BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF67711.1 sent8 ACF67711.1 GIB00763CH01
"3-oxoacyl-[acyl-carrier-protein] synthase 1"
         (404 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2vb7A [c.95.1 - c.95.1 (1og9D)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]...   726   0.0  
2buhA [c.95.1 - c.95.1 (1og8A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]...   726   0.0  
1h4fB [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I   725   0.0  
1h4fA [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I   725   0.0  
1dd8A [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN] SYN...   724   0.0  
2vb8C [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1             724   0.0  
2vb8A [c.95.1 - c.95.1 (1fj4A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]...   724   0.0  
2byzA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I             723   0.0  
2byyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I             723   0.0  
2bywA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I             722   0.0  
1ek4A [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN] SYN...   721   0.0  
1oeqA [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I   720   0.0  
2vb7C [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1             718   0.0  
2bz4D [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I             712   0.0  
1j3nA [c.95.1 - c.95.1] 3-OXOACYL-(ACYL-CARRIER PROTEIN) SYNTHAS...   211   3e-57
2gqdA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2             208   3e-56
1b3nA [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN S...   201   2e-54
2gfyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2             199   1e-53
2gfvA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2             197   6e-53
1oxhA [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE   184   5e-49
1ox0A [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE   184   5e-49
2almA [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II            180   7e-48
2rjtA [x.x.x] BETA-KETOACYL-ACP SYNTHASE II                           179   1e-47
2ix4A [c.95.1 - c.95.1 (1w0iA)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]...   179   2e-47
3e60A [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN ] SYNTHASE II           176   1e-46
2iwyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE               174   4e-46
1e5mA [c.95.1 - c.95.1] BETA KETOACYL ACYL CARRIER PROTEIN SYNTH...   173   7e-46
2iwzA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE               171   3e-45
2iwyB [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE               171   3e-45
2gp6A [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2             168   3e-44
2c9hA [x.x.x] MITOCHONDRIAL BETA-KETOACYL SYNTHASE                    163   7e-43
2wgeA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1             156   9e-41
2wgfA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1             152   2e-39
1tqyA [c.95.1 - c.95.1] BETA-KETOACYL SYNTHASE/ACYL TRANSFERASE       130   9e-33
2vz9B [x.x.x] FATTY ACID SYNTHASE                                      69   2e-14
2vz9A [x.x.x] FATTY ACID SYNTHASE                                      69   2e-14
2vz8B [x.x.x] FATTY ACID SYNTHASE                                      69   2e-14
2vz8A [x.x.x] FATTY ACID SYNTHASE                                      69   2e-14
2qo3B [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES          64   1e-12
2qo3A [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES          64   1e-12
2hg4F [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE                          46   2e-07
2hg4E [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE                          46   2e-07
2hg4D [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE                          46   2e-07
2hg4A [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE                          46   2e-07
1tqyB [c.95.1 - c.95.1] ACTINORHODIN POLYKETIDE PUTATIVE BETA-KE...    41   5e-06
2uv9F [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2uv9E [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2uv9D [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2uv9C [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2uv9B [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2uv9A [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS                       38   5e-05
2vkzA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA                        38   6e-05
2uv8A [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA (FAS2)                 38   6e-05
2pffA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA                        38   6e-05
3hmjA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA                        38   6e-05

>2vb7A [c.95.1 - c.95.1 (1og9D)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
           SYNTHASE 1
          Length = 404

 Score =  726 bits (1874), Expect = 0.0
 Identities = 382/404 (94%), Positives = 389/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>2buhA [c.95.1 - c.95.1 (1og8A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
           SYNTHASE I
          Length = 406

 Score =  726 bits (1874), Expect = 0.0
 Identities = 382/404 (94%), Positives = 389/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>1h4fB [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 406

 Score =  725 bits (1871), Expect = 0.0
 Identities = 381/404 (94%), Positives = 389/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISAT+AMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATRAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>1h4fA [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 405

 Score =  725 bits (1871), Expect = 0.0
 Identities = 381/404 (94%), Positives = 389/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISAT+AMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATRAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>1dd8A [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
           SYNTHASE I
          Length = 406

 Score =  724 bits (1870), Expect = 0.0
 Identities = 381/404 (94%), Positives = 388/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKR VITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>2vb8C [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
          Length = 405

 Score =  724 bits (1869), Expect = 0.0
 Identities = 381/403 (94%), Positives = 388/403 (96%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLID 61
           KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLID
Sbjct: 1   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLID 60

Query: 62  RKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMR 121
           RKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAMR
Sbjct: 61  RKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMR 120

Query: 122 SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGK 181
            PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLGK
Sbjct: 121 GPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGK 180

Query: 182 QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXE 241
           QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             E
Sbjct: 181 QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXE 240

Query: 242 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTS 301
           ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGTS
Sbjct: 241 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTS 300

Query: 302 TPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI 361
           TPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI
Sbjct: 301 TPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI 360

Query: 362 EELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           EELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 EELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 403


>2vb8A [c.95.1 - c.95.1 (1fj4A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
           SYNTHASE 1
          Length = 403

 Score =  724 bits (1869), Expect = 0.0
 Identities = 381/403 (94%), Positives = 388/403 (96%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLID 61
           KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLID
Sbjct: 1   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLID 60

Query: 62  RKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMR 121
           RKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAMR
Sbjct: 61  RKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMR 120

Query: 122 SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGK 181
            PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLGK
Sbjct: 121 GPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGK 180

Query: 182 QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXE 241
           QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             E
Sbjct: 181 QDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXE 240

Query: 242 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTS 301
           ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGTS
Sbjct: 241 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTS 300

Query: 302 TPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI 361
           TPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI
Sbjct: 301 TPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI 360

Query: 362 EELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           EELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 EELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 403


>2byzA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 405

 Score =  723 bits (1866), Expect = 0.0
 Identities = 381/404 (94%), Positives = 388/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNS GT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSQGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>2byyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 405

 Score =  723 bits (1866), Expect = 0.0
 Identities = 381/404 (94%), Positives = 388/404 (96%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNS GT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSEGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>2bywA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 406

 Score =  722 bits (1864), Expect = 0.0
 Identities = 380/404 (94%), Positives = 387/404 (95%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKR VITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISAT AMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>1ek4A [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
           SYNTHASE I
          Length = 406

 Score =  721 bits (1860), Expect = 0.0
 Identities = 380/404 (94%), Positives = 387/404 (95%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKR VITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSA ATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>1oeqA [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 406

 Score =  720 bits (1859), Expect = 0.0
 Identities = 379/404 (93%), Positives = 386/404 (95%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKR VITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISAT AMTGHSLGA GVQEAIYSLLMLEHGFIAPSIN
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAKGVQEAIYSLLMLEHGFIAPSIN 360

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 361 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 404


>2vb7C [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
          Length = 405

 Score =  718 bits (1853), Expect = 0.0
 Identities = 381/404 (94%), Positives = 388/404 (96%), Gaps = 1/404 (0%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSA ATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSA-ATSAHCIGNAVEQIQLG 179

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 180 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 239

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM+MAMHGVDTPIDYLNSHGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 299

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 300 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 359

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 360 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 403


>2bz4D [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
          Length = 402

 Score =  712 bits (1837), Expect = 0.0
 Identities = 378/404 (93%), Positives = 385/404 (95%), Gaps = 3/404 (0%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKD+GMRS VWGNVKLDTTGLI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRKVVRFMSDASIYA+LSMEQA+ADAGL+PE YQNNPRVGLIAGSGGGSP+FQVFGADAM
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
           R PRGLKAVGPYVVTKAMASGVSACLATPFKI+GVNYSISSACATSAHCIGNAVEQIQLG
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
           KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRD             
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240

Query: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300
           EELEHALARGAHIYAEIVGYGATSDGADM   SGEGAVRCM+MAMHGVDTPIDYLNS GT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADM---SGEGAVRCMKMAMHGVDTPIDYLNSQGT 297

Query: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           STPVGDVKEL AIREVFGD SPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
Sbjct: 298 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 357

