGDKAVAHCRAgngpyILEMQTYryrghsmSDpAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAAD 325
                 4444555555543333446666665443322244456688999***********************************998888777 PP

>> PF12438  Protein of unknown function (DUF3679)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.5    0.0079        19      13      41 ..      72     101 ..      64     107 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.0079
     PF12438  13 VllGmqqA.neGlkkmkGYddpsleqvfsi 41 
                 V++Gmq+A  eG + + GY+d +   + ++
  ABE40040.1  72 VVVGMQMAlREGDQVITGYRDHGHMLACEM 101
                 99******668**********987766666 PP

>> PF04919  Protein of unknown function, DUF655
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0065        15      27      99 ..     191     325 ..     162     329 .. 0.76

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0065
                 -EEEEE---S---EEEEE-------..............................................................TT-EEE------ CS
     PF04919  27 pvvqalgereftLlelvpkkevdil..............................................................kleevaigkgkr 63 
                 pvv+++ ++++ +   v ++ ++                                                                + eev   ++ +
  ABE40040.1 191 PVVYVIENNRYAMGTSVTRSSAQTDfskrgvsfnipgeqvdgmdvravkaagdkavahcragngpyilemqtyryrghsmsdpakyrTREEVDKIRNDQ 289
                 6666666666666666666554444556677777777777777777777777777777777777777777777777777777777779999******** PP

                 SSEEEEEEE--GGGS-HHHHHHHHHHHHHHHHTTHH CS
     PF04919  64 dkivsvkrkisyedLtdvaraeLpyvvekivkeked 99 
                 d i++v++++   d+t+   ++++  v+kiv+e  d
  ABE40040.1 290 DPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAAD 325
                 ********************************9877 PP

>> PF07739  TipAS antibiotic-recognition domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.1     0.012        28      17      59 ..     289     333 ..     276     338 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.012
                 -----------..----------TTHHHHHHHHHHHHHHH----T CS
     PF07739  17 tealkesnekl..knmskedwaelkaewaalfaelaaameagvdp 59 
                 ++ +++++++l  ++m+++d ++++ae +++++e a+  ++  +p
  ABE40040.1 289 QDPIEQVRQRLlgSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEP 333
                 6778888888833469*********************99998444 PP

>> PF10103  Uncharacterised conserved protein (DUF2342)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0092        22     268     313 ..     277     322 ..     270     330 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0092
     PF10103 268 alrerlrrrRakggpaekalrrLlGlelkprqyregaalvaavvea 313
                 + re++++ R+++ p+e++ +rLlG ++    +++  a v+++v++
  ABE40040.1 277 RTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNE 322
                 56899***********************999988888877777765 PP

>> PF09802  Preprotein translocase subunit Sec66
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.029        69     119     140 ..     308     329 ..     282     332 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.029
     PF09802 119 aeKlveeElkdvvqEaeaykpg 140
                   K ++ E++++v+Ea  ++++
  ABE40040.1 308 DLKKIDAEVRKIVNEAADFAQN 329
                 6799*************99887 PP

>> PF00947  Picornavirus core protein 2A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.041        98      24      55 ..     235     266 ..     225     292 .. 0.78

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.041
     PF00947  24 vvrttahGadtiarCnCttgvyycksrrkyyp 55 
                 v  ++a G++ +a+C+  +g y  + +   y 
  ABE40040.1 235 VRAVKAAGDKAVAHCRAGNGPYILEMQTYRYR 266
                 77899*****************9988876664 PP

>> PF10437  Bacterial lipoate protein ligase C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.052   1.2e+02      41      68 ..     289     316 ..     287     327 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.052
     PF10437  41 pedleeleekLiGvkydkeaikkalkel 68 
                 ++++e++ ++L G  ++++++kk+ +e+
  ABE40040.1 289 QDPIEQVRQRLLGSDMTEDDLKKIDAEV 316
                 568*******************996665 PP

>> PF05488  PAAR motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0      0.05   1.2e+02       4      24 ..      68      88 ..      68      89 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.05
     PF05488  4 GSpnVkinGkPAARlGDsvvC 24
                G+ +V +++++A R GD+v +
  ABE40040.1 68 GQEAVVVGMQMALREGDQVIT 88
                7789*************9765 PP

