RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE38488.1 rpal2 ABE38488.1 GIB00345CH01 "Alcohol
dehydrogenase, zinc-binding"
         (339 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o89A2 [c.2.1.1] YHDH A:116 -- 292                                    114   1e-28
1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326                   113   2e-28
1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294                  111   1e-27
1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339             110   2e-27
1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294                      105   6e-26
1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --...   105   7e-26
1pqwA [c.2.1.1] POLYKETIDE SYNTHASE                                   104   2e-25
1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A...   102   8e-25
1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269                   100   2e-24
1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312      100   3e-24
1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309                    99   5e-24
1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --...    94   3e-22
1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313     89   1e-20
1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323                         88   1e-20
1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327       81   2e-18
1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302        80   4e-18
1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142 ...    80   5e-18
1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --...    80   5e-18
1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A...    79   6e-18
1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 -...    79   7e-18
1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355               79   1e-17
1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329           78   1e-17
1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415                       72   1e-15
1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383                         71   3e-15
1o8cA2 [c.2.1.1] YHDH A:116 -- 192                                     70   3e-15
1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 13...    69   6e-15
1gv8A [c.94.1.2] OVOTRANSFERRIN                                        68   2e-14
1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 ...    66   5e-14
1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- ...    65   1e-13
1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 -...    65   2e-13
1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE- A...    56   5e-11
1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331          56   7e-11
1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291                   55   2e-10
1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A...    51   2e-09
1y88A2 [c.52.1.30] HYPOTHETICAL PROTEIN AF1548 A:3 -- 127              51   2e-09
1escA [c.23.10.1] ESTERASE                                             48   2e-08
1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:...    46   8e-08
1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349                44   3e-07
2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374              42   1e-06
1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470                         41   2e-06
1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605     40   4e-06
1p9oA [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE                39   8e-06
2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101                 38   1e-05
1a27A [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE                   37   4e-05
2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336         36   5e-05
1snyA [c.2.1.2] SNIFFER CG10964-PA                                     36   6e-05
1h5qA [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE                  35   1e-04
1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:71...    35   1e-04
1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247         35   1e-04
2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215                34   2e-04
1jvsA2 [c.2.1.3] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE...    34   2e-04
1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1                   34   2e-04
1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127...    34   3e-04
1a9yA [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE                              34   3e-04
1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1            34   3e-04
1k6iA [c.2.1.2] NMRA                                                   34   3e-04
1bdbA [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE         34   4e-04
2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11...    34   4e-04
1ae1A [c.2.1.2] TROPINONE REDUCTASE-I                                  33   5e-04
2ayiA1 [e.60.1.1] AMINOPEPTIDASE T A:3 -- 408                          33   7e-04
1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 -...    33   7e-04
1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:1...    32   8e-04
2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:...    32   9e-04

>1o89A2 [c.2.1.1] YHDH A:116 -- 292
          Length = 177

 Score =  114 bits (287), Expect = 1e-28
 Identities = 36/190 (18%), Positives = 68/190 (35%), Gaps = 24/190 (12%)

Query: 126 SFEQAAALPVAYGTAHRMM--TTNGHVKAGE-KVLILGASGGVGVCCVQLAKIAGAYVIA 182
              +A  +  A  TA   +    +  V+  + ++++ GASGGVG   V L    G  V+A
Sbjct: 2   DARKAMIIGTAGFTAMLCVMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVA 61

Query: 183 CAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGG 242
            +G E   + LK +GA  V+   +    + +                       ++  G 
Sbjct: 62  VSGRESTHEYLKSLGASRVLPRDEFAESRPLE---------------KQVWAGAIDTVGD 106

Query: 243 DTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSN--GWERDD----IEK 296
               K L  +  GG +  CG   G+     +       ++++G +      +      ++
Sbjct: 107 KVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQR 166

Query: 297 LFALLASGKL 306
           L A L     
Sbjct: 167 LVADLPESFY 176


>1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
          Length = 172

 Score =  113 bits (285), Expect = 2e-28
 Identities = 44/187 (23%), Positives = 70/187 (37%), Gaps = 17/187 (9%)

Query: 121 IPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAY- 179
           I       + A L  A  TA+R +            + +   GG+G   VQL K+     
Sbjct: 1   ISRE-KLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPAT 59

Query: 180 VIACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNF 239
           VIA    EEK +  + +GAD V+   ++   QV+    G             GV+V ++F
Sbjct: 60  VIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRG------------RGVNVAMDF 107

Query: 240 TGGD-TWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLF 298
            G   T   +   L   GR++  G             + + E+   GS      ++ +L 
Sbjct: 108 VGSQATVDYTPYLLGRMGRLIIVGYGGELRF--PTIRVISSEVSFEGSLVGNYVELHELV 165

Query: 299 ALLASGK 305
            L   GK
Sbjct: 166 TLALQGK 172


>1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
          Length = 174

 Score =  111 bits (278), Expect = 1e-27
 Identities = 49/182 (26%), Positives = 90/182 (49%), Gaps = 15/182 (8%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA 184
           + F+Q AA+ + Y TA+R +  +  VKAGE VL+ GASGGVG+   Q+A+  G  ++  A
Sbjct: 1   LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA 60

Query: 185 GSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDT 244
           G+EE  + + + GA EV  + + +++  +++  G             G+D+++       
Sbjct: 61  GTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVG-----------EKGIDIIIEMLANVN 109

Query: 245 WVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSN--GWERDDIEKLFALLA 302
             K L  L  GGR++  G+    +   + R     E  + G       +++ ++  A L 
Sbjct: 110 LSKDLSLLSHGGRVIVVGSRGTIEI--NPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQ 167

Query: 303 SG 304
           +G
Sbjct: 168 AG 169


>1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
          Length = 176

 Score =  110 bits (277), Expect = 2e-27
 Identities = 31/185 (16%), Positives = 54/185 (29%), Gaps = 17/185 (9%)

Query: 127 FEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGS 186
            E+   +   + T +        V  G    + G  G      +       A +I    +
Sbjct: 3   LEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDIN 62

Query: 187 EEKGQRLKEVGADEVILYTK-EDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGD-- 243
           ++K  + KEVGA E +     +  +Q V                NGGVD      G    
Sbjct: 63  KDKFAKAKEVGATECVNPQDYKKPIQEVLTEMS-----------NGGVDFSFEVIGRLDT 111

Query: 244 TWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGS---NGWERDDIEKLFAL 300
                    +  G  +  G            ++       +G+       +D + KL A 
Sbjct: 112 MVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVAD 171