Query: 361 IEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           IEELDEQAAGLNIV          VMSNSFGFGGTNATLVMRKL
Sbjct: 358 IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL 401


>1j3nA [c.95.1 - c.95.1] 3-OXOACYL-(ACYL-CARRIER PROTEIN) SYNTHASE
           II
          Length = 408

 Score =  211 bits (537), Expect = 3e-57
 Identities = 146/413 (35%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60
           M+R V+TGLG ++ IG  Q+    +   G+SG+        + +  ++   V +D    +
Sbjct: 1   MRRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEVDVDPGAYL 60

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSG-GGSPKFQVFGADA 119
           DRK +R +     YA ++ + A+ DAGL PE      RVG + G+G GG   ++      
Sbjct: 61  DRKELRRLDRFVQYALIAAQLALEDAGLKPEDLDPE-RVGTLVGTGIGGMETWEAQSRVF 119

Query: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179
           +   RG   + P+ +   +A+  SA +A  +   G + ++ +ACAT A  +G+A+  IQL
Sbjct: 120 LE--RGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACATGADALGSALRMIQL 177

Query: 180 GKQDIVFAGGGEELCWEMAC-EFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXX 238
           G+ D+V AGG E     MA   F  M ALST+ N+ PEKASR +   RD           
Sbjct: 178 GEADLVLAGGTEAAITPMAIGAFAVMRALSTR-NEEPEKASRPFTLSRDGFVMGEGAGVL 236

Query: 239 XXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHG-----VDTPID 293
             E  EHA  RGA IYAE+VG+G ++D   +  P  E                     + 
Sbjct: 237 VLEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEXXXXXXXXXXXXXXXXIAPEQVG 296

Query: 294 YLNSHGTSTPVGDVKELGAIREVFGDNSP--AISATKAMTGHSLGAAGVQEAIYSLLMLE 351
           Y+N+HGTSTPVGD  E+ AI+ VFGD++    +S+TK+M GH LGAAG  EAI ++  L 
Sbjct: 297 YINAHGTSTPVGDRAEVLAIKRVFGDHAKRLMVSSTKSMIGHLLGAAGAVEAIATVQALY 356

Query: 352 HGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
           HG I P+IN                         +SNSF FGG NA L  +++
Sbjct: 357 HGVIPPTIN-XXXXXXXXXXXXXXXXREAKVDYALSNSFAFGGHNAVLAFKRV 408


>2gqdA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
          Length = 411

 Score =  208 bits (529), Expect = 3e-56
 Identities = 152/413 (36%), Positives = 213/413 (51%), Gaps = 17/413 (4%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLI 60
           KR VITG+G +S IGN+ +    +  +G +GI     +        + G +K  +    I
Sbjct: 2   KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNIEDHI 61

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNP-RVGLIAGSG-GGSPKFQVFGAD 118
           D+K  R M   + YA ++  +AV DA L  ++ +N   R+G+  GSG GG   F++    
Sbjct: 62  DKKEARRMDRFTQYAIVAAREAVKDAQL--DINENTADRIGVWIGSGIGGMETFEIAHKQ 119

Query: 119 AMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQ 178
            M   +G + V P+ V   +    +  ++      G N +  +ACAT  + IG A + +Q
Sbjct: 120 LM--DKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ 177

Query: 179 LGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXX 237
            G  D +  GG E     MA   F A  ALST  ND  E A R +   RD          
Sbjct: 178 RGDADAMITGGTEAPITHMAIAGFSASRALST--NDDIETACRPFQEGRDGFVMGEGAGI 235

Query: 238 XXXEELEHALARGAHIYAEIVGYGATSDGADMVAPS--GEGAVRCMQMAMH--GVD-TPI 292
              E LE A ARGA+IYAEIVGYG T D   + AP+  GEG  R MQ AM   G++   +
Sbjct: 236 LVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDV 295

Query: 293 DYLNSHGTSTPVGDVKELGAIREVFGDNSP--AISATKAMTGHSLGAAGVQEAIYSLLML 350
            YLN+HGTSTPVGD+ E+ AI+  FG+ +    +S+TK+MTGH LGA G  EAI+S L +
Sbjct: 296 QYLNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSI 355

Query: 351 EHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           +   +AP+I+    D +     +            MSNS GFGG NA LV +K
Sbjct: 356 KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK 408


>1b3nA [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN
           SYNTHASE
          Length = 411

 Score =  201 bits (512), Expect = 2e-54
 Identities = 137/414 (33%), Positives = 204/414 (49%), Gaps = 15/414 (3%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLI 60
           +R V+TGLG++S +GN  +    +L  G+SGI+       +   ++  G VK  +   +I
Sbjct: 2   RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDII 61

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
            RK  R M     Y  ++  QA+ D+GL  E+ + N                        
Sbjct: 62  SRKEQRKMDAFIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTS 119

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
               G + + P+ V   + + V+  L   + + G + SI++AC +  H IG+A   I  G
Sbjct: 120 LMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYG 179

Query: 181 KQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXX 239
             D++ AGG E+    +    F A  ALST+ ND P+ ASR +D  RD            
Sbjct: 180 DADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLV 238

Query: 240 XEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPID-----Y 294
            EE EHA  RGA IYAE+VG+G +SD   M +P                D  I+     Y
Sbjct: 239 LEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXXXXXXXXXRDAGIEASQIGY 298

Query: 295 LNSHGTSTPVGDVKELGAIREVFGD--NSPAISATKAMTGHSLGAAGVQEAIYSLLMLEH 352
           +N+HGTSTP GD  E  A++ +FG+  +   +S+TK+MTGH LGAAG  E+IYS+L L  
Sbjct: 299 VNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRD 358

Query: 353 GFIAPSINIEELDEQAAGLNIV--XXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
             + P+IN++  DE    L+ V             + NSFGFGGTN +L+ +K+
Sbjct: 359 QAVPPTINLDNPDE-GCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI 411


>2gfyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
          Length = 411

 Score =  199 bits (506), Expect = 1e-53
 Identities = 136/414 (32%), Positives = 203/414 (49%), Gaps = 15/414 (3%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLI 60
           +R V+TGLG++S +GN  +    +L  G+SGI+       +   ++  G VK  +   +I
Sbjct: 2   RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDII 61

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
            RK  R M     Y  ++  QA+ D+GL  E+ + N                        
Sbjct: 62  SRKEQRKMDAFIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTS 119

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
               G + + P+ V   + + V+  L   + + G + SI++AC +  H IG+A   I  G
Sbjct: 120 LMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYG 179

Query: 181 KQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXX 239
             D++ AGG E+    +    F A  ALST+ ND P+ ASR +D  RD            
Sbjct: 180 DADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLV 238

Query: 240 XEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPID-----Y 294
            EE EHA  RGA IYAE+VG+G +SD   M +P                D  I+     Y
Sbjct: 239 LEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXXXXXXXXXRDAGIEASQIGY 298

Query: 295 LNSHGTSTPVGDVKELGAIREVFGD--NSPAISATKAMTGHSLGAAGVQEAIYSLLMLEH 352
           +N+HGTSTP GD  E  A++ +FG+  +   +S+T +MTGH LGAAG  E+IYS+L L  
Sbjct: 299 VNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTASMTGHLLGAAGAVESIYSILALRD 358

Query: 353 GFIAPSINIEELDEQAAGLNIV--XXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
             + P+IN++  DE    L+ V             + NSFGFGGTN +L+ +K+
Sbjct: 359 QAVPPTINLDNPDE-GCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI 411


>2gfvA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
          Length = 411

 Score =  197 bits (500), Expect = 6e-53
 Identities = 136/414 (32%), Positives = 203/414 (49%), Gaps = 15/414 (3%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLI 60
           +R V+TGLG++S +GN  +    +L  G+SGI+       +   ++  G VK  +   +I
Sbjct: 2   RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDII 61

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
            RK  R M     Y  ++  QA+ D+GL  E+ + N                        
Sbjct: 62  SRKEQRKMDAFIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTS 119

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
               G + + P+ V   + + V+  L   + + G + SI++A  +  H IG+A   I  G
Sbjct: 120 LMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYG 179

