BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF67354.1 sent8 ACF67354.1 GIB00763CH01 "putative esterase
YbdB"
         (137 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1vh9A [d.38.1] HYPOTHETICAL PROTEIN YBDB                              240   2e-66
1vi8G [d.38.1] HYPOTHETICAL PROTEIN YDII                              147   2e-38
1vi8B [d.38.1] HYPOTHETICAL PROTEIN YDII                              147   2e-38
1vh5A [d.38.1] HYPOTHETICAL PROTEIN YDII                              147   2e-38
1sbkA [d.38.1] HYPOTHETICAL PROTEIN YDII                              134   2e-34
1o0iA [d.38.1] HYPOTHETICAL PROTEIN HI1161                            104   1e-25
2b6eD [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                     104   1e-25
2b6eB [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                     104   1e-25
2b6eA [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                     104   1e-25
1q4uB [d.38.1] THIOESTERASE                                            41   2e-06
1q4uA [d.38.1] THIOESTERASE                                            41   2e-06
1q4sB [d.38.1] THIOESTERASE                                            41   2e-06
1q4sA [d.38.1] THIOESTERASE                                            41   2e-06

>1vh9A [d.38.1] HYPOTHETICAL PROTEIN YBDB
          Length = 138

 Score =  240 bits (612), Expect = 2e-66
 Identities = 125/137 (91%), Positives = 132/137 (96%)

Query: 1   MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXX 60
           +IWKRHLTLDELNATS NT+VAHLGIVYTRLGDDVLEAEMPVD RTHQPF          
Sbjct: 2   LIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFXXXXXXXXXX 61

Query: 61  XXETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFD 120
             ETLGSMAG++MTRDGQCVVGTELNATHHR VS+GKVRGVC PLHLGRQNQSWEI +FD
Sbjct: 62  XXETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFD 121

Query: 121 EQGRRCCTCRLGTAVMG 137
           EQGRRCCTCRLGTAV+G
Sbjct: 122 EQGRRCCTCRLGTAVLG 138


>1vi8G [d.38.1] HYPOTHETICAL PROTEIN YDII
          Length = 137

 Score =  147 bits (370), Expect = 2e-38
 Identities = 69/136 (50%), Positives = 92/136 (67%)

Query: 1   MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXX 60
           +IWKR +TL+ LNA  +  +V  L I +  +GDD LEA MPVD+RT QPF          
Sbjct: 1   LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV 60

Query: 61  XXETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFD 120
             E++GS+AGYL T   Q VVG E+NA H R+  +G+VRGVC PLHLG ++Q W+I +FD
Sbjct: 61  LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD 120

Query: 121 EQGRRCCTCRLGTAVM 136
           E+GR CC+ RL TA++
Sbjct: 121 EKGRLCCSSRLTTAIL 136


>1vi8B [d.38.1] HYPOTHETICAL PROTEIN YDII
          Length = 146

 Score =  147 bits (370), Expect = 2e-38
 Identities = 69/136 (50%), Positives = 92/136 (67%)

Query: 1   MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXX 60
           +IWKR +TL+ LNA  +  +V  L I +  +GDD LEA MPVD+RT QPF          
Sbjct: 2   LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV 61

Query: 61  XXETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFD 120
             E++GS+AGYL T   Q VVG E+NA H R+  +G+VRGVC PLHLG ++Q W+I +FD
Sbjct: 62  LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD 121

Query: 121 EQGRRCCTCRLGTAVM 136
           E+GR CC+ RL TA++
Sbjct: 122 EKGRLCCSSRLTTAIL 137


>1vh5A [d.38.1] HYPOTHETICAL PROTEIN YDII
          Length = 138

 Score =  147 bits (370), Expect = 2e-38
 Identities = 69/136 (50%), Positives = 92/136 (67%)

Query: 1   MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXX 60
           +IWKR +TL+ LNA  +  +V  L I +  +GDD LEA MPVD+RT QPF          
Sbjct: 2   LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV 61

Query: 61  XXETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFD 120
             E++GS+AGYL T   Q VVG E+NA H R+  +G+VRGVC PLHLG ++Q W+I +FD
Sbjct: 62  LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD 121

Query: 121 EQGRRCCTCRLGTAVM 136
           E+GR CC+ RL TA++
Sbjct: 122 EKGRLCCSSRLTTAIL 137


>1sbkA [d.38.1] HYPOTHETICAL PROTEIN YDII
          Length = 134

 Score =  134 bits (337), Expect = 2e-34
 Identities = 69/135 (51%), Positives = 89/135 (65%), Gaps = 3/135 (2%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           IWKR +TL+ LNA   N  V  L I +  +GDD LEA  PVD+RT QPF           
Sbjct: 1   IWKRKITLEALNAGEGN--VGFLDIRFEHIGDDTLEAT-PVDSRTKQPFGLLHGGASVVL 57

