RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE37664.1 rpal2 ABE37664.1 GIB00345CH01 "protein of unknown
function DUF299"
         (279 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1lwdA [c.77.1.1] ISOCITRATE DEHYDROGENASE                              35   2e-04

>1lwdA [c.77.1.1] ISOCITRATE DEHYDROGENASE
          Length = 413

 Score = 34.6 bits (79), Expect = 2e-04
 Identities = 22/156 (14%), Positives = 42/156 (26%), Gaps = 18/156 (11%)

Query: 132 SMMHDDGQHVEGLEEADVVLVGVSRTSKT--------PTSIYLANRGIR-----TANVPL 178
             +  D       ++  V +   + T                  N  IR     T     
Sbjct: 55  DQVTIDS--ALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREP 112

Query: 179 VAGIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLGAGAGNDSYIDRQAVTDEVLL 238
           +    IP  +    KP+ +  HA  D   Q +    +   AG     +  +   + +   
Sbjct: 113 IICKNIPRLVPGWTKPITIGRHAHGD---QYKATDFVVDRAGTFKIVFTPKDGSSAKQWE 169

Query: 239 ARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQR 274
                A      +  T  SI   A +  +    ++ 
Sbjct: 170 VYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKW 205


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0607    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 14,178,006
Number of extensions: 1049138
Number of successful extensions: 5147
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5003
Number of HSP's successfully gapped: 245
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)