Query: 181 KQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXX 239
             D++ AGG E+    +    F A  ALST+ ND P+ ASR +D  RD            
Sbjct: 180 DADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLV 238

Query: 240 XEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPID-----Y 294
            EE EHA  RGA IYAE+VG+G +SD   M +P                D  I+     Y
Sbjct: 239 LEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXXXXXXXXXRDAGIEASQIGY 298

Query: 295 LNSHGTSTPVGDVKELGAIREVFGD--NSPAISATKAMTGHSLGAAGVQEAIYSLLMLEH 352
           +N+HGTSTP GD  E  A++ +FG+  +   +S+TK+MTGH LGAAG  E+IYS+L L  
Sbjct: 299 VNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRD 358

Query: 353 GFIAPSINIEELDEQAAGLNIV--XXXXXXXXXXVMSNSFGFGGTNATLVMRKL 404
             + P+IN++  DE    L+ V             + NSFGFGGTN +L+ +K+
Sbjct: 359 QAVPPTINLDNPDE-GCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI 411


>1oxhA [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
          Length = 408

 Score =  184 bits (466), Expect = 5e-49
 Identities = 132/410 (32%), Positives = 195/410 (47%), Gaps = 12/410 (2%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGL 59
           + R V+TG G+ S IGN  +E   SL               +         ++       
Sbjct: 2   LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQDFPFDKY 61

Query: 60  IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADA 119
             +K      + S+YA  + ++AV  A L  E   N  R G+I  SG G  K ++     
Sbjct: 62  FVKKDTNRFDNYSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVL 119

Query: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179
               +G K V P  + KA+ +  S  +A  F   GV  SI++AC++S   IG+A   I+ 
Sbjct: 120 RLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKF 179

Query: 180 GKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXX 238
           G QD++  GG E      A   F A+ ALST   + P +AS  +D  R+           
Sbjct: 180 GFQDVMLVGGTEASITPFAIAGFQALTALST--TEDPTRASIPFDKDRNGFVMGEGSGML 237

Query: 239 XXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMHGVD---TPID 293
             E LEHA  RGA I AE+VGYG T D   M +  P G+GA++ +++A+   +     + 
Sbjct: 238 VLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVA 297

Query: 294 YLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHG 353
           Y+N+HGTSTP  +  E GAI  V G   P +S+TK+ TGH LGAAG  EAI ++  + H 
Sbjct: 298 YVNAHGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAMRHN 356

Query: 354 FIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           F+  +    E+ +      +            +SN+FGFGG NA L  ++
Sbjct: 357 FVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGHNAVLAFKR 406


>1ox0A [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
          Length = 414

 Score =  184 bits (466), Expect = 5e-49
 Identities = 132/410 (32%), Positives = 195/410 (47%), Gaps = 12/410 (2%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGL 59
           + R V+TG G+ S IGN  +E   SL               +         ++       
Sbjct: 8   LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQDFPFDKY 67

Query: 60  IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADA 119
             +K      + S+YA  + ++AV  A L  E   N  R G+I  SG G  K ++     
Sbjct: 68  FVKKDTNRFDNYSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVL 125

Query: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179
               +G K V P  + KA+ +  S  +A  F   GV  SI++AC++S   IG+A   I+ 
Sbjct: 126 RLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKF 185

Query: 180 GKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXX 238
           G QD++  GG E      A   F A+ ALST   + P +AS  +D  R+           
Sbjct: 186 GFQDVMLVGGTEASITPFAIAGFQALTALST--TEDPTRASIPFDKDRNGFVMGEGSGML 243

Query: 239 XXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMHGVD---TPID 293
             E LEHA  RGA I AE+VGYG T D   M +  P G+GA++ +++A+   +     + 
Sbjct: 244 VLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVA 303

Query: 294 YLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHG 353
           Y+N+HGTSTP  +  E GAI  V G   P +S+TK+ TGH LGAAG  EAI ++  + H 
Sbjct: 304 YVNAHGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAMRHN 362

Query: 354 FIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           F+  +    E+ +      +            +SN+FGFGG NA L  ++
Sbjct: 363 FVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGHNAVLAFKR 412


>2almA [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II
          Length = 412

 Score =  180 bits (456), Expect = 7e-48
 Identities = 131/410 (31%), Positives = 194/410 (47%), Gaps = 12/410 (2%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGL 59
           + R V+TG G+ S IGN  +E   SL               +         ++       
Sbjct: 6   LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQDFPFDKY 65

Query: 60  IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADA 119
             +K      + S+YA  + ++AV  A L  E   N  R G+I  SG G  K ++     
Sbjct: 66  FVKKDTNRFDNYSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVL 123

Query: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179
               +G K V P  + KA+ +  S  +A  F   GV  SI++AC++S   IG+A   I+ 
Sbjct: 124 RLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKF 183

Query: 180 GKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXX 238
           G QD++  GG E      A   F A+ ALST   + P +AS  +D  R+           
Sbjct: 184 GFQDVMLVGGTEASITPFAIAGFQALTALST--TEDPTRASIPFDKDRNGFVMGEGSGML 241

Query: 239 XXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMHGVD---TPID 293
             E LEHA  RGA I AE+VGYG T D   M +  P G+GA++ +++A+   +     + 
Sbjct: 242 VLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVA 301

Query: 294 YLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHG 353
           Y+N+ GTSTP  +  E GAI  V G   P +S+TK+ TGH LGAAG  EAI ++  + H 
Sbjct: 302 YVNAAGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAMRHN 360

Query: 354 FIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           F+  +    E+ +      +            +SN+FGFGG NA L  ++
Sbjct: 361 FVPMTAGTSEVSDYIEANVVYAQGLEKEIPYAISNTFGFGGHNAVLAFKR 410


>2rjtA [x.x.x] BETA-KETOACYL-ACP SYNTHASE II
          Length = 408

 Score =  179 bits (455), Expect = 1e-47
 Identities = 131/410 (31%), Positives = 193/410 (47%), Gaps = 12/410 (2%)

Query: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGL 59
           + R V+TG G+ S IGN   E   SL               +         ++       
Sbjct: 2   LNRVVVTGYGVTSPIGNTPAEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQDFPFDKY 61

Query: 60  IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADA 119
             +K      + S+YA  + ++AV  A L      N  R G+I  SG G  K ++     
Sbjct: 62  FVKKDTNRFDNYSLYALYAAQEAVNHANLDVAAL-NRDRFGVIVASGIGGIK-EIEDQVL 119

Query: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179
               +G K V P  + KA+ +  S  +A  F   GV  SI++AC++S   IG+A   I+ 
Sbjct: 120 RLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKF 179

Query: 180 GKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXX 238
           G QD++  GG E      A   F A+ ALST   + P +AS  +D  R+           
Sbjct: 180 GFQDVMLVGGTEASITPFAIAGFQALTALST--TEDPTRASIPFDKDRNGFVMGEGSGML 237

Query: 239 XXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMHGVD---TPID 293
             E LEHA  RGA I AE+VGYG T D   M +  P G+GA++ +++A+   +     + 
Sbjct: 238 VLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVA 297

Query: 294 YLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHG 353
           Y+N+HGTSTP  +  E GAI  V G   P +S+TK+ TGH LGAAG  EAI ++  + H 
Sbjct: 298 YVNAHGTSTPANEKGESGAIVAVLGKAVP-VSSTKSFTGHLLGAAGAVEAIVTIEAMRHN 356

Query: 354 FIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           F+  +    E+ +      +            +SN+FGFGG NA L  ++
Sbjct: 357 FVPMTAGTSEVSDYIEANVVYGQGLAKEIPYAISNTFGFGGHNAVLAFKR 406


>2ix4A [c.95.1 - c.95.1 (1w0iA)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
           SYNTHASE
          Length = 431

 Score =  179 bits (453), Expect = 2e-47
 Identities = 136/437 (31%), Positives = 199/437 (45%), Gaps = 40/437 (9%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLID 61
           +R V+TGLG+V+ +G   +     L +G  GI     L D  M+S      KL T   + 
Sbjct: 1   RRVVVTGLGMVTPLGRGVETTWRRLIDGECGIR-GLTLDDLKMKS-FDEETKLYTFDQLS 58