Query: 301 LASGK 305
             + K
Sbjct: 172 FMAKK 176


>1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
          Length = 182

 Score =  105 bits (264), Expect = 6e-26
 Identities = 45/196 (22%), Positives = 79/196 (40%), Gaps = 26/196 (13%)

Query: 121 IPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYV 180
           +P +++      + +   TA+  +     VK GE VL+  A+G VG    Q+AK+ G  V
Sbjct: 1   LPLSLA---LGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKV 57

Query: 181 IACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFT 240
           +  AGS+EK   LK++G D    Y   + ++   ++               G D   +  
Sbjct: 58  VGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKAS-----------PDGYDCYFDNV 106

Query: 241 GGDTWVKSLRTLKLGGRILTCGATAGYDPAE------DLRVIWTFELQVRGSNGWERD-- 292
           GG+     L  +K  G+I  CGA + Y+  +          I   +L++ G   +     
Sbjct: 107 GGEFLNTVLSQMKDFGKIAICGAISVYNRMDQLPPGPSPESIIYKQLRIEGFIVYRWQGD 166

Query: 293 ----DIEKLFALLASG 304
                +  L   +  G
Sbjct: 167 VREKALRDLMKWVLEG 182


>1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
           397
          Length = 201

 Score =  105 bits (263), Expect = 7e-26
 Identities = 30/208 (14%), Positives = 53/208 (25%), Gaps = 38/208 (18%)

Query: 1   MRAMVLREHGGLEKLSFD---SNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIP 57
            R +V    G +E    D      P        V+L+V +T++   D    RG    +  
Sbjct: 2   NRGVVYLGSGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQ-- 59

Query: 58  LPVIMGLDXXXXXXXXXXXXXXXXXXDRVLVDP-------------------------LN 92
           + +++G +                  D V V                             
Sbjct: 60  VGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAG 119

Query: 93  RVEGGLMGETMNGGLAE--LCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHV 150
              G +      GG AE  L       L+++PD     +   +    G           +
Sbjct: 120 GAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKINIAEVVGVQVIS------L 173

Query: 151 KAGEKVLILGASGGVGVCCVQLAKIAGA 178
               +      +G      +   K   A
Sbjct: 174 DDAPRGYGEFDAGVPKKFVIDPHKTFSA 201


>1pqwA [c.2.1.1] POLYKETIDE SYNTHASE
          Length = 183

 Score =  104 bits (260), Expect = 2e-25
 Identities = 53/188 (28%), Positives = 85/188 (45%), Gaps = 20/188 (10%)

Query: 129 QAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEE 188
           +AA   VAY TA   +   G +  GE+VLI  A+GGVG+  V +AK+ GA +   AGS+ 
Sbjct: 2   EAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDA 61

Query: 189 KGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKS 248
           K + L  +G + V      DF   + +            ++  GVDVV+N   G+   + 
Sbjct: 62  KREMLSRLGVEYVGDSRSVDFADEILE-----------LTDGYGVDVVLNSLAGEAIQRG 110

Query: 249 LRTLKLGGRILTCGATAGY-DPAEDLRVI--------WTFELQVRGSNGWERDDIEKLFA 299
           ++ L  GGR +  G    Y D +  L  +           +L ++      R  ++ +  
Sbjct: 111 VQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQ 170

Query: 300 LLASGKLR 307
            +A GKL 
Sbjct: 171 HVADGKLE 178


>1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
           -- 250
          Length = 228

 Score =  102 bits (254), Expect = 8e-25
 Identities = 12/171 (7%), Positives = 33/171 (19%), Gaps = 15/171 (8%)

Query: 104 NGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMM---TTNGHVKAGEKVLILG 160
             G   +              +     A            +       HV +G+ +  L 
Sbjct: 59  PVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLXHLA 118

Query: 161 ASGGVGVCCVQLAKIAGAYVI-ACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGR 219
               +      +A+      +     S    +  ++V       +T    +         
Sbjct: 119 PGFKLDHAWAGIARAVVEGRLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIR- 177

Query: 220 PQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPA 270
                       G+  ++ +         +          T   +      
Sbjct: 178 ----------AAGIKCLLTYKPDVYTYLGIYRANRWHLCPTLYESRFQGSR 218


>1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
          Length = 168

 Score =  100 bits (251), Expect = 2e-24
 Identities = 51/190 (26%), Positives = 77/190 (40%), Gaps = 22/190 (11%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA 184
           +S E+AAA PV++ TA+  +      + GEKVL+  A+G +G   VQ+A+  G  V+A A
Sbjct: 1   LSPEEAAAFPVSFLTAYLALKR-AQARPGEKVLVQAAAGALGTAAVQVARAMGLRVLAAA 59

Query: 185 GSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDT 244
              EK      +GA+E   Y +                        GG+D+V+   G + 
Sbjct: 60  SRPEKLALPLALGAEEAATYAEVPERAK----------------AWGGLDLVLEVRGKEV 103

Query: 245 WVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFALLASG 304
             +SL  L  GGR++  GA     P   L       L V G           L      G
Sbjct: 104 E-ESLGLLAHGGRLVYIGAAEAPIPPLRL---MRRNLAVLGFWLTPLLREGALVEEAL-G 158

Query: 305 KLRAQVDKAF 314
            L  ++ +  
Sbjct: 159 FLLPRLGREL 168


>1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
          Length = 170

 Score =  100 bits (250), Expect = 3e-24
 Identities = 37/181 (20%), Positives = 67/181 (37%), Gaps = 11/181 (6%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA 184
           VS E   AL                V+ G  VL++GA G +G+  V  AK  GA+V+  A
Sbjct: 1   VSLE-EGALLEPLSVGVHACRR-AGVQLGTTVLVIGA-GPIGLVSVLAAKAYGAFVVCTA 57

Query: 185 GSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDT 244
            S  + +  K  GAD  ++           +     +R+   S+     +V ++ +G + 
Sbjct: 58  RSPRRLEVAKNCGADVTLVVDPAK-----EEESSIIERI--RSAIGDLPNVTIDCSGNEK 110

Query: 245 WVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFALLASG 304
            +     +   G  L             L      E+ ++    +  +D      ++ASG
Sbjct: 111 CITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRY-CNDYPIALEMVASG 169

