RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABE38119.1 rpal2 ABE38119.1 GIB00345CH01 "benzoyl-CoA
oxygenase, component B"
         (496 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3dhiA [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA               104   6e-25
3dhgA [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA                96   2e-22
3dhgD [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA                73   1e-15
3chhB [x.x.x] P-AMINOBENZOATE N-OXYGENASE                              72   3e-15
3dhhB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT         64   8e-13
3dhiB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT         63   2e-12
3dhgB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT         49   3e-08
2bq1I [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA              37   2e-04

>3dhiA [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
          Length = 498

 Score =  104 bits (259), Expect = 6e-25
 Identities = 31/242 (12%), Positives = 75/242 (30%), Gaps = 18/242 (7%)

Query: 31  VDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPD 90
           +    D   L     W P Y+        + F + +             + +      P+
Sbjct: 2   MHPRKDWYELTRATNWTPSYVTE-----EQLFPERMSGHMGIPLEKWESYDEPYKTSYPE 56

Query: 91  YRWGVLLAPQEENRTIP-FGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQRHL 149
           Y   V +  +++               ++     + + L+         E A+V  +  +
Sbjct: 57  Y---VSIQREKDAGAYSVKAALERAKIYENSDPGWISTLKSHYGAIAVGEYAAVTGEGRM 113

Query: 150 GKTAPSLYDMRNLFQVNV-EEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADS-PR 207
            + + +    RN+    + +E RH    ++   +Y  +D + +        +  A    +
Sbjct: 114 ARFSKAP-GNRNMATFGMMDELRHGQLQLFFPHEYCKKDRQFDWAWRAYHSNEWAAIAAK 172

Query: 208 MLGAFNEATPDWLSFFMFTYFTDRDGKMQLHSL------AQSGFDPLSRTCRFMLTEEAH 261
                     D +S  +   F+   G   +  L      A++G    +     + T+E+ 
Sbjct: 173 HFFDDIITGRDAISVAIMLTFSFETGFTNMQFLGLAADAAEAGDYTFANLISSIQTDESR 232

Query: 262 HM 263
           H 
Sbjct: 233 HA 234


>3dhgA [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
          Length = 491

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 28/245 (11%), Positives = 68/245 (27%), Gaps = 24/245 (9%)

Query: 31  VDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPD 90
           +    D   L     W P Y+        + F +    +     +    W  +     P 
Sbjct: 2   MHPRKDWYELTRATNWTPSYVTE-----EQLFPE---RMSGHMGIPLEKWESY---DEPY 50

Query: 91  YRWG---VLLAPQEENRTIP-FGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQ 146
                  V +  +++               ++     + + L+         E A+V  +
Sbjct: 51  KTSYPEYVSIQREKDAGAYSVKAALERAKIYENSDPGWISTLKSHYGAIAVGEYAAVTGE 110

Query: 147 RHLGKTAPSLYDMRNLFQVNV-EEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADS 205
             + + + +    RN+    + +E RH    ++   +Y  +D + +        +  A  
Sbjct: 111 GRMARFSKAP-GNRNMATFGMMDELRHGQLQLFFPHEYCKKDRQFDWAWRAYHSNEWAAI 169

Query: 206 P--RMLGAFNEATPDWLSFFMFTYFTDRDGKMQLH-----SLAQSGFDPLSRTCRFMLTE 258
                               M T+  +               A++G    +     + T+
Sbjct: 170 AAKHFFDDIITGRDAISVAIMLTFSFETGFTNMQFLGLAADAAEAGDYTFANLISSIQTD 229

Query: 259 EAHHM 263
           E+ H 
Sbjct: 230 ESRHA 234


>3dhgD [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
          Length = 492

 Score = 73.3 bits (178), Expect = 1e-15
 Identities = 26/225 (11%), Positives = 71/225 (31%), Gaps = 16/225 (7%)

Query: 50  YIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFG 109
           +   +     + F + +             + +      P+Y   V +  +++       
Sbjct: 17  WTPSYVTE-EQLFPERMSGHMGIPLEKWESYDEPYKTSYPEY---VSIQREKDAGAYSVK 72