Query: 62  RKVVRFMSDASI--------------------YAYLSMEQAVADAGLAPEVYQNNPRVGL 101
            KV  F+   S                     YA  + ++A+ DA   P   +   R   
Sbjct: 59  SKVAAFVPYGSNPGEFDEALWLNSKAVANFIGYAVCAADEALRDAEWLPTEEEEKERTXX 118

Query: 102 IAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISS 161
                       V  A  +   R L+ + P+ + K + +  S  ++  +   G N++  +
Sbjct: 119 XXXXXXXXXCDIVEAAQLICEKR-LRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVT 177

Query: 162 ACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASR 220
           ACAT AH IG+A   IQ G  D++ AGG E     ++   F    ALSTK+N +P++ASR
Sbjct: 178 ACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFNSSPQEASR 237

Query: 221 TYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAP--SGEGAV 278
            +D  RD             EE EHA  RGA IYAE+ GYG + D   +  P   G+GAV
Sbjct: 238 PFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPPEDGKGAV 297

Query: 279 RCMQMAMHG---VDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSP----AISATKAMT 331
             M  A+         IDY+N+H TSTP+GD  E  AI+ VF +++     A S+TK   
Sbjct: 298 LAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATSGTLAFSSTKXXX 357

Query: 332 GHSLGAAGVQEAIYSLLMLEHGFIAPSINIEE----LDEQAAGLNIVXXXXXXXXXXVMS 387
                     EAI+S+L + HG    ++N++      D++   L              MS
Sbjct: 358 XXXXXXXXXVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLT---TSKKMLVRTAMS 414

Query: 388 NSFGFGGTNATLVMRKL 404
           NSFGFGGTNA+L+   +
Sbjct: 415 NSFGFGGTNASLLFASI 431


>3e60A [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN ] SYNTHASE II
          Length = 420

 Score =  176 bits (446), Expect = 1e-46
 Identities = 108/288 (37%), Positives = 155/288 (53%), Gaps = 9/288 (3%)

Query: 124 RGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQD 183
           +G + + P+ +   + +  S  ++  + + G N+S+ +AC+T AH IG+A   I LG  D
Sbjct: 131 KGPRRISPFFIPGRLINLASGYVSIKYGLRGPNHSVVTACSTGAHAIGDAARLIALGDAD 190

Query: 184 IVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEE 242
           ++ AGG E     ++   F A  ALST  ND PE+ASR YD  RD             EE
Sbjct: 191 VMLAGGTESPINRISLAGFSACRALSTCRNDDPERASRPYDVDRDGFVMGEGAAIVVLEE 250

Query: 243 LEHALARGAHIYAEIVGYGATSDGADMVAP--SGEGAVRCMQMAMHGVD---TPIDYLNS 297
           LEHA  RGA IYAEI+GYG + D   + AP  SGEGA R M  A+       + +DY+N+
Sbjct: 251 LEHAKKRGARIYAEIIGYGLSGDAYHITAPSESGEGAQRSMMAALKRAQVNVSELDYINA 310

Query: 298 HGTSTPVGDVKELGAIREVFGDNSP--AISATKAMTGHSLGAAGVQEAIYSLLMLEHGFI 355
           HGTST + DV EL A+  V G  +P  ++S+TK+  GH          I+ +L +     
Sbjct: 311 HGTST-MADVIELAAVERVLGYYAPQVSMSSTKSSIGHXXXXXXXXXXIFCVLAIRDNIA 369

Query: 356 APSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
             ++N+E    +     +           V+SNSFGFGGTNA+LVMR+
Sbjct: 370 PATLNLENPSIETKIDLVPHKPRERKIDTVLSNSFGFGGTNASLVMRR 417


>2iwyA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
          Length = 420

 Score =  174 bits (441), Expect = 4e-46
 Identities = 130/418 (31%), Positives = 203/418 (48%), Gaps = 21/418 (5%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGIT--FSQELKDAGMRSQVW-----GNVKL 54
           +R VITG+G+V+ +G     V   L  G SGI     +E K        +        + 
Sbjct: 9   RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQF 68

Query: 55  DTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQV 114
           +    + +  ++ MS  +I A  + E A+ D+G  P+   +    G+  G G      +V
Sbjct: 69  NEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEV 126

Query: 115 FGADAMR-SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNA 173
               A+    +G   V P+ V K + +  +  ++  +K+ G N+++S+AC T AH +G++
Sbjct: 127 VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDS 186

Query: 174 VEQIQLGKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXX 232
              I  G  D++ AGG +     ++   F    ALST  N  P+ A R +   RD     
Sbjct: 187 FRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMG 244

Query: 233 XXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMH--GVD- 289
                   EE EHA+ R A IYAE++GYG + D A  + P GEGA+RCM  A+   GV  
Sbjct: 245 EGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGD-AGHIDPEGEGALRCMAAALKDAGVQP 303

Query: 290 TPIDYLNSHGTSTPVGDVKELGAIREVFGDN--SPAISATKAMTGHSLGAAGVQEAIYSL 347
             I Y+N+H TSTP+GD  E  AI+ +F D+  + A+S+TK             EA ++ 
Sbjct: 304 EEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKXXXXXXXXXXXXVEAAFTT 363

Query: 348 LMLEHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXV-MSNSFGFGGTNATLVMRKL 404
           L   +  + P++N+ +  E    LN V          + ++NSFGFGGTNATL +  L
Sbjct: 364 LACYYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKRFIGLTNSFGFGGTNATLCIAGL 420


>1e5mA [c.95.1 - c.95.1] BETA KETOACYL ACYL CARRIER PROTEIN SYNTHASE
           II
          Length = 411

 Score =  173 bits (439), Expect = 7e-46
 Identities = 134/411 (32%), Positives = 195/411 (47%), Gaps = 12/411 (2%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLI 60
           KR V+TGLG ++ IGN  Q+    L EGR+GI        +    +  G VK  D T  +
Sbjct: 2   KRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKDFDATQFL 61

Query: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM 120
           DRK  + M     +A  + +QA+ DA L   + + N                       +
Sbjct: 62  DRKEAKRMDRFCHFAVCASQQAINDAKLV--INELNADEXXXXXXXXXXXXXXXEDQQTI 119

Query: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG 180
              +G     P+++   +A+  S   A      G N    +ACA  ++ IG+A   +Q G
Sbjct: 120 LLDKGPSRCSPFMIPMMIANMASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQNG 179

Query: 181 KQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXX 239
               +  GG E     ++   F +  ALS + ND P  ASR +D  RD            
Sbjct: 180 YAKAMICGGTEAAITPLSYAGFASARALSFR-NDDPLHASRPFDKDRDGFVMGXXXXXXX 238

Query: 240 XEELEHALARGAHIYAEIVGYGATSDGADMVAP--SGEGAVRCMQMAMHGVDTP---IDY 294
                    RGA IY E+VGY  T D   + AP   G GA R +  A+         + Y
Sbjct: 239 XXXXXXXXXRGAKIYGEMVGYAMTCDAYHITAPVPDGRGATRAIAWALKDSGLKPEMVSY 298

Query: 295 LNSHGTSTPVGDVKELGAIREVFGDNSP--AISATKAMTGHSLGAAGVQEAIYSLLMLEH 352
           +N+HGTSTP  DV E  AI++  G+++   A+S+TK+MTGH LG +G  EA+ +++ +  
Sbjct: 299 INAHGTSTPANDVTETRAIKQALGNHAYNIAVSSTKSMTGHLLGGSGGIEAVATVMAIAE 358

Query: 353 GFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
             + P+IN+E  D +     +            +SNSFGFGG N TL  +K
Sbjct: 359 DKVPPTINLENPDPECDLDYVPGQSRALIVDVALSNSFGFGGHNVTLAFKK 409


>2iwzA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
          Length = 426

 Score =  171 bits (434), Expect = 3e-45
 Identities = 130/423 (30%), Positives = 202/423 (47%), Gaps = 25/423 (5%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGIT--FSQELKDAGMRSQVW-----GNVKL 54
           +R VITG+G+V+ +G     V   L  G SGI     +E K        +        + 
Sbjct: 9   RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQF 68