Query: 305 K 305
           +
Sbjct: 170 R 170


>1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
          Length = 166

 Score = 99.4 bits (247), Expect = 5e-24
 Identities = 38/180 (21%), Positives = 72/180 (40%), Gaps = 15/180 (8%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA 184
           V F + A +  A  T ++ +      + G+ V I G  GG+G   VQ A+  G +V A  
Sbjct: 1   VEFAEIAPILCAGVTVYKGLKQTN-ARPGQWVAISGI-GGLGHVAVQYARAMGLHVAAID 58

Query: 185 GSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDT 244
             + K +  +++GA   +   +ED ++ +++               G   V+V       
Sbjct: 59  IDDAKLELARKLGASLTVNARQEDPVEAIQRDI------------GGAHGVLVTAVSNSA 106

Query: 245 WVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFALLASG 304
           + +++   + GG I   G   G  P   +  +    L + GS    R D+++       G
Sbjct: 107 FGQAIGMARRGGTIALVGLPPGDFPT-PIFDVVLKGLHIAGSIVGTRADLQEALDFAGEG 165


>1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
           337
          Length = 182

 Score = 93.6 bits (232), Expect = 3e-22
 Identities = 32/185 (17%), Positives = 63/185 (34%), Gaps = 15/185 (8%)

Query: 127 FEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA-G 185
            +  A    +  TA+          AG+ V+I GA G +G+  V +A+  GA  +    G
Sbjct: 3   LDVLAMAMCSGATAYHAFDEYPESFAGKTVVIQGA-GPLGLFGVVIARSLGAENVIVIAG 61

Query: 186 SEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGD-T 244
           S  + +  +E+GAD  +   +    +  +                 G D ++  TG    
Sbjct: 62  SPNRLKLAEEIGADLTLNRRETSVEERRKAIMDIT--------HGRGADFILEATGDSRA 113

Query: 245 WVKSLRTLKLGGRILTCGATAGYDPAEDLRV---IWTFELQVRGSNGWERDDIEKLFALL 301
            ++    L+ GG   +    A        +V   +       +G    +     K  ++ 
Sbjct: 114 LLEGSELLRRGGFY-SVAGVAVPQDPVPFKVYEWLVLKNATFKGIWVSDTSHFVKTVSIT 172

Query: 302 ASGKL 306
           +    
Sbjct: 173 SRNYQ 177


>1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
          Length = 174

 Score = 88.5 bits (219), Expect = 1e-20
 Identities = 37/187 (19%), Positives = 63/187 (33%), Gaps = 19/187 (10%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIA-GAYVIAC 183
           +  E A  +P    T          ++ G  V +LG  G VG+  V  AK+     +IA 
Sbjct: 1   IPLEAAVMIPDMMTTGFHGAEL-ADIELGATVAVLGI-GPVGLMAVAGAKLRGAGRIIAV 58

Query: 184 AGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTG-G 242
                     K  GA +++ Y        +              +E  GVD  +   G  
Sbjct: 59  GSRPVCVDAAKYYGATDIVNYKDGPIESQIMN-----------LTEGKGVDAAIIAGGNA 107

Query: 243 DTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTF---ELQVRGS-NGWERDDIEKLF 298
           D    +++ +K GG I         +     R+ W        ++G      R  +E+L 
Sbjct: 108 DIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLI 167

Query: 299 ALLASGK 305
            L+   +
Sbjct: 168 DLVFYKR 174


>1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
          Length = 143

 Score = 88.3 bits (218), Expect = 1e-20
 Identities = 28/140 (20%), Positives = 48/140 (34%), Gaps = 12/140 (8%)

Query: 20  NFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXXXXXXXXXXX 79
              +  +  GDV + V  +SLNY D     G   I    P+I G+D              
Sbjct: 16  TLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAGTVRTSEDPR 73

Query: 80  XXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGT 139
                 V       + G  +GE   GGLAE  + +   LV +P   + ++ +        
Sbjct: 74  FHAGQEV------LLTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEISLSEAPNFA 127

Query: 140 AHRMMTTNGHVKAGEKVLIL 159
              +     +   G  ++ +
Sbjct: 128 EAIIN----NQIQGRTLVKV 143


>1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
          Length = 147

 Score = 80.9 bits (199), Expect = 2e-18
 Identities = 27/158 (17%), Positives = 48/158 (30%), Gaps = 14/158 (8%)

Query: 2   RAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVI 61
             +   +HGG E L     F   D    ++ +  +A  +N+ D + R G+      LP  
Sbjct: 2   TRIEFHKHGGPEVLQAV-EFTPADPAENEIQVENKAIGINFIDTYIRSGLYPPP-SLPSG 59

Query: 62  MGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRI 121
           +G +                  DRV+              +  G  + +    A +   +
Sbjct: 60  LGTEAAGIVSKVGSGVKHIKAGDRVVYAQ-----------SALGAYSSVHNIIADKAAIL 108

Query: 122 PDNVSFEQAAALPVAYGTAHRMMTTN-GHVKAGEKVLI 158
           P  +  + A         A R           G  +LI
Sbjct: 109 PAAIKVDVAEQQKYPLKDAQRAHEILESRATQGSSLLI 146


>1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
          Length = 131

 Score = 79.9 bits (197), Expect = 4e-18
 Identities = 39/150 (26%), Positives = 57/150 (38%), Gaps = 28/150 (18%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
           M+A VL+  GG  +L    + P+P+   G+V+LRV A  LN+ D   R G    ++  P 
Sbjct: 1   MKAWVLKRLGGPLELV---DLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPF 57

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVR 120
           I G++                    V V    R    +      GGLAE        L+ 
Sbjct: 58  IPGMEV-------------------VGVVEGRRYAALVPQ----GGLAERVAVPKGALLP 94

Query: 121 IPDNVSFEQAAALPVAYG-TAHRMMTTNGH 149
           +P+          P A    A R +   GH
Sbjct: 95  LPEGRPVV-GPVFPFAEAEAAFRALLDRGH 123


>1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
           A:313 -- 351
          Length = 178

 Score = 79.5 bits (195), Expect = 5e-18
 Identities = 26/180 (14%), Positives = 52/180 (28%), Gaps = 24/180 (13%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRR--GMPGIKIPL 58
           + A++         L  +   P P+    +VLL++    +   D+       +    +  
Sbjct: 3   LSAVL----YKQNDLRLE-QRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKD 57

Query: 59  PVIMGLDXXXXXXXXXXXXXXXXXXDRVLVDP----------------LNRVEGGLMGET 102
           P+++G +                  DRV V+P                L           
Sbjct: 58  PMVIGHEASGTVVKVGKNVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPP 117

