RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE38555.1 rpal2 ABE38555.1 GIB00345CH01 "Carotenoid oxygenase"
         (467 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3btaA3 [d.92.1.7] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1 -- 546     53   9e-10

>3btaA3 [d.92.1.7] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1 -- 546
          Length = 528

 Score = 52.7 bits (125), Expect = 9e-10
 Identities = 16/86 (18%), Positives = 27/86 (31%), Gaps = 3/86 (3%)

Query: 266 DIRWFRGDACFVFHVMNAWEDGTKIVADVMQSEEAPLFTHPDGRRTDPEKGRARLCRWSF 325
           DI + +         + A++   KI     +          D       K        S 
Sbjct: 17  DIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTF-TNPEEGDLNPPPEAKQVPVSYYDST 75

Query: 326 DLAGNTNAFKRSYLDDISGEFPRIDE 351
            L  +T+  K +YL  ++  F RI  
Sbjct: 76  YL--STDNEKDNYLKGVTKLFERIYS 99


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0420    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,703,374
Number of extensions: 1156610
Number of successful extensions: 4517
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 4389
Number of HSP's successfully gapped: 147
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)