>> PF07303  Occludin homology domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.2     0.037        88       9      78 ..     261     329 ..     255     334 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.037
     PF07303   9 qrqrYkaeFdsdykeYkeLqaeldeiskklaeldaelkslkegseeykevakileeyeklkkrspdykek 78 
                 q  rY+ +  sd ++Y++  +e+d+i++  + +++  ++l  +   +++++ki  e +k+ ++ +d+ ++
  ABE40040.1 261 QTYRYRGHSMSDPAKYRT-REEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQN 329
                 556788888888899986.789*************9999999999999999*********9999999876 PP

>> PF04273  Putative phosphatase (DUF442)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.05   1.2e+02      70      97 ..     225     253 ..     205     258 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.05
     PF04273  70 iteddveafq.ralaeaegpvlayCrsGt 97 
                 i  ++v+ ++ ra+++a+   +a+Cr+G 
  ABE40040.1 225 IPGEQVDGMDvRAVKAAGDKAVAHCRAGN 253
                 5567777775489*************996 PP

>> PF01486  K-box region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.055   1.3e+02      11      45 ..     272     306 ..     263     321 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.055
     PF01486  11 eakaeslqqelakLkkeienLqreqRhllGedLes 45 
                 +    + ++e++k+++  + +++   +llG d+++
  ABE40040.1 272 DPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE 306
                 555557889***************99****99886 PP

>> PF03731  Ku70/Ku80 N-terminal alpha/beta domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.2      0.06   1.4e+02     133     181 ..     282     341 ..     280     343 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.06
                 -SS--.-CCCHHHHHHHHH..........---TTT---EEEEEEB.-------CCCTGGH CS
     PF03731 133 lddpfkdddqldtilqkll..........aeDledegielnllhL.pkskkfdpeefyke 181
                 +d++ +d+d +++ +q+ll          + D+e ++i  + +   +++ ++dp+e+y++
  ABE40040.1 282 VDKIRNDQDPIEQVRQRLLgsdmteddlkKIDAEVRKIVNEAADFaQNDPEPDPSELYTD 341
                 5777889************77777666665555555554333333599999999999987 PP

>> PF12413  Homeobox protein distal-less-like N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.076   1.8e+02      28      61 ..     248     281 ..     239     286 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.076
     PF12413  28 ycqpssqtygqqlnsYqynlnglggsgnYsakse 61 
                 +c + + +y  ++  Y y  ++++  ++Y++++e
  ABE40040.1 248 HCRAGNGPYILEMQTYRYRGHSMSDPAKYRTREE 281
                 67777889999*******************9866 PP

>> PF08652  RAI1 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.08   1.9e+02      46      66 ..      77      97 ..      74      99 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.08
                HHHH-----EEE-EE-----E CS
     PF08652 46 QsfLlgvpkivvGfRddegil 66
                Q  L   ++++ G+Rd+ ++l
  ABE40040.1 77 QMALREGDQVITGYRDHGHML 97
                556677789********9998 PP

>> PF05531  Nucleopolyhedrovirus P10 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.2     0.069   1.6e+02      25      63 ..     280     321 ..     277     337 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.069
     PF05531  25 qqvddvqenlpdvtelnekL...daqsaqLaeletkvenIqd 63 
                 ++vd+++++   ++++ ++L   d   + L++++++v +I +
  ABE40040.1 280 EEVDKIRNDQDPIEQVRQRLlgsDMTEDDLKKIDAEVRKIVN 321
                 68999************9997777778889999998888754 PP

>> PF11687  Domain of unknown function (DUF3284)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.08   1.9e+02      47      82 ..     181     216 ..     173     221 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.08
     PF11687  47 sfskgkeatvkIteleknkkYaittstnrdtftvrY 82 
                 sf++ +  ++ +  +++n++Ya+ ts +r++ ++++
  ABE40040.1 181 SFNMAELWKLPVVYVIENNRYAMGTSVTRSSAQTDF 216
                 67777788999999***************9999887 PP

>> PF03406  Phage tail fibre repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.3     0.098   2.3e+02      26      38 ..     236     248 ..     235     253 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.098
     PF03406  26 KAVKaayDlAnaa 38 
                 +AVKaa D+A+a+
  ABE40040.1 236 RAVKAAGDKAVAH 248
                 7*********986 PP