Query: 103 MNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGAS 162
            +G LA      A    ++PDN + +Q                     KA   + ++ + 
Sbjct: 118 DDGNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTVDAFEA-ARKKADNTIKVMISC 176


>1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
           386
          Length = 175

 Score = 79.5 bits (195), Expect = 5e-18
 Identities = 25/174 (14%), Positives = 53/174 (30%), Gaps = 6/174 (3%)

Query: 1   MRAMVLREHGGLEKLSF--DSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPL 58
            +A++  +HG  + + F       D ++ P +V+++   + +N  DI   +G+   K   
Sbjct: 4   AQAVLYTQHGEPKDVLFTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPSKPAK 63

Query: 59  PVIMGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQL 118
               G                        V  L   +  +      G             
Sbjct: 64  TTGFGTTEPAAPCGNEGLFEVIKVGSN--VSSLEAGDWVIPSHVNFGTWRTHALGNDDDF 121

Query: 119 VRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILG-ASGGVGVCCVQ 171
           +++P+    + A   P     A  + T     K   ++   G A+   G   + 
Sbjct: 122 IKLPNPAQSK-ANGKPNGLTDAKSIETLYDGTKPLHELYQDGVANSKDGKQLIT 174


>1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
           -- 127
          Length = 127

 Score = 79.4 bits (195), Expect = 6e-18
 Identities = 20/128 (15%), Positives = 38/128 (29%), Gaps = 6/128 (4%)

Query: 148 GHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIA-CAGSEEKGQRLKEVGADEVILYTK 206
                 + +LILGA G + +        +GA           +   +    A  +     
Sbjct: 2   PKRTDIKSILILGA-GPIVIGQACEFDYSGAQACKALREEGYRVINVNSNPATIMTDPEM 60

Query: 207 EDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAG 266
            D   +        +++          D V+   GG T +     L+  G +   G T  
Sbjct: 61  ADATYIEPIHWEVVRKIIEK----ERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMI 116

Query: 267 YDPAEDLR 274
              A+ + 
Sbjct: 117 GATADAID 124


>1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
           374
          Length = 198

 Score = 79.1 bits (194), Expect = 7e-18
 Identities = 25/193 (12%), Positives = 41/193 (21%), Gaps = 31/193 (16%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
            +A VL E      +              +V +++ AT +   D     G      PLPV
Sbjct: 9   CKAAVLWEEKKPFSIE---EVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT--PLPV 63

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDP----------------LNRVEGGLMGETMN 104
           I G +                  D+V+                           M     
Sbjct: 64  IAGHEAAGIVESIGEGVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTM 123

Query: 105 GGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTN----------GHVKAGE 154
                    R   +       +F Q   +                          +  G 
Sbjct: 124 QDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAAFALDPLITHVLPFEKINEGF 183

Query: 155 KVLILGASGGVGV 167
            +L  G S    +
Sbjct: 184 DLLRSGESIRTIL 196


>1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
          Length = 195

 Score = 78.6 bits (193), Expect = 1e-17
 Identities = 31/196 (15%), Positives = 53/196 (27%), Gaps = 20/196 (10%)

Query: 128 EQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGA-YVIACAGS 186
                L     T +        V  G  V + GA G VG+     A++ GA  VI    +
Sbjct: 2   RDLTCLSDILPTGYHG-AVTAGVGPGSTVYVAGA-GPVGLAAAASARLLGAAVVIVGDLN 59

Query: 187 EEKGQRLKEVGADEVILYTKEDFMQVVRQRHG-----RPQRVGGGSSENGGVDVVVNFTG 241
             +    K  G +   L       + +    G           G  +   G +   +   
Sbjct: 60  PARLAHAKAQGFEIADLSLDTPLHEQIAALLGEPEVDCAVDAVGFEARGHGHEGAKHEAP 119

Query: 242 GDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWER---------- 291
                  ++  ++ G+I   G     DP           L +R   GW +          
Sbjct: 120 ATVLNSLMQVTRVAGKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTGQTP 179

Query: 292 --DDIEKLFALLASGK 305
                  L   +   +
Sbjct: 180 VMKYNRALMQAIMWDR 195


>1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
          Length = 147

 Score = 78.3 bits (192), Expect = 1e-17
 Identities = 14/162 (8%), Positives = 39/162 (24%), Gaps = 24/162 (14%)

Query: 1   MRAMVLREH----GGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKI 56
            ++  L++H             +    P +  G+VLL     S++ +     + +     
Sbjct: 4   AKSWTLKKHFQGKPTQSDFELKT-VELPPLKNGEVLLEALFLSVDPYMRIASKRLK---- 58

Query: 57  PLPVIMGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAH 116
              V+MG                      V            + ++              
Sbjct: 59  EGAVMMGQQVARVVESKNSAFPAG---SIV------------LAQSGWTTHFISDGKGLE 103

Query: 117 QLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLI 158
           +L+    +   +    +   +           +     K ++
Sbjct: 104 KLLTEWPDKKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVV 145


>1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415
          Length = 413

 Score = 71.6 bits (174), Expect = 1e-15
 Identities = 22/176 (12%), Positives = 47/176 (26%), Gaps = 16/176 (9%)

Query: 126 SFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCC--VQLAKIAGAYVIAC 183
           ++++      A       M    +V+  + V I  +   + +    V+ A   GA  +  
Sbjct: 1   NYKEKLQ-QYAELLVKVGM----NVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRV 55

Query: 184 AGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGD 243
             S+   +RLK            E     V  R               G   +   +   
Sbjct: 56  VYSDPTLKRLKFENESVEHFANHEIKSYDVEARM---------DYVKRGAANLALISEDP 106

Query: 244 TWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFA 299
             +  + + KL                   +  + + +    S  W +    +L  
Sbjct: 107 DLMDGIDSQKLQAFQQQNARAFKGYMESVQKNQFPWVVAAFPSKAWAKRVYPELSV 162


>1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
          Length = 382

 Score = 70.5 bits (172), Expect = 3e-15
 Identities = 17/192 (8%), Positives = 45/192 (23%), Gaps = 7/192 (3%)

Query: 29  GDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXXXXXXXXXXXXXXXDRVLV 88
           G   L      L   +             +  +  +                      + 
Sbjct: 17  GFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIPVGDGCSHTLEELGVFDIS 76

Query: 89  ---DPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMT 145
              + +               L    + +    VR+   + +    +L V    A  +++
Sbjct: 77  VPGEMVFPSPLDFFERGKPTPLVRS-RLQLPNGVRVWLKLEWYNPFSLSVKDRPAVEIIS 135