Query: 55  DTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQV 114
           +    + +  ++ MS  +I A  + E A+ D+G  P+   +    G+  G G      +V
Sbjct: 69  NEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEV 126

Query: 115 FGADAMR-SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNA 173
               A+    +G   V P+ V K + +  +  ++  +K+ G N+++S+AC T AH +G++
Sbjct: 127 VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDS 186

Query: 174 VEQIQLGKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXX 232
              I  G  D++ AGG +     ++   F    ALST  N  P+ A R +   RD     
Sbjct: 187 FRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMG 244

Query: 233 XXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMH--GV 288
                   EE EHA+ R A IYAE++GYG + D   + A  P GEGA+RCM  A+   GV
Sbjct: 245 EGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGV 304

Query: 289 D-TPIDYLNSHGTSTPVGDVKELGAIREVFGDN--SPAISATKAMTGHSLGAAGVQEAIY 345
               I Y+N+H TSTP+GD  E  AI+ +F D+  + A+S+TK             EA +
Sbjct: 305 QPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKXXXXXXXXXXXXVEAAF 364

Query: 346 SLLMLEHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXV----MSNSFGFGGTNATLVM 401
           + L   +  + P++N+ +  E    LN V               ++NSFGFGGTNATL +
Sbjct: 365 TTLACYYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCI 423

Query: 402 RKL 404
             L
Sbjct: 424 AGL 426


>2iwyB [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
          Length = 423

 Score =  171 bits (434), Expect = 3e-45
 Identities = 130/423 (30%), Positives = 202/423 (47%), Gaps = 25/423 (5%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGIT--FSQELKDAGMRSQVW-----GNVKL 54
           +R VITG+G+V+ +G     V   L  G SGI     +E K        +        + 
Sbjct: 6   RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQF 65

Query: 55  DTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQV 114
           +    + +  ++ MS  +I A  + E A+ D+G  P+   +    G+  G G      +V
Sbjct: 66  NEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEV 123

Query: 115 FGADAMR-SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNA 173
               A+    +G   V P+ V K + +  +  ++  +K+ G N+++S+AC T AH +G++
Sbjct: 124 VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDS 183

Query: 174 VEQIQLGKQDIVFAGGGEELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXX 232
              I  G  D++ AGG +     ++   F    ALST  N  P+ A R +   RD     
Sbjct: 184 FRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMG 241

Query: 233 XXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMH--GV 288
                   EE EHA+ R A IYAE++GYG + D   + A  P GEGA+RCM  A+   GV
Sbjct: 242 EGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGV 301

Query: 289 D-TPIDYLNSHGTSTPVGDVKELGAIREVFGDN--SPAISATKAMTGHSLGAAGVQEAIY 345
               I Y+N+H TSTP+GD  E  AI+ +F D+  + A+S+TK             EA +
Sbjct: 302 QPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKXXXXXXXXXXXXVEAAF 361

Query: 346 SLLMLEHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXV----MSNSFGFGGTNATLVM 401
           + L   +  + P++N+ +  E    LN V               ++NSFGFGGTNATL +
Sbjct: 362 TTLACYYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCI 420

Query: 402 RKL 404
             L
Sbjct: 421 AGL 423


>2gp6A [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
          Length = 415

 Score =  168 bits (425), Expect = 3e-44
 Identities = 128/404 (31%), Positives = 194/404 (48%), Gaps = 14/404 (3%)

Query: 5   VITGLGIVSSIGNNQQEVLASLREGRSGITFSQE--LKDAGMRSQVWGNVKLDTTGLIDR 62
           V+TG+ + +++  + +     L + +SGI    +  +++  +  ++ G++  +    + R
Sbjct: 12  VVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDPFVEEFDLPVRIGGHLLEEFDHQLTR 71

Query: 63  KVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRS 122
             +R M      + +   +   +AG +PEV  N   V +  G+G GS +  VF  D MR+
Sbjct: 72  IELRRMGYLQRMSTVLSRRLWENAG-SPEVDTNRLMVSI--GTGLGSAEELVFSYDDMRA 128

Query: 123 PRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQ 182
            RG+KAV P  V K M +G +A +           +  SACA+ A  I  A +QI LG+ 
Sbjct: 129 -RGMKAVSPLTVQKYMPNGAAAAVGLERHAKAGVMTPVSACASGAEAIARAWQQIVLGEA 187

Query: 183 DIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXE 241
           D    GG E     +    F  M  + +  ND P  A R +D  RD             E
Sbjct: 188 DAAICGGVETRIEAVPIAGFAQMRIVMSTNNDDPAGACRPFDRDRDGFVFGEGGALLLIE 247

Query: 242 ELEHALARGAHIYAEIVGYGATSDGADMVAP------SGEGAVRCMQMAMHGVDTPIDYL 295
             EHA ARGA+I A I+G   TSDG  MVAP      +G    R +Q+A       ID++
Sbjct: 248 TEEHAKARGANILARIMGASITSDGFHMVAPDPNGERAGHAITRAIQLAGLAPGD-IDHV 306

Query: 296 NSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFI 355
           N+H T T VGD+ E  AI    G N PA+ A K+  GHS+GA G  E+I ++L L    I
Sbjct: 307 NAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGAVGAVESILTVLALRDQVI 366

Query: 356 APSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATL 399
            P++N+  LD +     +            ++NSFGFGG N  +
Sbjct: 367 PPTLNLVNLDPEIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAI 410


>2c9hA [x.x.x] MITOCHONDRIAL BETA-KETOACYL SYNTHASE
          Length = 426

 Score =  163 bits (413), Expect = 7e-43
 Identities = 129/423 (30%), Positives = 201/423 (47%), Gaps = 26/423 (6%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGIT--FSQELKDAGMRSQVW-----GNVKL 54
           +R VITG+G+V+ +G     V   L  G SGI     +E K        +        + 
Sbjct: 10  RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQF 69

Query: 55  DTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQV 114
           +    + +  ++ MS  +I A  + E A+ D+G  P+   +    G+  G G      +V
Sbjct: 70  NEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEV 127

Query: 115 FGADAMR-SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNA 173
               A+    +G   V P+ V K + +  +  ++  +K+ G N+++S+A  T AH +G++
Sbjct: 128 VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTA-TTGAHAVGDS 186

Query: 174 VEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDXXXXX 232
              I  G  D++ AGG +     ++   F    ALST  N  P+ A R +   RD     
Sbjct: 187 FRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMG 244

Query: 233 XXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVA--PSGEGAVRCMQMAMH--GV 288
                   EE EHA+ R A IYAE++GYG + D   + A  P GEGA+RCM  A+   GV
Sbjct: 245 EGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGV 304

Query: 289 D-TPIDYLNSHGTSTPVGDVKELGAIREVFGDN--SPAISATKAMTGHSLGAAGVQEAIY 345
               I Y+N+H TSTP+GD  E  AI+ +F D+  + A+S+TK             EA +
Sbjct: 305 QPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKXXXXXXXXXXXXVEAAF 364

Query: 346 SLLMLEHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXV----MSNSFGFGGTNATLVM 401
           + L   +  + P++N+ +  E    LN V               ++NSFGFGGTNATL +
Sbjct: 365 TTLACYYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCI 423

Query: 402 RKL 404
             L
Sbjct: 424 AGL 426


>2wgeA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
          Length = 415

 Score =  156 bits (395), Expect = 9e-41
 Identities = 127/394 (32%), Positives = 188/394 (47%), Gaps = 14/394 (3%)

Query: 14  SIGNNQQEVLASLREGRSGITFSQE--LKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSDA 71
           SI  + +     L  G SGI   ++  +    +  ++ G++K      + R  +R MS  
Sbjct: 23  SISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSYV 82

Query: 72  SIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGP 131
                L   Q    AG +PEV  +  R  ++ G+G G  +  V   D M +  G + V P
Sbjct: 83  QRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSP 138

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
             V   M +G +A +           +  SAC++ +  I +A  QI +G  D+   GG E
Sbjct: 139 LAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVE 198