>> PF07644  Planctomycete PGAMP
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.1      0.16   3.9e+02      16      35 .]     202     221 ..     200     221 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.16
     PF07644  16 AvGQsnrlkkaqsqnSrrav 35 
                 A G s+   +aq+  S+r+v
  ABE40040.1 202 AMGTSVTRSSAQTDFSKRGV 221
                 889999889*********86 PP

>> PF07456  Heptaprenyl diphosphate synthase component I
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.12     3e+02      81     114 ..      39      73 ..      33      80 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.12
     PF07456  81 vmlllkklpkkkvslvgiSilgavahn.lgQliva 114
                  mll++++++k   l+g+ ++g+++h  +gQ +v+
  ABE40040.1  39 DMLLIRRFEEKAGQLYGMGAIGGFCHLyIGQEAVV 73 
                 6999*****99999************636776665 PP

>> PF04157  EAP30/Vps36 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.11   2.5e+02      12      48 ..     293     329 ..     287     335 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.11
                 ---------SCCCHHHHHHHHHHHHHHHHHHHHHHHH CS
     PF04157  12 qqrkendlgaqialedleqlmdqakelvelleslakk 48 
                 +q +++ lg+  +++dl ++ +   ++v+ + ++a++
  ABE40040.1 293 EQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQN 329
                 78899999***************************98 PP

>> PF02438  Late 100kD protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0       0.1   2.4e+02     377     398 ..      23      44 ..      20      46 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.1
     PF02438 377 kalPdfisqsqlqnfRsFiler 398
                 +++Pdf+++  l++fR+ +l r
  ABE40040.1  23 SKVPDFTKEQELHAFRDMLLIR 44 
                 679***************9987 PP

>> PF07966  A1 Propeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.16   3.8e+02      12      28 ..     295     311 ..     295     312 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.16
                 HHHHHHH---HHHHHHH CS
     PF07966  12 lRetLrEkGlledfLke 28 
                 +R++L  +++ ed Lk+
  ABE40040.1 295 VRQRLLGSDMTEDDLKK 311
                 69**************8 PP

>> PF08855  Domain of unknown function (DUF1825)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.15   3.6e+02       6      37 ..     301     332 ..     297     337 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.15
     PF08855   6 dSeivqeelkelfedyqelmklgseygkldre 37 
                  S++  ++lk++  + +++++ ++++++ d+e
  ABE40040.1 301 GSDMTEDDLKKIDAEVRKIVNEAADFAQNDPE 332
                 59*************************99987 PP

>> PF06608  Protein of unknown function (DUF1143)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.19   4.5e+02     102     125 ..     115     138 ..     104     142 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.19
     PF06608 102 asysrkkplsthrfkrephlfpgh 125
                   ys+ k  s h f  e h++ gh
  ABE40040.1 115 GGYSKGKGGSMHMFSMEKHFYGGH 138
                 579999*****************9 PP

>> PF00700  Bacterial flagellin C-terminal helical region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1      0.16   3.8e+02      23      54 ..     276     307 ..     273     317 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.16
     PF00700  23 nRlesaienlknqsenlkaaisriedvDpaee 54 
                  R+ + ++++ n ++ +++ ++r+ + D++e 
  ABE40040.1 276 YRTREEVDKIRNDQDPIEQVRQRLLGSDMTED 307
                 588999***********************996 PP

>> PF06320  GCN5-like protein 1 (GCN5L1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.18   4.2e+02      50      68 ..     310     328 ..     305     331 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.18
     PF06320  50 krleaeakalqataaklak 68 
                 k+++ae++++ ++aa +a+
  ABE40040.1 310 KKIDAEVRKIVNEAADFAQ 328
                 9***************986 PP

>> PF10529  Histidine-rich Calcium-binding repeat region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.049   1.2e+02       1       7 [.     263     269 ..     263     272 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.049
     PF10529   1 HRHRGHr 7  
                 +R+RGH+
  ABE40040.1 263 YRYRGHS 269
                 7*****7 PP

>> PF09598  Stm1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.1      0.04        95       5      48 ..     299     336 ..     298     340 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.04
     PF09598   5 LLGnDdeeDpsrlpapptkelvkqsttskkrdkpakaPnkpaPr 48 
                 LLG D  eD+ + ++++++++v +++  +++d     P  p+P 
  ABE40040.1 299 LLGSDMTEDDLKKIDAEVRKIVNEAADFAQND-----P-EPDPS 336
                 9*****99999999****99**9999999999.....5.66665 PP