Query: 146 TNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAG---SEEKGQRLKEVGADEVI 202
                     ++    S   GV    +A++ G            E      + +GA  ++
Sbjct: 136 RLSRRVEKGSLVADATSSNFGVALSAVARLYGYRARVYLPGAAEEFGKLLPRLLGAQVIV 195

Query: 203 LYTKEDFMQVVR 214
                  + ++ 
Sbjct: 196 DPEAPSTVHLLP 207


>1o8cA2 [c.2.1.1] YHDH A:116 -- 192
          Length = 77

 Score = 70.3 bits (172), Expect = 3e-15
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 126 SFEQAAALPVAYGTAHRMMTTNGHV---KAGEKVLILGASGGVGVCCVQLAKIAGAYVIA 182
              +A  +  A  TA   +             ++++ GASGGVG   V L    G  V+A
Sbjct: 2   DARKAMIIGTAGFTAMLCVMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVA 61

Query: 183 CAGSEEKGQRLKEVGA 198
            +G E   + LK +GA
Sbjct: 62  VSGRESTHEYLKSLGA 77


>1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
           A:314 -- 352
          Length = 178

 Score = 69.3 bits (169), Expect = 6e-15
 Identities = 28/183 (15%), Positives = 49/183 (26%), Gaps = 28/183 (15%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
           M+   +   G +           P  GP D ++R  A +    DI T      I     +
Sbjct: 1   MKGFAMLSIGKVG----WIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEG-AIGERHNM 55

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDPL------------------NRVEGGLMGET 102
           I+G +                  DRV+V  +                    + G      
Sbjct: 56  ILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNV 115

Query: 103 MNGGLAELCKARA--HQLVRIPDNVSFEQAAALP-VAYGTAHR--MMTTNGHVKAGEKVL 157
            +G   E          L  +P  V   +        +    +  M+  +      + V+
Sbjct: 116 KDGVFGEFFHVNDADMNLAHLPKEVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVV 175

Query: 158 ILG 160
           IL 
Sbjct: 176 ILA 178


>1gv8A [c.94.1.2] OVOTRANSFERRIN
          Length = 160

 Score = 67.9 bits (165), Expect = 2e-14
 Identities = 11/163 (6%), Positives = 23/163 (14%), Gaps = 28/163 (17%)

Query: 22  PDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXXXXXXXXXXXXX 81
                G   ++  +R  +  +  +    G          I  L                 
Sbjct: 6   AVVKKGTDFMIKDLRGKTSCHTGLGRSAGWN------IPIGTLIHRGDIEWEGIESGSVE 59

Query: 82  XXDRVLV--------------------DPLNRVEGGLMGETMNGGLAELCKARAHQLVRI 121
                                      D   +          +G    L   +       
Sbjct: 60  QAVAKFFSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVK 119

Query: 122 PDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGG 164
              V                        V + +       + G
Sbjct: 120 HTTVQENAPEEKDEYELLCLDGT--RQPVDSYKTCNWARVAAG 160


>1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
           371
          Length = 188

 Score = 66.4 bits (161), Expect = 5e-14
 Identities = 25/191 (13%), Positives = 52/191 (27%), Gaps = 37/191 (19%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
           + A V    G   +L              +VL++V AT + + D+  R       +PLP 
Sbjct: 4   IIAAVTPCKGADFELQ---ALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYP--VPLPA 58

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLV--------------------DPLNRVEGGLMG 100
           ++G +                  D V++                    +   R   G   
Sbjct: 59  VLGHEGSGIIEAIGPNVTELQVGDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADS 118

Query: 101 E-----------TMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGH 149
           E                 A    +R +  V++  +  F+Q              + +   
Sbjct: 119 EGNHALCVNDHFFAQSSFATYALSRENNTVKVTKDFPFDQLVKFYAFDEINQAAIDS-RK 177

Query: 150 VKAGEKVLILG 160
               + ++ + 
Sbjct: 178 GITLKPIIKIA 188


>1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
           A:338 -- 367
          Length = 184

 Score = 65.0 bits (157), Expect = 1e-13
 Identities = 25/187 (13%), Positives = 42/187 (22%), Gaps = 39/187 (20%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
             AMVL +            F   DI  G +L+ + +  +   D+   RG     +PLP+
Sbjct: 5   AHAMVLEKFNQPLVYK---EFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPR-VPLPI 60

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRV-------------------------- 94
           I+G +                       D +                             
Sbjct: 61  ILGHEGAGRVVEVNGEKRDLNGELLKPGDLIVWNRGITCGECYWCKVSKEPYLCPNRKVY 120

Query: 95  ---EGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVK 151
               G      + G  +          V             L  A              +
Sbjct: 121 GINRGCSEYPHLRGCYSSHIVLDPETDVLKVSEKITH-RLPLKEANKALEL-----MESR 174

Query: 152 AGEKVLI 158
              KV++
Sbjct: 175 EALKVIL 181


>1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
           124 A:312 -- 351
          Length = 166

 Score = 64.7 bits (157), Expect = 2e-13
 Identities = 19/181 (10%), Positives = 39/181 (21%), Gaps = 28/181 (15%)

Query: 1   MRAMVLREHGG--LEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPL 58
           +      ++G    E    +       +  G V +R    S++ +         G     
Sbjct: 9   VLNSRPGKNGNPVAENFRVEEFSLLDALNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLA 68

Query: 59  PVIMG--LDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAH 116
           P  +    D                  D V               +             +
Sbjct: 69  PWQLAQVADGGGIGIVEESKHQKLAKGDFVT--------------SFYWPWQTKAILDGN 114

Query: 117 QLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIA 176
            L ++             +  G   +     G    G         G VG   V +++ +
Sbjct: 115 GLEKVDP----------QLVDGLKVKETVAKGLENXGVAFQSXXTGGNVGKQIVCISEDS 164

Query: 177 G 177
            
Sbjct: 165 S 165


>1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
           A:153 -- 320
          Length = 168

 Score = 56.3 bits (136), Expect = 5e-11
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 37/196 (18%)

Query: 121 IPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYV 180
           IP ++    AA L     T +  +  NG    G+KV I+G  GG+G     ++K  GA  
Sbjct: 1   IPSHL----AAPLLCGGLTVYSPLVRNG-CGPGKKVGIVGL-GGIGSMGTLISKAMGAET 54