Query: 110 EHYG-EPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYDMRNLFQVNV- 167
                   ++     + + L+         E A+V  +  + + + +    RN+    + 
Sbjct: 73  AALERAKIYENSDPGWISTLKSHYGAIAVGEYAAVTGEGRMARFSKAP-GNRNMATFGMM 131

Query: 168 EEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLGAFNEA--TPDWLSFFMF 225
           +E RH    ++     + +  R+         S +  +      F++     D +S  + 
Sbjct: 132 DELRHGQLQLFFP-HEYCKKDRQFDWAWRAYHSNEWAAIAAKHFFDDIITGRDAISVAIM 190

Query: 226 TYFTDRDGKMQLHSL------AQSGFDPLSRTCRFMLTEEAHHMF 264
             F+   G   +  L      A++G    +     + T+E+ H  
Sbjct: 191 LTFSFETGFTNMQFLGLAADAAEAGDYTFANLISSIQTDESRHAQ 235


>3chhB [x.x.x] P-AMINOBENZOATE N-OXYGENASE
          Length = 299

 Score = 72.2 bits (176), Expect = 3e-15
 Identities = 24/224 (10%), Positives = 50/224 (22%), Gaps = 8/224 (3%)

Query: 65  SLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEY 124
                R A         ++         +      +             EP  ++     
Sbjct: 10  RAWPRRAAVVNKADILDEWADYDTLVPDY----PLEIVPFAEHPLFLAAEPHQRQRVLTG 65

Query: 125 RAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYD---MRNLFQVNVEEGRHLWAMVYLLQ 181
             +     VI  +   A       +    P   D    +++ Q  V+E  H +  +  + 
Sbjct: 66  MWIGYNERVIATEQLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMHMLAID 125

Query: 182 KYFGRDGREEADDLLRRRSGDADSPRMLGAFNEATPDWLSFFMFTYFTDRDGKMQLHSLA 241
           +        E        +       +     +   D                +      
Sbjct: 126 RTRELRKISERPPQPELVTYRRLRRVLADMPEQWERDIAVLVWGAVAETCINALLALLAR 185

Query: 242 QSGFDP-LSRTCRFMLTEEAHHMFVGETGISRIVQRTCEAMRDA 284
            +   P  S      L +E  H  +    +  +  R  E  R A
Sbjct: 186 DATIQPMHSLITTLHLRDETAHGSIVVEVVRELYARMNEQQRRA 229


>3dhhB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
          Length = 305

 Score = 64.2 bits (155), Expect = 8e-13
 Identities = 23/241 (9%), Positives = 52/241 (21%), Gaps = 18/241 (7%)

Query: 46  WHPGYIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRT 105
           W        N    +  + +          +   +   D +    Y    +   QE    
Sbjct: 42  WELSPDSPMNLWYKQY-RNASPLKHD----NWDAFTDPDQLVYRTYNL--MQDGQESYVQ 94

Query: 106 IPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYDMRNLFQV 165
             F +       Q V   +   + R                 ++ + AP+   + N   +
Sbjct: 95  SLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFHCLQMSSAYVQQMAPAS-TISNCCIL 153

Query: 166 NV-EEGRHLWAMVYLLQKYFGRDGREEADDLLRR-RSGDADSPRMLGAFNEATPDWLSF- 222
              +  R L    Y   +           +  R     +     +     +    +    
Sbjct: 154 QTADSLRWLTHTAYRTHELSLTYPDAGLGEHERELWEKEPGWQGLRELMEKQLTAFDWGE 213

Query: 223 ------FMFTYFTDRDGKMQLHSLAQSGFDP-LSRTCRFMLTEEAHHMFVGETGISRIVQ 275
                  +            L   A    D  L       L +   H    +  +   ++
Sbjct: 214 AFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDAERHSRWSKALVKHALE 273

Query: 276 R 276
            
Sbjct: 274 N 274


>3dhiB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
          Length = 306

