RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE39967.1 rpal2 ABE39967.1 GIB00345CH01 "Histone-like
nucleoid-structuring protein H-NS"
         (139 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1hnrA [a.155.1.1] H-NS                                                 45   8e-08

>1hnrA [a.155.1.1] H-NS
          Length = 47

 Score = 45.2 bits (107), Expect = 8e-08
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 81  ARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELK-SGKSIDDFLIR 128
           A+RP       Y      + TW G+G+ P  +   +   GKS+DDFLI+
Sbjct: 1   AQRPAK---YSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIK 46


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0575    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 8,668,658
Number of extensions: 567442
Number of successful extensions: 2132
Number of sequences better than 1.0e-03: 5
Number of HSP's gapped: 2116
Number of HSP's successfully gapped: 23
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)