Query: 181 IACAGSEEKGQRLKEVGADEVILYTKE-DFMQVVRQRHGRPQRVGGGSSENGGVDVVVNF 239
              + S  K +   ++GAD  I   +E D+ +                      D++V  
Sbjct: 55  YVISRSSRKREDAMKMGADHYIATLEEGDWGEKYF----------------DTFDLIVVC 98

Query: 240 TGGDT---WVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFEL-----QVRGSNGWER 291
               T   +    + +K+GGRI++        P +   ++           +  S     
Sbjct: 99  ASSLTDIDFNIMPKAMKVGGRIVSISI-----PEQHE-MLSLKPYGLKAVSISYSALGSI 152

Query: 292 DDIEKLFALLASGKLR 307
            ++ +L  L++   ++
Sbjct: 153 KELNQLLKLVSEKDIK 168


>1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
          Length = 225

 Score = 55.8 bits (133), Expect = 7e-11
 Identities = 17/143 (11%), Positives = 43/143 (30%), Gaps = 7/143 (4%)

Query: 116 HQLVRIPD-NVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAK 174
           HQ + IP   +    +A   V +              + +  +ILG  G V +   ++  
Sbjct: 1   HQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQ-GNVALDVARILL 59

Query: 175 IAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVD 234
               ++     +E     L++     V +  +   +QV        + +        G  
Sbjct: 60  TPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQL-----PGTR 114

Query: 235 VVVNFTGGDTWVKSLRTLKLGGR 257
            +++          ++      +
Sbjct: 115 PMLDPADFLGLQDRIKEAARPRK 137


>1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
          Length = 179

 Score = 54.8 bits (130), Expect = 2e-10
 Identities = 32/93 (34%), Positives = 52/93 (55%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACA 184
           +SFEQAAA  +   T + ++     +K  E+ L   A+GGVG+   Q AK  GA +I   
Sbjct: 1   ISFEQAAASFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTV 60

Query: 185 GSEEKGQRLKEVGADEVILYTKEDFMQVVRQRH 217
           G+ +K Q   + GA +VI Y +ED ++ +++  
Sbjct: 61  GTAQKAQSALKAGAWQVINYREEDLVERLKEIT 93


>1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
           -- 144 A:313 -- 349
          Length = 178

 Score = 51.4 bits (122), Expect = 2e-09
 Identities = 20/167 (11%), Positives = 40/167 (23%), Gaps = 29/167 (17%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
           ++A+         +     +    + GP DV + +    + + D+   R         P 
Sbjct: 1   IKAVGAYSAKQPLEPM---DITRREPGPNDVKIEIAYCGVCHSDLHQVRSE-WAGTVYPC 56

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDPLNRVEG------------------------ 96
           + G +                  D V V  +                             
Sbjct: 57  VPGHEIVGRVVAVGDQVEKYAPGDLVGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPT 116

Query: 97  GLMGETMNGGLAELCKARAHQLVRIPDNV-SFEQAAALPVAYGTAHR 142
                   GG ++        ++RI        +A  +  AY    R
Sbjct: 117 PDEPGHTLGGYSQQIVVHERYVLRIRVADIEMIRADQINEAYERMLR 163


>1y88A2 [c.52.1.30] HYPOTHETICAL PROTEIN AF1548 A:3 -- 127
          Length = 125

 Score = 50.8 bits (121), Expect = 2e-09
 Identities = 12/131 (9%), Positives = 33/131 (25%), Gaps = 14/131 (10%)

Query: 127 FEQ--AAALPVAYGTAHRMMTTNGHVKAGEK-VLILGASGGVGVCCVQLAKIAGAYVIAC 183
                A  L          +   G+    E  V+         + C          +   
Sbjct: 5   QGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEA 64

Query: 184 AGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGD 243
             +  +   +++ G  +  ++T   F +  ++            +   G+ +        
Sbjct: 65  MYTYARFLDVEKHGFTQPWIFTNTKFSEEAKK-----------YAGCVGIKLTGWSYPEK 113

Query: 244 TWVKSLRTLKL 254
             ++ L   K 
Sbjct: 114 EGIEVLLESKG 124


>1escA [c.23.10.1] ESTERASE
          Length = 302

 Score = 47.6 bits (112), Expect = 2e-08
 Identities = 9/158 (5%), Positives = 28/158 (17%), Gaps = 22/158 (13%)

Query: 108 AELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGV 167
                    Q   +  +                   +      +  +  L+ G     G 
Sbjct: 76  PFGAGELPPQQDALKQDTQL--TVGSLGGNTLGFNRILKQCSDELRKPSLLPGD-PVDGD 132

Query: 168 CCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGS 227
                              +++ +R+     +E++                         
Sbjct: 133 EPAAKCGEFFGTGDGKQWLDDQFERVGA-ELEELLDRIGYFA----------------PD 175

Query: 228 SENGGVDVVVNFTGG--DTWVKSLRTLKLGGRILTCGA 263
           ++   V                +    +L    +   A
Sbjct: 176 AKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDA 213


>1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
           -- 319
          Length = 171

 Score = 45.8 bits (107), Expect = 8e-08
 Identities = 12/86 (13%), Positives = 24/86 (27%)

Query: 130 AAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEK 189
           A    + +   +  +   G+   G+K +++  S  VG     L    GA V +   +  +
Sbjct: 6   AIVKILEFLKIYNNLLPEGNRLYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQ 65

Query: 190 GQRLKEVGADEVILYTKEDFMQVVRQ 215
                E                    
Sbjct: 66  KFTRGESLKLNKHHVEDLGEYSEDLL 91


>1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
          Length = 189

 Score = 44.0 bits (102), Expect = 3e-07
 Identities = 26/146 (17%), Positives = 49/146 (33%), Gaps = 9/146 (6%)

Query: 125 VSFEQAAALPVAYGTAHRMMTTNGHVKAGEK-VLILGASGGVGVCCVQLAKIAGAYVIAC 183
           ++  Q A + V   TA+ M+T    +  G+   +  G +  VG    Q+ K+     I+ 
Sbjct: 1   LTINQGATISVNPLTAYLMLTHYVKLTPGKDWFIQNGGTSAVGKYASQIGKLLNFNSISV 60

Query: 184 AGSEEK----GQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGG---SSENGGVDVV 236
                        LKE+GA +VI   + +  +         ++ GG    +    G    
Sbjct: 61  IRDRPNLDEVVASLKELGATQVITEDQNNSREFGPTIKEWIKQSGGEAKLALNCVGGKSS 120

Query: 237 VNFTGGD-TWVKSLRTLKLGGRILTC 261
                        L    +  + +T 
Sbjct: 121 TGIARKLNNNGLMLTYGGMSFQPVTI 146


