BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF67239.1 sent8 ACF67239.1 GIB00763CH01 "transcriptional
regulator HilD"
         (309 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2k9sA [x.x.x] ARABINOSE OPERON REGULATORY PROTEIN                      36   1e-04

>2k9sA [x.x.x] ARABINOSE OPERON REGULATORY PROTEIN
          Length = 107

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 225 LTDVADHIFMSTSTLKRKLAEE-GTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKCGYD 283
           +  VA H+ +S S L     ++ G S        R++QA  LL      +  V    G+D
Sbjct: 23  IASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFD 82

Query: 284 STSYFIQCFKKYFKTTPSTF 303
              YF + FKK    +PS F
Sbjct: 83  DQLYFSRVFKKCTGASPSEF 102


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.324    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 776,772,209
Number of extensions: 30569203
Number of successful extensions: 74284
Number of sequences better than 1.0e-03: 1171
Number of HSP's gapped: 73422
Number of HSP's successfully gapped: 1305
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.1 bits)