RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE39396.1 rpal2 ABE39396.1 GIB00345CH01 "ATP dependent DNA
ligase"
         (313 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1fviA2 [d.142.2.1] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:2 -- 189    101   1e-24
1x9nA3 [d.142.2.1] DNA LIGASE I A:534 -- 753                           87   3e-20
1b04A [d.142.2.2] PROTEIN (DNA LIGASE)                                 66   6e-14
1a0iA1 [b.40.4.6] DNA LIGASE A:241 -- 349                              54   2e-10
2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225              42   1e-06
1fviA1 [b.40.4.6] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:190 -- 293    39   1e-05
1ckmA2 [d.142.2.3] MRNA CAPPING ENZYME A:11 -- 238                     33   7e-04

>1fviA2 [d.142.2.1] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:2 -- 189
          Length = 184

 Score =  101 bits (253), Expect = 1e-24
 Identities = 23/195 (11%), Positives = 48/195 (24%), Gaps = 24/195 (12%)

Query: 23  FVQPQLATLRTRPPSGAG-WIHEIKLDGYRGQAHVGPQGTRIYTRGGHDWSKMFAPLVAA 81
             +P LA             +   K+ G R          ++ +R            +  
Sbjct: 2   ITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQT-----QMLSRTFKPIRNSVMNRLLT 56

Query: 82  LSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXMLFYAFDLLHLDGYDLGPVPL 141
                                 +                  +Y FD +  D        +
Sbjct: 57  ELLPEGSDGEISIEGATFQDTTSAVMTGHAK--------FSYYWFDYVTDDPLKKYIDRV 108

Query: 142 TERKRLLKGLFDRGLEPPV-------VYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYR 194
            + K  +           V       V  +++ +           G+EG++ ++ D  Y+
Sbjct: 109 EDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYK 168

Query: 195 SGDRSL---DWQKIK 206
            G  +L      K+K
Sbjct: 169 FGRSTLKEGILLKMK 183


>1x9nA3 [d.142.2.1] DNA LIGASE I A:534 -- 753
          Length = 220

 Score = 86.7 bits (214), Expect = 3e-20
 Identities = 42/208 (20%), Positives = 73/208 (35%), Gaps = 26/208 (12%)

Query: 24  VQPQLATLRTR------PPSGAGWIHEIKLDGYRGQAH-VGPQGTRIYTRGGHDWSKMFA 76
           ++P LA               A +  E K DG R Q H +     +I++R   D +  + 
Sbjct: 7   LKPXLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYP 66

Query: 77  PLVAALSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXML-----------FYA 125
            +++ +                      +                             YA
Sbjct: 67  DIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYA 126

Query: 126 FDLLHLDGYDLGPVPLTERKRLLKGLFDRGLEPPVVYSDS-----MDDGEAMFDGAGRLG 180
           FDL++L+G  L   PL+ R++LL+  F    E   V++ S     ++      + + +  
Sbjct: 127 FDLIYLNGESLVREPLSRRRQLLRENF-VETEGEFVFATSLDTKDIEQIAEFLEQSVKDS 185

Query: 181 WEGIVSKRAD--APYRSGDRSLDWQKIK 206
            EG+  K  D  A Y    RS +W K+K
Sbjct: 186 CEGLXVKTLDVDATYEIAKRSHNWLKLK 213


>1b04A [d.142.2.2] PROTEIN (DNA LIGASE)
          Length = 310

 Score = 65.9 bits (160), Expect = 6e-14
 Identities = 23/206 (11%), Positives = 47/206 (22%), Gaps = 42/206 (20%)

Query: 34  RPPSGAGWIHEIKLDGYRGQAHV-GPQGTRIYTRG----GHDWSKMFAPLVAALSDAAXX 88
           +    A ++ E+ +DG             +  TRG    G D ++    + +        
Sbjct: 101 QEVGEAAYVCELAIDGLAVSVRYEDGYFVQGATRGDGTTGEDITENLKTIRSLP--LRLK 158

Query: 89  XXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXML----------------------FYAF 126
                         +  F                                       + +
Sbjct: 159 EPVSLEARGEAFMPKASFLRLNEERKARELFANPRNAAAGSLRQLDPKVAASRQLDLFVY 218