>2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
          Length = 362

 Score = 41.7 bits (96), Expect = 1e-06
 Identities = 20/147 (13%), Positives = 38/147 (25%), Gaps = 7/147 (4%)

Query: 139 TAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQ----RLK 194
           T   +           K+ I GA G +     +  K  G YVIA    + +         
Sbjct: 1   TYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCD 60

Query: 195 EVGADEVILYTKEDFMQVVRQRHGRPQRVGGG---SSENGGVDVVVNFTGGDTWVKSLRT 251
           E    ++ +      +              GG      N  V +  N       +++ R 
Sbjct: 61  EFHLVDLRVMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARI 120

Query: 252 LKLGGRILTCGATAGYDPAEDLRVIWT 278
             +        A    +  +      +
Sbjct: 121 NGIKRFFYASSACIYPEFKQLETTNVS 147


>1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470
          Length = 117

 Score = 40.9 bits (95), Expect = 2e-06
 Identities = 10/90 (11%), Positives = 21/90 (23%), Gaps = 7/90 (7%)

Query: 1   MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV 60
              +V+   GG                P   +L +       H +   +G+    +   +
Sbjct: 18  APLIVVATQGGKSAR------AVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVK-EI 70

Query: 61  IMGLDXXXXXXXXXXXXXXXXXXDRVLVDP 90
               D                  D V++  
Sbjct: 71  TSTDDFYRLGKELALQSGLAHKGDVVVMVS 100


>1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
          Length = 395

 Score = 39.9 bits (91), Expect = 4e-06
 Identities = 12/89 (13%), Positives = 25/89 (28%), Gaps = 7/89 (7%)

Query: 108 AELCKARAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGH----VKAGEKVLILGASG 163
            +       ++ ++ ++            YGTA  +   N +    VK  +  +   A  
Sbjct: 5   QKFMLVVREKVNKLRNDPVAGGGLP---KYGTAVLVNIINENGLYPVKNFQTGVYPYAYE 61

Query: 164 GVGVCCVQLAKIAGAYVIACAGSEEKGQR 192
             G        +      AC     +  R
Sbjct: 62  QSGEAMAAKYLVRNKPCYACPIGCGRVNR 90


>1p9oA [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
          Length = 269

 Score = 39.1 bits (91), Expect = 8e-06
 Identities = 10/83 (12%), Positives = 20/83 (24%), Gaps = 5/83 (6%)

Query: 120 RIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAY 179
           R    +  +    + V  G     +          + L   +SG  G    +    AG  
Sbjct: 8   RFAARLGAQGRRVVLVTSGGTKVPLEARPV-----RFLDNFSSGRRGATSAEAFLAAGYG 62

Query: 180 VIACAGSEEKGQRLKEVGADEVI 202
           V+    +               +
Sbjct: 63  VLFLYRARSAFPYAHRFPPQTWL 85


>2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101
          Length = 44

 Score = 38.5 bits (90), Expect = 1e-05
 Identities = 7/39 (17%), Positives = 15/39 (38%), Gaps = 1/39 (2%)

Query: 10 GGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTR 48
              ++ F+     P + PG V++ V + S    +    
Sbjct: 5  ASPTQVFFN-QVDVPTLRPGLVVVFVSSGSQLLAEEAVT 42


>1a27A [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
          Length = 285

 Score = 36.7 bits (84), Expect = 4e-05
 Identities = 15/89 (16%), Positives = 27/89 (30%), Gaps = 2/89 (2%)

Query: 152 AGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQ 211
           A   VLI G S G+G+          +       +    +    +      L      ++
Sbjct: 1   ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLE 60

Query: 212 VVRQRHGRPQRVGGGSSE--NGGVDVVVN 238
            ++      + V         G VDV+V 
Sbjct: 61  TLQLDVRDSKSVAAARERVTEGRVDVLVC 89


>2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
          Length = 144

 Score = 36.5 bits (84), Expect = 5e-05
 Identities = 8/43 (18%), Positives = 13/43 (30%)

Query: 153 GEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
              V ++GA+G VG   V L       +             + 
Sbjct: 2   PLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQR 44


>1snyA [c.2.1.2] SNIFFER CG10964-PA
          Length = 248

 Score = 36.1 bits (82), Expect = 6e-05
 Identities = 10/51 (19%), Positives = 23/51 (45%), Gaps = 8/51 (15%)

Query: 149 HVKAGEKVLILGASGGVGVCCVQ----LAKIAGAYVIACAGSEEKGQRLKE 195
           H      +LI G + G+G+  V+    L +    ++     + E+ + L++
Sbjct: 1   HXN---SILITGCNRGLGLGLVKALLNLPQ-PPQHLFTTCRNREQAKELED 47


>1h5qA [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
          Length = 260

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 9/44 (20%), Positives = 18/44 (40%)

Query: 152 AGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
             + +++ G + G+G+   +    AGA V     S      + E
Sbjct: 8   VNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTE 51


>1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
           -- 745
          Length = 136

 Score = 35.3 bits (80), Expect = 1e-04
 Identities = 13/47 (27%), Positives = 18/47 (38%)

Query: 155 KVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEV 201
           +V +LGA G VG   V+    A    ++          L   G  EV
Sbjct: 2   RVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEV 48


>1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
          Length = 227

 Score = 35.2 bits (80), Expect = 1e-04
 Identities = 24/189 (12%), Positives = 57/189 (30%), Gaps = 12/189 (6%)

Query: 114 RAHQLVRIPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLA 173
           R H+ ++    V+ +    +        + ++    +   +  + +G   G  +    LA
Sbjct: 21  REHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA 80

Query: 174 KIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGV 233
                 ++A   ++E  +        +  +  K DF +           +      +G  
Sbjct: 81  IPEDGKILAMDINKENYELGLP-VIKKAGVDHKIDFRE--GPALPVLDEMIKDEKNHGSY 137

Query: 234 DVVVNFTGGDTWVKSL----RTLKLGGR-----ILTCGATAGYDPAEDLRVIWTFELQVR 284
           D +      D ++         +K+GG       L  G+      A   + +  +   V 
Sbjct: 138 DFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVL 197

Query: 285 GSNGWERDD 293
             N     D
Sbjct: 198 ELNKALAVD 206


>2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
          Length = 208

 Score = 34.2 bits (77), Expect = 2e-04
 Identities = 12/117 (10%), Positives = 27/117 (23%)