Query: 192 ELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARG 250
                +    F  M A+ST+ ND PE+ASR +D  RD             E  EHA ARG
Sbjct: 199 GPIEALPIAAFSMMRAMSTR-NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARG 257

Query: 251 AHIYAEIVGYGATSDGADMVAPSGEG--AVRCM--QMAMHGVD-TPIDYLNSHGTSTPVG 305
           A   A ++G G TSD   MVAP+ +G  A R M   + + G+    ID++N+HGT+TP+G
Sbjct: 258 AKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGLSPADIDHVNAHGTATPIG 317

Query: 306 DVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELD 365
           D  E  AIR V G +  A+ A K+  GHS+GA G  E++ ++L L  G I P++N E  D
Sbjct: 318 DAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTLRDGVIPPTLNYETPD 376

Query: 366 EQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATL 399
            +     +            ++NSFGFGG N  L
Sbjct: 377 PEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL 410


>2wgfA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
          Length = 415

 Score =  152 bits (383), Expect = 2e-39
 Identities = 126/394 (31%), Positives = 187/394 (47%), Gaps = 14/394 (3%)

Query: 14  SIGNNQQEVLASLREGRSGITFSQE--LKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSDA 71
           SI  + +     L  G SGI   ++  +    +  ++ G++K      + R  +R MS  
Sbjct: 23  SISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSYV 82

Query: 72  SIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGP 131
                L   Q    AG +PEV  +  R  ++ G+G G  +  V   D M +  G + V P
Sbjct: 83  QRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSP 138

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
             V   M +G +A +           +  SA ++ +  I +A  QI +G  D+   GG E
Sbjct: 139 LAVQMIMPNGAAAVIGLQLGARAGVMTPVSAQSSGSEAIAHAWRQIVMGDADVAVCGGVE 198

Query: 192 ELCWEMA-CEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARG 250
                +    F  M A+ST+ ND PE+ASR +D  RD             E  EHA ARG
Sbjct: 199 GPIEALPIAAFSMMRAMSTR-NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARG 257

Query: 251 AHIYAEIVGYGATSDGADMVAPSGEG--AVRCM--QMAMHGVD-TPIDYLNSHGTSTPVG 305
           A   A ++G G TSD   MVAP+ +G  A R M   + + G+    ID++N+HGT+TP+G
Sbjct: 258 AKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGLSPADIDHVNAHGTATPIG 317

Query: 306 DVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELD 365
           D  E  AIR V G +  A+ A K+  GHS+GA G  E++ ++L L  G I P++N E  D
Sbjct: 318 DAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTLRDGVIPPTLNYETPD 376

Query: 366 EQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATL 399
            +     +            ++NSFGFGG N  L
Sbjct: 377 PEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL 410


>1tqyA [c.95.1 - c.95.1] BETA-KETOACYL SYNTHASE/ACYL TRANSFERASE
          Length = 421

 Score =  130 bits (326), Expect = 9e-33
 Identities = 119/428 (27%), Positives = 178/428 (41%), Gaps = 42/428 (9%)

Query: 2   KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTT--GL 59
           +R VITG+G+ +  GN  ++    L  GR+          +  RSQV      D    G 
Sbjct: 1   RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAEGF 60

Query: 60  IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQ----------------NNPRVGLIA 103
             R++ R M  AS +           +GL P+                      R  L+ 
Sbjct: 61  GPRELDR-MDRASQFXXXXXXXXXXXSGLDPDTLDPXXXXXXXXXXXXXXXXXEREYLLL 119

Query: 104 GSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSAC 163
              G       +  DA    R +     Y+V   M + V+  +       G    +S+ C
Sbjct: 120 SDSGRD-----WEVDAAWLSRHMF---DYLVPSVMPAEVAWAVGAE----GPVTMVSTGC 167

Query: 164 ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEM--ACEFDAMGALSTKYNDTPEKASRT 221
            +    +GNAV  I+ G  D++FAG  +     +  AC FDA+ A +T  ND PE ASR 
Sbjct: 168 TSGLDSVGNAVRAIEEGSADVMFAGAADTPITPIVVAC-FDAIRA-TTARNDDPEHASRP 225

Query: 222 YDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEG----- 276
           +D  RD             E+ + ALARGA I+AEI GY    +   M     +G     
Sbjct: 226 FDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAE 285

Query: 277 AVRCMQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNS--PAISATKAMTGHS 334
            +R          T IDY+N+HG+ T   D  E  A +   G+++    +S+ K+M GHS
Sbjct: 286 TIRVALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHS 345

Query: 335 LGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGG 394
           LGA G  E    +L LEHG + P+ N+   D +     +           V++   GFGG
Sbjct: 346 LGAIGSLEIAACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGG 405

Query: 395 TNATLVMR 402
             + +V+R
Sbjct: 406 FQSAMVLR 413


>2vz9B [x.x.x] FATTY ACID SYNTHASE
          Length = 2086

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 80/171 (46%), Gaps = 16/171 (9%)

Query: 246 ALARGAHIYAEIVGYGATSDGAD---MVAPSG---EGAVRCMQMAMHGVDTPIDYLNSHG 299
           +LAR   +YA I+  G  +DG+    +  PSG   E  +R +          ++Y+ +HG
Sbjct: 237 SLAR--RVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEAHG 294

Query: 300 TSTPVGDVKELGAIREVFGDNSPA---ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIA 356
           T T VGD +EL  I             I +TK+  GH   A+GV   I  LL LEHG  A
Sbjct: 295 TGTKVGDPQELNGIVNALCATRREPLLIGSTKSNMGHPEPASGVAALIKVLLSLEHGVWA 354

Query: 357 PSI-----NIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMR 402
           P++     N E    Q   L +V          V  NSFGFGG+N  ++++
Sbjct: 355 PNLHYHTPNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ 405


>2vz9A [x.x.x] FATTY ACID SYNTHASE
          Length = 2081

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 80/171 (46%), Gaps = 16/171 (9%)

Query: 246 ALARGAHIYAEIVGYGATSDGAD---MVAPSG---EGAVRCMQMAMHGVDTPIDYLNSHG 299
           +LAR   +YA I+  G  +DG+    +  PSG   E  +R +          ++Y+ +HG
Sbjct: 237 SLAR--RVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEAHG 294

Query: 300 TSTPVGDVKELGAIREVFGDNSPA---ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIA 356
           T T VGD +EL  I             I +TK+  GH   A+GV   I  LL LEHG  A
Sbjct: 295 TGTKVGDPQELNGIVNALCATRREPLLIGSTKSNMGHPEPASGVAALIKVLLSLEHGVWA 354

Query: 357 PSI-----NIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMR 402
           P++     N E    Q   L +V          V  NSFGFGG+N  ++++
Sbjct: 355 PNLHYHTPNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ 405


>2vz8B [x.x.x] FATTY ACID SYNTHASE
          Length = 2004

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 80/171 (46%), Gaps = 16/171 (9%)

Query: 246 ALARGAHIYAEIVGYGATSDGAD---MVAPSG---EGAVRCMQMAMHGVDTPIDYLNSHG 299
           +LAR   +YA I+  G  +DG+    +  PSG   E  +R +          ++Y+ +HG
Sbjct: 237 SLAR--RVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEAHG 294

Query: 300 TSTPVGDVKELGAIREVFGDNSPA---ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIA 356
           T T VGD +EL  I             I +TK+  GH   A+GV   I  LL LEHG  A
Sbjct: 295 TGTKVGDPQELNGIVNALCATRREPLLIGSTKSNMGHPEPASGVAALIKVLLSLEHGVWA 354

Query: 357 PSI-----NIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMR 402
           P++     N E    Q   L +V          V  NSFGFGG+N  ++++
Sbjct: 355 PNLHYHTPNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ 405


>2vz8A [x.x.x] FATTY ACID SYNTHASE
          Length = 1962

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 80/171 (46%), Gaps = 16/171 (9%)

Query: 246 ALARGAHIYAEIVGYGATSDGAD---MVAPSG---EGAVRCMQMAMHGVDTPIDYLNSHG 299
           +LAR   +YA I+  G  +DG+    +  PSG   E  +R +          ++Y+ +HG
Sbjct: 237 SLAR--RVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEAHG 294