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            E++GS+AGYL T   Q VVG E+NA H R+  +G+VRGVC PLHLG ++Q W+I +FDE
Sbjct: 58  AESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDE 117

Query: 122 QGRRCCTCRLGTAVM 136
           +GR CC+ RL TA++
Sbjct: 118 KGRLCCSSRLTTAIL 132


>1o0iA [d.38.1] HYPOTHETICAL PROTEIN HI1161
          Length = 135

 Score =  104 bits (260), Expect = 1e-25
 Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 2/135 (1%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           +WK+  TL+ LN    N+ V+HLGI  +  G+D +EA  PVD RT QPF           
Sbjct: 1   LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVAL 58

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            ET+GS+AG L   +G+ VVG ++NA H R V  GKV     P++LGR  Q W+I +  E
Sbjct: 59  AETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTE 118

Query: 122 QGRRCCTCRLGTAVM 136
           + + CC  RL  +V+
Sbjct: 119 ENKLCCVSRLTLSVI 133


>2b6eD [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 143

 Score =  104 bits (260), Expect = 1e-25
 Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 2/135 (1%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           +WK+  TL+ LN    N+ V+HLGI  +  G+D +EA  PVD RT QPF           
Sbjct: 1   LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVAL 58

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            ET+GS+AG L   +G+ VVG ++NA H R V  GKV     P++LGR  Q W+I +  E
Sbjct: 59  AETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTE 118

Query: 122 QGRRCCTCRLGTAVM 136
           + + CC  RL  +V+
Sbjct: 119 ENKLCCVSRLTLSVI 133


>2b6eB [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 136

 Score =  104 bits (260), Expect = 1e-25
 Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 2/135 (1%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           +WK+  TL+ LN    N+ V+HLGI  +  G+D +EA  PVD RT QPF           
Sbjct: 1   LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVAL 58

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            ET+GS+AG L   +G+ VVG ++NA H R V  GKV     P++LGR  Q W+I +  E
Sbjct: 59  AETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTE 118

Query: 122 QGRRCCTCRLGTAVM 136
           + + CC  RL  +V+
Sbjct: 119 ENKLCCVSRLTLSVI 133


>2b6eA [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 134

 Score =  104 bits (260), Expect = 1e-25
 Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 2/135 (1%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           +WK+  TL+ LN    N+ V+HLGI  +  G+D +EA  PVD RT QPF           
Sbjct: 1   LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVAL 58

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            ET+GS+AG L   +G+ VVG ++NA H R V  GKV     P++LGR  Q W+I +  E
Sbjct: 59  AETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTE 118

Query: 122 QGRRCCTCRLGTAVM 136
           + + CC  RL  +V+
Sbjct: 119 ENKLCCVSRLTLSVI 133


>1q4uB [d.38.1] THIOESTERASE
          Length = 139

 Score = 41.2 bits (95), Expect = 2e-06
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 1/120 (0%)

Query: 17  QNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRD 76
           + TL   +G V   +  +   A + V     Q +            E L + A   +  +
Sbjct: 16  EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEATVAVVHE 75

Query: 77  -GQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAV 135
            G   VG   + +  R V +G VR   + +H G     W+++L D+ GR C    +  AV
Sbjct: 76  KGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV 135


>1q4uA [d.38.1] THIOESTERASE
          Length = 140

 Score = 41.2 bits (95), Expect = 2e-06
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 1/120 (0%)

Query: 17  QNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRD 76
           + TL   +G V   +  +   A + V     Q +            E L + A   +  +
Sbjct: 17  EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEATVAVVHE 76

Query: 77  -GQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAV 135
            G   VG   + +  R V +G VR   + +H G     W+++L D+ GR C    +  AV
Sbjct: 77  KGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV 136


>1q4sB [d.38.1] THIOESTERASE
          Length = 140

 Score = 41.2 bits (95), Expect = 2e-06
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 1/120 (0%)

Query: 17  QNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRD 76
           + TL   +G V   +  +   A + V     Q +            E L + A   +  +
Sbjct: 16  EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEATVAVVHE 75

Query: 77  -GQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAV 135
            G   VG   + +  R V +G VR   + +H G     W+++L D+ GR C    +  AV
Sbjct: 76  KGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV 135


>1q4sA [d.38.1] THIOESTERASE
          Length = 142

 Score = 41.2 bits (95), Expect = 2e-06
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 1/120 (0%)

Query: 17  QNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRD 76
           + TL   +G V   +  +   A + V     Q +            E L + A   +  +
Sbjct: 18  EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEATVAVVHE 77

Query: 77  -GQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAV 135
            G   VG   + +  R V +G VR   + +H G     W+++L D+ GR C    +  AV
Sbjct: 78  KGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV 137


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 922,807,552
Number of extensions: 37189677
Number of successful extensions: 87199
Number of sequences better than 1.0e-03: 2207
Number of HSP's gapped: 85284
Number of HSP's successfully gapped: 2428
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)