Query: 153 GEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQV 212
            ++VL+ GA+G  G   +             A + +       +      L      +  
Sbjct: 2   PKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDG 61

Query: 213 VRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDP 269
                          + +      V+F       K    +     ++     A    
Sbjct: 62  SIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKS 118


>1jvsA2 [c.2.1.3] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
           A:0 -- 125 A:275 -- 300
          Length = 152

 Score = 34.2 bits (78), Expect = 2e-04
 Identities = 9/62 (14%), Positives = 21/62 (33%), Gaps = 5/62 (8%)

Query: 153 GEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRL-----KEVGADEVILYTKE 207
           G+++ ILG++G +G   + + +    +    A    K          E      +   + 
Sbjct: 1   GKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRXVEQCLEFSPRYAVXDDEA 60

Query: 208 DF 209
             
Sbjct: 61  SA 62


>1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
          Length = 392

 Score = 34.2 bits (76), Expect = 2e-04
 Identities = 6/43 (13%), Positives = 12/43 (27%)

Query: 153 GEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
           G +V+++G  G  G             V        +    + 
Sbjct: 1   GSRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLVRRLFDHQL 43


>1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
           296
          Length = 160

 Score = 34.1 bits (77), Expect = 3e-04
 Identities = 18/112 (16%), Positives = 30/112 (26%), Gaps = 1/112 (0%)

Query: 131 AALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKG 190
             +P        ++   G   AG   +++G S  VG     L     A V  C       
Sbjct: 17  CFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHL 76

Query: 191 QRLKEVGADEVILYTKEDFMQVVRQRHGRPQR-VGGGSSENGGVDVVVNFTG 241
                 G   V+   + + ++    + G      G      G V        
Sbjct: 77  DEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYKVVGDVAYDEAKER 128


>1a9yA [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
          Length = 338

 Score = 33.8 bits (75), Expect = 3e-04
 Identities = 9/41 (21%), Positives = 14/41 (34%)

Query: 155 KVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
           +VL+ G SG +G          G  VI         + +  
Sbjct: 2   RVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLP 42


>1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
          Length = 307

 Score = 33.7 bits (75), Expect = 3e-04
 Identities = 13/94 (13%), Positives = 29/94 (30%), Gaps = 6/94 (6%)

Query: 152 AGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQ 211
           +  ++L++GA+G +G    + +   G                ++    E    +  + + 
Sbjct: 2   SRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVH 61

Query: 212 VVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTW 245
                H               VDVV++  G    
Sbjct: 62  GSIDDHASLVE------AVKNVDVVISTVGSLQI 89


>1k6iA [c.2.1.2] NMRA
          Length = 318

 Score = 33.6 bits (75), Expect = 3e-04
 Identities = 8/51 (15%), Positives = 20/51 (39%)

Query: 151 KAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEV 201
           +  + + ++ A+G      +++A   G +V A   S +     +      V
Sbjct: 1   QQKKTIAVVNATGRQAASLIRVAAAVGHHVRAQVHSLKGLIAEELQAIPNV 51


>1bdbA [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
          Length = 267

 Score = 33.6 bits (76), Expect = 4e-04
 Identities = 20/106 (18%), Positives = 31/106 (29%), Gaps = 17/106 (16%)

Query: 152 AGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE--------VGADEVIL 203
            GE VLI G + G+G   V      GA V     S E+   L+         +  D   L
Sbjct: 4   KGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSL 63

Query: 204 YTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSL 249
             ++        R G+          +  +     +      V   
Sbjct: 64  EDQKQAASRCVARFGK---------IDTLIPNAGIWDYSTALVDLP 100


>2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
           278
          Length = 267

 Score = 33.5 bits (75), Expect = 4e-04
 Identities = 10/45 (22%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 152 AGEKVLILGASGGVG-VCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
             +  +I G +GG+G        +  GA V+    +++ GQ++  
Sbjct: 5   QDKVAIITGGAGGIGETTAKLFVR-YGAKVVIADIADDHGQKVCN 48


>1ae1A [c.2.1.2] TROPINONE REDUCTASE-I
          Length = 245

 Score = 33.1 bits (74), Expect = 5e-04
 Identities = 18/94 (19%), Positives = 37/94 (39%), Gaps = 1/94 (1%)

Query: 152 AGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQ 211
            G   L+ G S G+G   V+     GA V  C+ +E++     E+  ++ +         
Sbjct: 5   KGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDL 64

Query: 212 VVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTW 245
           + R    +  +       +G ++++VN  G    
Sbjct: 65  LSRTERDKLMQ-TVAHVFDGKLNILVNNAGVVIH 97


>2ayiA1 [e.60.1.1] AMINOPEPTIDASE T A:3 -- 408
          Length = 397

 Score = 32.6 bits (74), Expect = 7e-04
 Identities = 9/58 (15%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 150 VKAGEKVLILGA--SGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYT 205
           ++ G++V+      +        + A   GA +      +++  R +   A E  L  
Sbjct: 20  LEKGQEVIATAPIEAVDFVRLLAEKAYREGASLFTVIYGDQELARKRLALAPEEGLDK 77


>1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
           214
          Length = 128

 Score = 32.5 bits (73), Expect = 7e-04
 Identities = 10/87 (11%), Positives = 21/87 (24%), Gaps = 14/87 (16%)

Query: 155 KVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFMQVVR 214
           K  I+G SG +G    ++    G  ++                         +    V+ 
Sbjct: 2   KYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGV--------------EELDSPDVVID 47

Query: 215 QRHGRPQRVGGGSSENGGVDVVVNFTG 241
                         +     +V+  T 
Sbjct: 48  FSSPEALPKTVDLCKKYRAGLVLGTTA 74


>1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
           -- 287
          Length = 181

 Score = 32.4 bits (73), Expect = 8e-04
 Identities = 10/54 (18%), Positives = 18/54 (33%)

Query: 142 RMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
           R +  +G    G+  ++LGA G       Q A      +      +E   +   
Sbjct: 7   RAIKESGFDIKGKTXVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKALA 60


>2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
           -- 158
          Length = 142

 Score = 32.3 bits (73), Expect = 9e-04
 Identities = 3/45 (6%), Positives = 5/45 (11%)

Query: 151 KAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKE 195
           +          S         L   A                 + 
Sbjct: 17  EHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARG 61


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.325    0.139    0.412 

Gapped
Lambda     K      H
   0.267   0.0524    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,831,645
Number of extensions: 930628
Number of successful extensions: 4552
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 4247
Number of HSP's successfully gapped: 240
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)