Query: 300 TSTPVGDVKELGAIREVFGDNSPA---ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIA 356
           T T VGD +EL  I             I +TK+  GH   A+GV   I  LL LEHG  A
Sbjct: 295 TGTKVGDPQELNGIVNALCATRREPLLIGSTKSNMGHPEPASGVAALIKVLLSLEHGVWA 354

Query: 357 PSI-----NIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMR 402
           P++     N E    Q   L +V          V  NSFGFGG+N  ++++
Sbjct: 355 PNLHYHTPNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ 405


>2qo3B [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES
          Length = 873

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 67/291 (23%), Positives = 122/291 (41%), Gaps = 25/291 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           Y VT    +  S  ++    + G + S+ +AC++S   +  AVE ++ G+          
Sbjct: 140 YSVTGVAPAVASGRISYTMGLEGPSISVDTACSSSLVALHLAVESLRKGESSXXXXXXXX 199

Query: 192 ELCWE-MACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARG 250
                 +  +F    AL+       +  S+                    E L  A   G
Sbjct: 200 XXXTPGVFVDFSRQRALAA------DGRSKXXXXXXXXXXXSEGVTLVLLERLSEARRNG 253

Query: 251 AHIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDTP---IDYLNSHGTSTPVG 305
             + A + G     DGA   + APSG    R ++ A+         +D + +HGT T +G
Sbjct: 254 HEVLAVVRGSALNQDGASNGLSAPSGPAQRRVIRQALESCGLEPGDVDAVEAHGTGTALG 313

Query: 306 DVKELGAIREVFGDNSPA-----ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           D  E  A+ + +G +  A     + + K+  GH+  AAGV   +  +L L +G +  +++
Sbjct: 314 DPIEANALLDTYGRDRDADRPLWLGSVKSNIGHTQAAAGVTGLLKVVLALRNGELPATLH 373

Query: 361 IEE----LDEQAAGLNIV----XXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           +EE    +D  + G+ ++                 ++FG  GTNA +++ +
Sbjct: 374 VEEPTPHVDWSSGGVALLAGNQPWRRGERTRRAAVSAFGISGTNAHVIVEE 424


>2qo3A [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES
          Length = 869

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 67/291 (23%), Positives = 122/291 (41%), Gaps = 25/291 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           Y VT    +  S  ++    + G + S+ +AC++S   +  AVE ++ G+          
Sbjct: 140 YSVTGVAPAVASGRISYTMGLEGPSISVDTACSSSLVALHLAVESLRKGESSXXXXXXXX 199

Query: 192 ELCWE-MACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARG 250
                 +  +F    AL+       +  S+                    E L  A   G
Sbjct: 200 XXXTPGVFVDFSRQRALAA------DGRSKXXXXXXXXXXXSEGVTLVLLERLSEARRNG 253

Query: 251 AHIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDTP---IDYLNSHGTSTPVG 305
             + A + G     DGA   + APSG    R ++ A+         +D + +HGT T +G
Sbjct: 254 HEVLAVVRGSALNQDGASNGLSAPSGPAQRRVIRQALESCGLEPGDVDAVEAHGTGTALG 313

Query: 306 DVKELGAIREVFGDNSPA-----ISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360
           D  E  A+ + +G +  A     + + K+  GH+  AAGV   +  +L L +G +  +++
Sbjct: 314 DPIEANALLDTYGRDRDADRPLWLGSVKSNIGHTQAAAGVTGLLKVVLALRNGELPATLH 373

Query: 361 IEE----LDEQAAGLNIV----XXXXXXXXXXVMSNSFGFGGTNATLVMRK 403
           +EE    +D  + G+ ++                 ++FG  GTNA +++ +
Sbjct: 374 VEEPTPHVDWSSGGVALLAGNQPWRRGERTRRAAVSAFGISGTNAHVIVEE 424


>2hg4F [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
          Length = 859

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 18/213 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           YV T   +S  S  +A    + G   ++ +AC++    + +  E ++  +  +  AGG  
Sbjct: 145 YVGTGTASSVASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVT 202

Query: 192 ELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGA 251
                   EF + G L+      P      +    D             + L  A   G 
Sbjct: 203 VSSPGAFTEFRSQGGLAADGRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGR 256

Query: 252 HIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDT---PIDYLNSHGTSTPVGD 306
            + A + G     DGA   + APSG    R ++ A+         +DY+ +HGT T +GD
Sbjct: 257 PVLAVLRGSAVNQDGASNGLTAPSGPAQQRVIRRALENAGVRAGDVDYVEAHGTGTRLGD 316

Query: 307 VKELGAIREVFG-----DNSPAISATKAMTGHS 334
             E+ A+   +G     D+   I + K+  GH+
Sbjct: 317 PIEVHALLSTYGAERDPDDPLWIGSVKSNIGHT 349


>2hg4E [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
          Length = 862

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 18/213 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           YV T   +S  S  +A    + G   ++ +AC++    + +  E ++  +  +  AGG  
Sbjct: 149 YVGTGTASSVASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVT 206

Query: 192 ELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGA 251
                   EF + G L+      P      +    D             + L  A   G 
Sbjct: 207 VSSPGAFTEFRSQGGLAADGRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGR 260

Query: 252 HIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDT---PIDYLNSHGTSTPVGD 306
            + A + G     DGA   + APSG    R ++ A+         +DY+ +HGT T +GD
Sbjct: 261 PVLAVLRGSAVNQDGASNGLTAPSGPAQQRVIRRALENAGVRAGDVDYVEAHGTGTRLGD 320

Query: 307 VKELGAIREVFG-----DNSPAISATKAMTGHS 334
             E+ A+   +G     D+   I + K+  GH+
Sbjct: 321 PIEVHALLSTYGAERDPDDPLWIGSVKSNIGHT 353


>2hg4D [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
          Length = 868

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 18/213 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           YV T   +S  S  +A    + G   ++ +AC++    + +  E ++  +  +  AGG  
Sbjct: 157 YVGTGTASSVASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVT 214

Query: 192 ELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGA 251
                   EF + G L+      P      +    D             + L  A   G 
Sbjct: 215 VSSPGAFTEFRSQGGLAADGRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGR 268

Query: 252 HIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDT---PIDYLNSHGTSTPVGD 306
            + A + G     DGA   + APSG    R ++ A+         +DY+ +HGT T +GD
Sbjct: 269 PVLAVLRGSAVNQDGASNGLTAPSGPAQQRVIRRALENAGVRAGDVDYVEAHGTGTRLGD 328

Query: 307 VKELGAIREVFG-----DNSPAISATKAMTGHS 334
             E+ A+   +G     D+   I + K+  GH+
Sbjct: 329 PIEVHALLSTYGAERDPDDPLWIGSVKSNIGHT 361


>2hg4A [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
          Length = 867

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 18/213 (8%)

Query: 132 YVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE 191
           YV T   +S  S  +A    + G   ++ +AC++    + +  E ++  +  +  AGG  
Sbjct: 156 YVGTGTASSVASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVT 213

Query: 192 ELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGA 251
                   EF + G L+      P      +    D             + L  A   G 
Sbjct: 214 VSSPGAFTEFRSQGGLAADGRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGR 267

Query: 252 HIYAEIVGYGATSDGAD--MVAPSGEGAVRCMQMAMHGVDT---PIDYLNSHGTSTPVGD 306
            + A + G     DGA   + APSG    R ++ A+         +DY+ +HGT T +GD
Sbjct: 268 PVLAVLRGSAVNQDGASNGLTAPSGPAQQRVIRRALENAGVRAGDVDYVEAHGTGTRLGD 327

Query: 307 VKELGAIREVFG-----DNSPAISATKAMTGHS 334
             E+ A+   +G     D+   I + K+  GH+
Sbjct: 328 PIEVHALLSTYGAERDPDDPLWIGSVKSNIGHT 360


>1tqyB [c.95.1 - c.95.1] ACTINORHODIN POLYKETIDE PUTATIVE
           BETA-KETOACYL
          Length = 402

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 77/380 (20%), Positives = 146/380 (38%), Gaps = 21/380 (5%)