 Score = 62.6 bits (151), Expect = 2e-12
 Identities = 23/242 (9%), Positives = 49/242 (20%), Gaps = 18/242 (7%)

Query: 45  GWHPGYIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENR 104
            W        N    +    S +        +   +   D +    Y    +   QE   
Sbjct: 41  PWELSPDSPMNLWYKQYRNASPLKHD-----NWDAFTDPDQLVYRTYNL--MQDGQESYV 93

Query: 105 TIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYDMRNLFQ 164
              F +       Q V   +   + R                 ++ + AP+         
Sbjct: 94  QSLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFHCLQMSSAYVQQMAPASTISNCCIL 153

Query: 165 VNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDAD--SPRMLGAFNEATPDWLSF 222
              +  R L    Y           +       R   + +     +     +    +   
Sbjct: 154 QTADSLRWLTHTAYRT-HELSLTYPDAGLGEHERELWEKEPGWQGLRELMEKQLTAFDWG 212

Query: 223 -------FMFTYFTDRDGKMQLHSLAQSGFDP-LSRTCRFMLTEEAHHMFVGETGISRIV 274
                   +            L   A    D  L       L +   H    +  +   +
Sbjct: 213 EAFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDAERHSRWSKALVKHAL 272

Query: 275 QR 276
           + 
Sbjct: 273 EN 274


>3dhgB [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
          Length = 304

 Score = 49.1 bits (116), Expect = 3e-08
 Identities = 23/241 (9%), Positives = 51/241 (21%), Gaps = 18/241 (7%)

Query: 46  WHPGYIDWWNDMGPEGFQQSLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRT 105
           W        N    +    S +        +   +   D +    Y    +   QE    
Sbjct: 41  WELSPDSPMNLWYKQYRNASPLKHD-----NWDAFTDPDQLVYRTYNL--MQDGQESYVQ 93

Query: 106 IPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYDMRNLFQV 165
             F +       Q V   +   + R                 ++ + AP+   + N   +
Sbjct: 94  SLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFHCLQMSSAYVQQMAPAS-TISNCCIL 152

Query: 166 NV-EEGRHLWAMVYLLQKYFGR-DGREEADDLLRRRSGDADSPRMLGAFNEATPDWLSF- 222
              +  R L    Y   +           +        +     +     +    +    
Sbjct: 153 QTADSLRWLTHTAYRTHELSLTYPDAGLGEHERELWEKEPGWQGLRELMEKQLTAFDWGE 212

Query: 223 ------FMFTYFTDRDGKMQLHSLAQSGFDPLSRTC-RFMLTEEAHHMFVGETGISRIVQ 275
                  +            L   A    D L        L +   H    +  +   ++
Sbjct: 213 AFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDAERHSRWSKALVKHALE 272

Query: 276 R 276
            
Sbjct: 273 N 273


>2bq1I [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA
          Length = 294

 Score = 36.7 bits (84), Expect = 2e-04
 Identities = 21/176 (11%), Positives = 50/176 (28%), Gaps = 7/176 (3%)

Query: 115 PAWQEVPGEYRAMLRRLIVIQGDTEPASVEQQ-RHLGKTAPSLYDMRNLFQVNVEEGRHL 173
           PAWQ +    + +  R+       +          L   A + ++   L  ++  E  H 
Sbjct: 38  PAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHA 97

Query: 174 WAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLGAFNEATPDWLSF----FMFTYFT 229
            +   +          + A              +++ A   +           F+ ++  
Sbjct: 98  RSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLF 157

Query: 230 DRDGKMQLHSLAQSGFDPLSRT-CRFMLTEEAHHMFVGETGISRIVQRTCEAMRDA 284
              G       +  G    +    R ++ +EA H +         +Q+     R+ 
Sbjct: 158 YS-GFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREE 212


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.314    0.128    0.341 

Gapped
Lambda     K      H
   0.267   0.0498    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 40,577,234
Number of extensions: 2632353
Number of successful extensions: 29109
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 12832
Number of HSP's successfully gapped: 942
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)