>> PF03695  Uncharacterised protein family (UPF0149)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.21     5e+02     112     146 ..     300     335 ..     299     343 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.21
                 -------TTGGG-------HHHHHHHHTT--.-SS- CS
     PF03695 112 lGlglaeeddeelsaeldelledlaaiadld.dede 146
                 lG  ++e+d ++++ae+++   + a +a+ d ++d+
  ABE40040.1 300 LGSDMTEDDLKKIDAEVRKIVNEAADFAQNDpEPDP 335
                 6888999**********************9844333 PP

>> PF11421  ATP synthase F1 beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.25   5.8e+02       8      29 ..     205     226 ..     203     237 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.25
     PF11421   8 sSLLRsssrrsasksslsnssP 29 
                 +S+ Rss++   sk  +s  +P
  ABE40040.1 205 TSVTRSSAQTDFSKRGVSFNIP 226
                 799**********988887776 PP

>> PF00632  HECT-domain (ubiquitin-transferase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.22   5.3e+02      73     108 ..     297     332 ..     290     343 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.22
     PF00632  73 kfllgkkvtledleeidpelanslkelqelesntee 108
                 + llg+++t +dl++id e+ + ++e  ++ +n++e
  ABE40040.1 297 QRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPE 332
                 6799********************999999999887 PP

>> PF10951  Protein of unknown function (DUF2776)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.24   5.8e+02      47      98 ..     161     211 ..     157     225 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.24
     PF10951  47 gaicialfataatiirqliktynevakfllPiiGylaavitlvaGlallsea 98 
                 g +c+a f   a    q+ +++n +  + lP++ y+       +G ++++++
  ABE40040.1 161 GSVCLAYFGDGASNQGQVYESFNMAELWKLPVV-YVIENNRYAMGTSVTRSS 211
                 579****************************98.665555566666655554 PP

>> PF08597  Translation initiation factor eIF3 subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0       0.3   7.1e+02     172     196 ..     298     322 ..     292     324 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.3
     PF08597 172 rdllksLsaedikkvsstlnvline 196
                 r l  +++ +d+kk+ + + +++ne
  ABE40040.1 298 RLLGSDMTEDDLKKIDAEVRKIVNE 322
                 667789****************998 PP

>> PF04388  Hamartin protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.35   8.4e+02     610     646 ..       7      43 ..       4      49 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.35
     PF04388 610 sdahskvlkRlslpsksadthfgPseelealrsqlll 646
                 s a++  + R s p+ks+ + f   +el+a r+ ll+
  ABE40040.1   7 SAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLI 43 
                 668888999***********************99986 PP

>> PF08108  Halocidin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.41   9.9e+02       9      15 .]      99     108 ..      93     108 .. 0.72

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.41
     PF08108   9 C...AKGVLA 15 
                 C   AKGV+A
  ABE40040.1  99 CemdAKGVMA 108
                 55559***98 PP

>> PF08257  Sulfakinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   1.0         1   2.4e+03       3       7 ..      92      96 ..      90      97 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 1
     PF08257  3 DYGHM 7 
                D GHM
  ABE40040.1 92 DHGHM 96
                99*** PP

>> PF07601  Protein of unknown function (DUF1562)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.1      0.58   1.4e+03       1      12 [.     309     320 ..     309     320 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.58
     PF07601   1 LKNsivaInKTa 12 
                 LK+ +++++K++
  ABE40040.1 309 LKKIDAEVRKIV 320
                 8999******97 PP

>> PF10250  GDP-fucose protein O-fucosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.0       1.6   3.7e+03     212     247 ..     247     282 ..     238     300 .. 0.82

  Alignments for each domain:
  == domain 1    score: -0.6 bits;  conditional E-value: 1.6
     PF10250 212 sgCehkggdekeelasprekkekeidseelrregkc 247
                   C+ + g    e++ +r+++ +  d++++r ++ +
  ABE40040.1 247 AHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTREEV 282
                 568888888889999999999999999999988765 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (344 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       319  (0.0267797); expected 238.2 (0.02)
Passed bias filter:                      285  (0.0239255); expected 238.2 (0.02)
Passed Vit filter:                        43  (0.00360981); expected 11.9 (0.001)
Passed Fwd filter:                        43  (0.00360981); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              42  [number of targets reported over threshold]
# CPU time: 0.24u 0.05s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 3094.43
//