hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24350.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABE37710.1
Accession:      [none]
Description:    rpal2 ABE37710.1 GIB00345CH01 "protein of unknown function DUF589"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0052864  PUA domain-like                                178.9    1.4e-49   1
0051555  PUA domain-like                                178.7    1.6e-49   1
0051817  PUA domain-like                                170.2    5.8e-47   1
0052524  PUA domain-like                                165.2    1.8e-45   1
0052824  PUA domain-like                                162.6    1.1e-44   1
0050660  PUA domain-like                                122.0    1.9e-32   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0050660    1/1       1   136 [.     1   145 []   122.0  1.9e-32
0051555    1/1       1   136 [.     1   146 []   178.7  1.6e-49
0051817    1/1       1   136 [.     1   157 []   170.2  5.8e-47
0052524    1/1       2   135 ..     1   148 []   165.2  1.8e-45
0052824    1/1       2   135 ..     1   148 []   162.6  1.1e-44
0052864    1/1       2   137 ..     1   136 []   178.9  1.4e-49

Alignments of top-scoring domains:
0050660: domain 1 of 1, from 1 to 136: score 122.0, E = 1.9e-32
                   *->mnYWLlksep...............dnwdgvrnygargvpegkknll
                      m+YWL+ksep +   ++++++ ++ + w+gvrn+ a  +       +
  ABE37710.1     1    MAYWLVKSEPsvwswdqqvakgakgEAWTGVRNHSAKLH-------M 40   

                   krmkpgDlvlfYhsktgepggklllqsivGigeVvseaypdptpifdpes
                    +mk+gD+++fYhs++g        ++i+Gi+e+++eaypdpt       
  ABE37710.1    41 IAMKKGDRAFFYHSNEG--------KEIIGIAEIIREAYPDPT------- 75   

                   laddprpyrvdvkaviilevpikpllpsLefiknkpklgdlll....rls
                    +++ ++++vd+ka ++l++p+     +L  +k++p+l++++l ++ rls
  ABE37710.1    76 -DESGKFVCVDLKADKKLKTPV-----TLVAVKAEPRLAEMALlkysRLS 119  

                   vfpiseedfelIlellgmayWLlksePdvysiddlvalgeqttlwdGvrnyqarnflremkvGD
                      mayWL+kseP+v+s+d++va+g + + w+Gvrn+ a  ++ +mk+GD
  ABE37710.1     1    MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGD 47   

                   lvlfYhsnkkpgivGiaevvseaypdptafddprwllvdvkfveklkkpv
                   +++fYhsn++++i+Giae+++eaypdpt+ +++++++vd+k+ +klk+pv
  ABE37710.1    48 RAFFYHSNEGKEIIGIAEIIREAYPDPTD-ESGKFVCVDLKADKKLKTPV 96   

                   tlselkalpeledllllkgsrlsvlpvteeewelilellgleglkelle<
                   tl ++ka+p+l++++llk srlsv+pvt++ew+li++++g          
  ABE37710.1    97 TLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGG---------  136  

                   -*
                     
  ABE37710.1     -    -    

0051817: domain 1 of 1, from 1 to 136: score 170.2, E = 5.8e-47
                   *->slskmayWLlksePdaysiddll..kegttlWdGvrnyqarnflrdm
                          mayWL+kseP+++s+d++++++ + + W+Gvrn+ a+ ++ +m
  ABE37710.1     1    ----MAYWLVKSEPSVWSWDQQVakGAKGEAWTGVRNHSAKLHMIAM 43   

                   kvGDlvlfYhsnakepgivGiaevvseaypdptafdpespyydpkskpek
                   k+GD+++fYhsn ++++i+Giae+++eaypdpt+              e+
  ABE37710.1    44 KKGDRAFFYHSN-EGKEIIGIAEIIREAYPDPTD--------------ES 78   

                   prwllvdvkfvrklkkpvtlkelkalpelkdllllrgsrlsvqpvteeew
                   +++++vd+k+ +klk+pvtl ++ka+p+l++++ll+ srlsvqpvt +ew
  ABE37710.1    79 GKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEW 128  

                   dlilkllgldllaYWLlksePdeysiddllkeg..ttlWdgvrnyqarnflrdmkvGDl
                      aYWL+kseP+++s+d+++++g++ + W+gvrn+ a+ ++ +mk+GD+
  ABE37710.1     2    AYWLVKSEPSVWSWDQQVAKGakGEAWTGVRNHSAKLHMIAMKKGDR 48   

                   vlfYhsnckepgivGiaevvseaypdptqfdpeskyydpkskpekprwvl
                   ++fYhsn ++++i+Giae+++eaypdpt+              e++++v+
  ABE37710.1    49 AFFYHSN-EGKEIIGIAEIIREAYPDPTD--------------ESGKFVC 83   

                   vdvkfvkklkrpvtlselkalpeledllllkrgsrlsvlpvteeewdlil
                   vd+k+ kklk+pvtl ++ka+p+l++++ll + srlsv+pvt++ew+li+
  ABE37710.1    84 VDLKADKKLKTPVTLVAVKAEPRLAEMALL-KYSRLSVQPVTADEWKLIC 132  

                   ellaYWLlksePdvysiddlv..kegttlWdGvrnyqarnflrdmkvGdl
                      aYWL+kseP+v+s+d++v+++ + + W+Gvrn+ a  ++ +mk+Gd+
  ABE37710.1     2    AYWLVKSEPSVWSWDQQVakGAKGEAWTGVRNHSAKLHMIAMKKGDR 48   

                   vlfYhsnlkepgivGiaevvseaypdptafdpeskyydpkskpekprwvl
                   ++fYhsn ++++i+Giae+++eaypdpt+              e++++v+
  ABE37710.1    49 AFFYHSN-EGKEIIGIAEIIREAYPDPTD--------------ESGKFVC 83   

                   vdvkfvkllkkpvtlaelkalpalkdllllrkgsrlsvlpvteeewdlil
                   vd+k+ k+lk+pvtl ++ka+p+l++++ll k srlsv+pvt++ew+li+
  ABE37710.1    84 VDLKADKKLKTPVTLVAVKAEPRLAEMALL-KYSRLSVQPVTADEWKLIC 132  

                   elaaYWLlksePdvysiddlvaegeqltlwdgvrnyqarnflrdmkvGDl
                      aYWL+kseP+v+s+d++va+g + + w+gvrn+ a  ++ +mk+GD+
  ABE37710.1     2    AYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDR 48   

                   vlfYhsncekgivGiaevvkeaypdptafdprwllvdvkfveklkkpvtl
                   ++fYhsn++k+i+Giae+++eaypdpt+ ++++++vd+k+ +klk+pvtl
  ABE37710.1    49 AFFYHSNEGKEIIGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTL 98   

                   selkalpeledllllrgsrlsvlpvteeewelilkllgl