RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABE39477.1 rpal2 ABE39477.1 GIB00345CH01 "Phenylacetic acid
degradation-related protein"
         (152 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF03061 4HBT "Thioesterase superfamily"                                34   3e-04

>PF03061 4HBT "Thioesterase superfamily"
          Length = 79

 Score = 33.6 bits (76), Expect = 3e-04
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 52  AGNVQGGFLAAMLDDTMGPALVATLGA-GEFAPTVSLNVQFHRPARVG-ALKGIGRVLLR 109
           AG+V GG  A +LD+  G A     GA G    TV LN+ + RP RVG  L+   RV+  
Sbjct: 1   AGHVHGGVYATLLDEARGAAAARLGGASGRGVVTVELNIDYLRPVRVGDRLEVRARVVRL 60

Query: 110 GKEVCQLSGELLQDDRVVA 128
           G+    +  E+  +D   A
Sbjct: 61  GRRSATVEVEVRDEDGAAA 79


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0516    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,029,215
Number of extensions: 720498
Number of successful extensions: 94350
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1631
Number of HSP's successfully gapped: 207
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)