RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE38106.1 rpal2 ABE38106.1 GIB00345CH01 "diguanylate cyclase"
         (494 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1w25A3 [d.58.29.2] STALKED-CELL DIFFERENTIATION CONTROLLING PROT...   117   2e-29
3byqA1 [d.79.9.1] UNCHARACTERIZED PROTEIN DUF1185 A:2 -- 192           95   2e-22
1wc0A [d.58.29.1] ADENYLATE CYCLASE                                    72   2e-15
1azsA [d.58.29.1] VC1                                                  71   3e-15
2p7jA2 [d.110.6.2] PUTATIVE SENSORY BOX/GGDEF FAMILY PROTEIN A:9...    57   6e-11
3by8A1 [d.110.6.1] SENSOR PROTEIN DCUS A:46 -- 178                     49   1e-08

>1w25A3 [d.58.29.2] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
           A:294 -- 455
          Length = 162

 Score =  117 bits (295), Expect = 2e-29
 Identities = 54/162 (33%), Positives = 77/162 (47%), Gaps = 6/162 (3%)

Query: 330 LTGLINRRKFDTLIEREWRRALRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALC 389
           LTGL NRR     ++   +RA     P++ L+ID D FK  ND +GH  GD+VL   AL 
Sbjct: 1   LTGLHNRRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALR 60

Query: 390 IGDSVQRAGDCAARFGGEEFAVLLPGGSATAAQGVAETIRNKVA----HWSVGQGDVTVS 445
           +  +V RA D   R+GGEEF V++P  +   A  +AE IR  V+      + G+  + V+
Sbjct: 61  LASNV-RAIDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVT 119

Query: 446 IGVASMT-PAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAAS 486
           I +        G     L +            GRN  V  A+
Sbjct: 120 ISIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA 161


>3byqA1 [d.79.9.1] UNCHARACTERIZED PROTEIN DUF1185 A:2 -- 192
          Length = 191

 Score = 94.8 bits (235), Expect = 2e-22
 Identities = 20/173 (11%), Positives = 34/173 (19%), Gaps = 18/173 (10%)

Query: 329 SLTGLINRRKFDTLIEREWRR------------ALRMNTPIALLIIDADHFKAFNDGYGH 376
           SL  +  R         E               A+  N        D   F A     G 
Sbjct: 1   SLIEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRYEPDLXPFXAELRSLGT 60

Query: 377 QAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATAAQGVAETIRNKVAHWS 436
               +++  +     +            G  E   +       A + V    +  V    
Sbjct: 61  LLATELVDTLGKDNIEVY-SKAAIVGVDGEXEHGAVWHEAGGWAXRSVLGEPKAXVP--- 116

Query: 437 VGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAASRHD 489
                   + G     P    H   +               R   ++ A    
Sbjct: 117 --AVKAVATAGYRXXVPVHYIHASYVRSHFNSIEIGIQDAPRPREILFALVXG 167


>1wc0A [d.58.29.1] ADENYLATE CYCLASE
          Length = 198

 Score = 71.6 bits (174), Expect = 2e-15
 Identities = 11/110 (10%), Positives = 23/110 (20%)

Query: 349 RALRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEE 408
                   I +L  D   F   ++    Q   ++L      +  +V        +F G+ 
Sbjct: 2   HMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDA 61

Query: 409 FAVLLPGGSATAAQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQH 458
              L       +                V    +        +       
Sbjct: 62  IMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVP 111


>1azsA [d.58.29.1] VC1
          Length = 190

 Score = 71.0 bits (173), Expect = 3e-15
 Identities = 9/106 (8%), Positives = 27/106 (25%), Gaps = 1/106 (0%)

Query: 344 ER-EWRRALRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAA 402
           +    +  ++ +  +++L  D + F +       Q     L  +                
Sbjct: 1   DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRI 60

Query: 403 RFGGEEFAVLLPGGSATAAQGVAETIRNKVAHWSVGQGDVTVSIGV 448
           +  G+ +  +     A A               ++        + V
Sbjct: 61  KILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNV 106


>2p7jA2 [d.110.6.2] PUTATIVE SENSORY BOX/GGDEF FAMILY PROTEIN A:9 --
           180
          Length = 172

 Score = 56.7 bits (136), Expect = 6e-11
 Identities = 17/172 (9%), Positives = 47/172 (27%), Gaps = 19/172 (11%)

Query: 41  NAQELARQTQENLASTISADINRNIEAYDLSLRSVVSNLALPQ-LAHVDETLRRLILFDH 99
           N  E   +   +  +    + N   +  +     +  + +L   L    +    ++    
Sbjct: 1   NNVENTAKEALHQLAYTGREYNNIQDQIETISDLLGHSQSLYDYLREPSKANLTILENXW 60

Query: 100 ASIARH---FGSIQVFDAQGNLTIDS--------ATLTPEKLNRGDEPFVSAHRDDPTVG 148
           +S+AR+   +  I+  D  G   +          A  +    ++    +    +      
Sbjct: 61  SSVARNQKLYKQIRFLDTSGTEKVRIKYDFKTSIAGPSLILRDKSAREYFKYAQSLDNEQ 120

Query: 149 LYISRPMQHRGTFAIVLSRRISGT-------DGRFLGVVAGSIRFSYFKQVF 193
           +        R    +V     S         +    G +  ++   Y   + 
Sbjct: 121 ISAWGIELERDKGELVYPLSPSLRILXPISVNDVRQGYLVLNVDIEYLSSLL 172


>3by8A1 [d.110.6.1] SENSOR PROTEIN DCUS A:46 -- 178
          Length = 133

 Score = 49.1 bits (116), Expect = 1e-08
 Identities = 16/136 (11%), Positives = 36/136 (26%), Gaps = 8/136 (5%)

Query: 61  INRNIEAYDLSLRSVVSNLA--LPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNL 118
               +    L++   +++       L    +      + +          I V D Q   
Sbjct: 3   TRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLR 62

Query: 119 TIDSATLTPEKLNRGDEPFVSAHRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLG 178
                           +  + A   +  V +            A+ +   I   + + +G
Sbjct: 63  YSHP-EAQRIGQPFKGDDILKALNGEENVAINRGF-----LAQALRVFTPIYDENHKQIG 116

Query: 179 VVAGSIRFSYFKQVFS 194
           VVA  +  S   Q  +
Sbjct: 117 VVAIGLELSRVTQQIN 132


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.135    0.375 

Gapped
Lambda     K      H
   0.267   0.0622    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,053,261
Number of extensions: 1057956
Number of successful extensions: 4367
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 4167
Number of HSP's successfully gapped: 178
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)