Query: 127 DLLHLDGYDLGPVPLTERKRLLKGLFDRGLEPPVVYSDSMDDGEA------MFDGAGRLG 180
            L   +         +E    L+ L  + + P      ++D+  A               
Sbjct: 219 GLADAEALG--IASHSEALDYLQALGFK-VNPERRRCANIDEVIAFVSEWHDKRPQLPYE 275

Query: 181 WEGIVSKRADAPYRSG----DRSLDW 202
            +GIV K      +       +S  W
Sbjct: 276 IDGIVIKVDSFAQQRALGATAKSPRW 301


>1a0iA1 [b.40.4.6] DNA LIGASE A:241 -- 349
          Length = 101

 Score = 54.4 bits (131), Expect = 2e-10
 Identities = 16/105 (15%), Positives = 25/105 (23%), Gaps = 13/105 (12%)

Query: 210 REHLVIVGYVPATG-----GIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIE 264
               +I G V  T      G         +   LV A  +      +    ++       
Sbjct: 4   EADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQW 63

Query: 265 TXXXXXXXXXXXXXXXXXXXXMSADVEYRDITASGHLRHASFKGL 309
                                 +  + Y + T  G LRH SF   
Sbjct: 64  G--------FFDACTINPYDGWACQISYMEETPDGSLRHPSFVMF 100


>2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
          Length = 124

 Score = 42.0 bits (98), Expect = 1e-06
 Identities = 9/111 (8%), Positives = 17/111 (15%), Gaps = 6/111 (5%)

Query: 156 LEPPVVYSDSMD-DGEAMFDGAGRLGWEGIVSKRADAPYRSGDRS---LDWQKIKTSKRE 211
           L    V S           +          ++      +             ++      
Sbjct: 1   LNITHVGSSYTGLATWTSCEDLNPDHAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHT 60

Query: 212 HLVIVGYVPATGGIAALHVARRDGDS--LVYAGKVGTGFSVKVGADLRRRL 260
                       G   L +A   G S           G        +    
Sbjct: 61  VSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGDDDHADCKIVVPS 111


>1fviA1 [b.40.4.6] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:190 -- 293
          Length = 80

 Score = 38.6 bits (90), Expect = 1e-05
 Identities = 13/107 (12%), Positives = 21/107 (19%), Gaps = 35/107 (32%)

Query: 209 KREHLVIVGYVPATG------GIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAE 262
           K     I+              +        DG        +GTGF      D  +    
Sbjct: 2   KDAEATIISMTALFKSGKVEEDVMGSIEVDYDG----VVFSIGTGFDADQRRDFWQNKES 57

Query: 263 IETXXXXXXXXXXXXXXXXXXXXMSADVEYRDITASGHLRHASFKGL 309
                                       +Y ++      R   F G+
Sbjct: 58  YIGKM--------------------VKFKYFEMP-----RFPVFIGI 79


>1ckmA2 [d.142.2.3] MRNA CAPPING ENZYME A:11 -- 238
          Length = 228

 Score = 32.5 bits (74), Expect = 7e-04
 Identities = 16/85 (18%), Positives = 30/85 (35%), Gaps = 11/85 (12%)

Query: 123 FYAFDLLHLDGYDLGPVPLTER----KRLLKGLFDRGLEPPVV------YSDSMDDGEAM 172
           F  FD + + G  +  + L  R    KR LK   +   +P ++        +     +  
Sbjct: 133 FVLFDAVVVSGVTVSQMDLASRFFAMKRSLKEFKNVPEDPAILRYKEWIPLEHPTIIKDH 192

Query: 173 FDGAGRL-GWEGIVSKRADAPYRSG 196
              A  +   +G++    D P   G
Sbjct: 193 LKKANAIYHTDGLIIMSVDEPVIYG 217


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.323    0.137    0.433 

Gapped
Lambda     K      H
   0.267   0.0685    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 8,260,107
Number of extensions: 564220
Number of successful extensions: 2292
Number of sequences better than 1.0e-03: 6
Number of HSP's gapped: 2274
Number of HSP's successfully gapped: 33
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)