hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24354.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABE38048.1
Accession:      [none]
Description:    rpal2 ABE38048.1 GIB00345CH01 "glutamate--cysteine ligase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0044108  Glutamine synthetase/guanido kinase            249.7    2.4e-73   1
0043170  Glutamine synthetase/guanido kinase            253.1    7.8e-73   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043170    1/1      22   455 ..     1   368 []   253.1  7.8e-73
0044108    1/1      24   455 ..     1   366 []   249.7  2.4e-73

Alignments of top-scoring domains:
0043170: domain 1 of 1, from 22 to 455: score 253.1, E = 7.8e-73
                   *->lsdfkdsdeltlGiElElllvdpdg......................
                        + k+ +e+++G+E+E+  ++++g++ + ++ +  + +  + ++  
  ABE38048.1    22    EAGVKPPSEFRIGTEHEKTPFTLEGhhpvpyagargigallegmqll 68   

                   ..ldlvlaadellellgdlllgglitpElsesqlElatpvlesldellee
                     ++++++ +++++l++  ++gg+i++E++ +q+El++++l++++++++e
  ABE38048.1    69 lgWEPIMEGPHIIGLHDV-TGGGAISLEPG-GQFELSGAPLDNVHQTHAE 116  

                   lralrrvlrevaaelgllllplgthPladwseqrlspkprYktlieylgy
                   l+a+++++reva +lg+++l+lg+ P +++++++++pk+rYk++++y++ 
  ABE38048.1   117 LMAHLAQVREVATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMTNYMPK 166  

                   lg.....rrmlicglHvhlgvssedeavallnllrrllPlllALsAsSPf
                   +g +  ++++++c+++ +l++sse+++v++l++  +l+P+ +AL+A+SPf
  ABE38048.1   167 VGsygldMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATALFANSPF 216  

                   ldGkdtgyaslRllvfgalpdag...lpplfdswaeyeeyvelllntgvi
                    +Gk++g++s+R+ +++++++a+  ++p+ f++ +++e++v+++l+++++
  ABE38048.1   217 TEGKPNGFLSFRSEIWRDTDNARsgmIPWAFEDGMGFERWVDYALDVPMY 266  

                   q......................................ilselwwdvRp
                   +++  ++++++      +  + ++++   +  +  + +++ls+++++vR+
  ABE38048.1   267 FvkrgdhyidvsgssfrdffdgkneklpgerptlsdwanHLSTIFPEVRL 316  

                   kpglgtvElRvlDvqptlaellalaallralvlyl..lleagllllllda
                   k    ++E+R +D++p+  +l al a++++l+++ + l++a++ +  +da
  ABE38048.1   317 K---RYLEMRGADGVPW-GRLPALPAFWVGLLYDDtsLDAAWEIVKGWDA 362  

                   llleenlwrAaryGldaelidladgreillrelleellellapvaeelge
                   + +++ ++ + r G++a++        + l e+++e+l l++++++++g+
  ABE38048.1   363 SERQALRDDVPRLGFKARI------GNRFLFEIARECLVLAHAGLRRRGR 406  

                   le........lleplaerilergngAerqlellaeggslkavvdelieel
                    +   ++++ +l++l +++  ++++Ae +le +  +g++++ v+ +++e+
  ABE38048.1   407 IDgfghdetrHLAALDQILDAGRTPAEEMLEKF--DGAWRGSVEPAYDEY 454  

                   rkfksseeltlGvElElllvdldgldlvlaad................
                      ++k+ +e+++G+E+E   ++l+g+++v++a++  + +  + ++    
  ABE38048.1    24    GVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGargigallegmqlllg 70   

                   .......ellaalggallggaitpElgesqlElitpvlesldevlaella
                    + +++ +++  l+++++ggai++E+g +q+El++++l+++++++ael+a
  ABE38048.1    71 wepimegPHIIGLHDVTGGGAISLEPG-GQFELSGAPLDNVHQTHAELMA 119  

                   lrrvlrellaelglgllplgthPfldweeqiitpkprYrellerlryva.
                   +++++re++ +lg+g+l+lg+ P +++e+++++pk+rY++++++++ v+ 
  ABE38048.1   120 HLAQVREVATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMTNYMPKVGs 169  

                   ....reqvicgvHvnlgvpseeeavallralrrllPlllALsAsSPfleG
                   +  ++++++c+v+ nl+++se+++v++lr+ ++l+P+ +AL+A+SPf eG
  ABE38048.1   170 ygldMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEG 219  

                   kdtgyaslRllvfgalpda...glpplfdsldeyesyvellldtgviqie
                   k++g++s+R+ +++++++a   ++p+ f++  ++e++v++ ld++++++ 
  ABE38048.1   220 KPNGFLSFRSEIWRDTDNArsgMIPWAFEDGMGFERWVDYALDVPMYFVK 269  

                   ke......................................lwwdvRpkpg
                   + ++++++      +  + ++++   +  +  + +++  +++++vR+k  
  ABE38048.1   270 RGdhyidvsgssfrdffdgkneklpgerptlsdwanhlstIFPEVRLK-- 317  

                   lgtlElRvlDvqptleellalaallrllvllllledglllpllpvsllde
                     +lE+R +D++p+ +    l al +++v ll+ +++l+++++ v+ +d+
  ABE38048.1   318 -RYLEMRGADGVPWGR----LPALPAFWVGLLYDDTSLDAAWEIVKGWDA 362  

                   nlwraarygldaelilaadgeelslrelleellellapvaeelg......
                    +++a+r ++ ++l + a ++ + l e+++e+l l+ + ++++g ++   
  ABE38048.1   363 SERQALRDDV-PRLGFKARIGNRFLFEIARECLVLAHAGLRRRGridgfg 411  

                   ..elellapllelilergtlAerllelleeggdlkavvdelaeelr