Query: 5   VITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVK-LDTTGLIDRK 63
           +ITG+G+V+  G       +++ +GR G+        +   + + G +        I  +
Sbjct: 3   LITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDDFHAPDHIPGR 62

Query: 64  VVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKF--QVFGADAMR 121
           ++     ++  A  + + A+ DA   PE   +   +G++  +  G   F  + F      
Sbjct: 63  LLPQTDPSTRLALTAADWALQDAKADPESLTDYD-MGVVTANACGGFDFTHREFRKLWSE 121

Query: 122 SPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGK 181
            P+ +     +    A+ +G    ++    + G + ++ +  A     +G+A   I+ G 
Sbjct: 122 GPKSVSVYESFAWFYAVNTGQ---ISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRGT 178

Query: 182 QDIVFAGGGEELC-WEMACEFDAMGALSTKYNDTPEKASRTYDAHRDXXXXXXXXXXXXX 240
             +V  G    L  W    +  A G +ST  +  P++A   +D                 
Sbjct: 179 PLVVSGGVDSALDPWGWVSQI-ASGRISTATD--PDRAYLPFDERAAGYVPGEGGAILVL 235

Query: 241 EELEHALARGAH-IYAEIVGYGATSDGADMVAPSGE--GAVRCMQMAMHGVDTPIDYLNS 297
           E+   A ARG H  Y E+ G  +T D A     SG   G  R +++A++   T  +    
Sbjct: 236 EDSAAAEARGRHDAYGELAGCASTFDPAP---GSGRPAGLERAIRLALNDAGTGPEXXXX 292

Query: 298 HGTST---PVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGF 354
                   P  D  E  AI  VFG             G      G  + + +L+ L  G 
Sbjct: 293 XXXXXXXXPELDAAEARAIGRVFGREGXXXXXXXXXXGRLYSGGGPLDVVTALMSLREGV 352

Query: 355 IAPSINIEELDEQAAGLNIV 374
           IAP+  +  +  +  G+++V
Sbjct: 353 IAPTAGVTSVPRE-YGIDLV 371


>2uv9F [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1461

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 921  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 980

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 981  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1037

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1038 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1097

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1098 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1147


>2uv9E [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1456

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 916  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 975

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 976  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1032

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1033 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1092

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1093 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1142


>2uv9D [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1467

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 927  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 986

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 987  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1043

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1044 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1103

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1104 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1153


>2uv9C [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1462

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 922  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 981

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 982  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1038

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1039 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1098

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1099 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1148


>2uv9B [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1464

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 924  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 983

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 984  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1040

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1041 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1100

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1101 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1150


>2uv9A [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
          Length = 1457

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 16/231 (6%)

Query: 60   IDRKVVRFMSDASIYAYLSMEQAVADAGLAPEV----YQNNPRVGLIAGSG-GGSPKFQV 114
            +   +++ +   ++Y  +S+ +A+  +G+        Y +   VG   GSG GG+   + 
Sbjct: 917  VPEDIIQQVDPVTLYVLVSVAEALLSSGITDPYEFYKYVHLSEVGNCIGSGVGGTSALRG 976

Query: 115  FGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAV 174
               D        K +        MA+ V+  L +     G   +   ACAT+   +    
Sbjct: 977  MYKDRYLDKPVQKDILQESFVNTMAAWVNMLLLSST---GPIKTPVGACATAVESLDVGY 1033

Query: 175  EQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYND-----TPEKASRTYDAHRDXX 229
            + I  GK  +   GG ++   E + EF  MGA S    +      P + SR     R+  
Sbjct: 1034 DTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNAKEEFARGREPGEMSRPTSTTRNGF 1093

Query: 230  XXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD--GADMVAPSGEGAV 278
                          + AL  G  IY  +      +D  G  + AP G+G +
Sbjct: 1094 MESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDKIGRSVPAP-GQGVL 1143


>2vkzA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
          Length = 1614

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 38/123 (30%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 162  ACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALST-----KYNDTPE 216
            ACATS   +   VE I  GK  I   GG ++   E + EF  M A S      ++  TP 
Sbjct: 1171 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1230

Query: 217  KASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD---GADMVAPS 273
            + SR     R+              + + AL  G  IY  IV   AT+    G  + AP 
Sbjct: 1231 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATDKIGRSVPAP- 1288

Query: 274  GEG 276
            G+G
Sbjct: 1289 GKG 1291



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 298  HGTSTPVGDVKELGAIREVF-----GDNSPAISA-TKAMTGHSLGAAGVQEAIYSLLMLE 351
            HGTST   D  E   I E+       + +P I    K +TGH  GAAG      +L +L 
Sbjct: 1409 HGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMMNGALQILN 1468

Query: 352  HGFIAPSINIEELDE 366
             G I  + N + +D+
Sbjct: 1469 SGIIPGNRNADNVDK 1483


>2uv8A [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA (FAS2)
          Length = 1613

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 38/123 (30%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 162  ACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALST-----KYNDTPE 216
            ACATS   +   VE I  GK  I   GG ++   E + EF  M A S      ++  TP 
Sbjct: 1170 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1229

Query: 217  KASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD---GADMVAPS 273
            + SR     R+              + + AL  G  IY  IV   AT+    G  + AP 
Sbjct: 1230 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATDKIGRSVPAP- 1287

Query: 274  GEG 276
            G+G
Sbjct: 1288 GKG 1290



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 298  HGTSTPVGDVKELGAIREVF-----GDNSPAISA-TKAMTGHSLGAAGVQEAIYSLLMLE 351
            HGTST   D  E   I E+       + +P I    K +TGH  GAAG      +L +L 
Sbjct: 1408 HGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMMNGALQILN 1467

Query: 352  HGFIAPSINIEELDE 366
             G I  + N + +D+
Sbjct: 1468 SGIIPGNRNADNVDK 1482


>2pffA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
          Length = 1683

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 38/123 (30%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 162  ACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALST-----KYNDTPE 216
            ACATS   +   VE I  GK  I   GG ++   E + EF  M A S      ++  TP 
Sbjct: 1100 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1159

Query: 217  KASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD---GADMVAPS 273
            + SR     R+              + + AL  G  IY  IV   AT+    G  + AP 
Sbjct: 1160 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATDKIGRSVPAP- 1217

Query: 274  GEG 276
            G+G
Sbjct: 1218 GKG 1220



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 298  HGTSTPVGDVKELGAIREVF-----GDNSPAISA-TKAMTGHSLGAAGVQEAIYSLLMLE 351
            HGTST   D  E   I E+       + +P I    K +TGH  GAAG      +L +L 
Sbjct: 1338 HGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMMNGALQILN 1397

Query: 352  HGFIAPSINIEELDE 366
             G I  + N + +D+
Sbjct: 1398 SGIIPGNRNADNVDK 1412


>3hmjA [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
          Length = 1750

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 38/123 (30%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 162  ACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALST-----KYNDTPE 216
            ACATS   +   VE I  GK  I   GG ++   E + EF  M A S      ++  TP 
Sbjct: 1171 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1230

Query: 217  KASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSD---GADMVAPS 273
            + SR     R+              + + AL  G  IY  IV   AT+    G  + AP 
Sbjct: 1231 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATDKIGRSVPAP- 1288

Query: 274  GEG 276
            G+G
Sbjct: 1289 GKG 1291



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 298  HGTSTPVGDVKELGAIREVF-----GDNSPAISA-TKAMTGHSLGAAGVQEAIYSLLMLE 351
            HGTST   D  E   I E+       + +P I    K +TGH  GAAG      +L +L 
Sbjct: 1409 HGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMMNGALQILN 1468

Query: 352  HGFIAPSINIEELDE 366
             G I  + N + +D+
Sbjct: 1469 SGIIPGNRNADNVDK 1483


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.333    0.148    0.455 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 849,704,202
Number of extensions: 34258763
Number of successful extensions: 81176
Number of sequences better than 1.0e-03: 1635
Number of HSP's gapped: 79414
Number of HSP's successfully gapped: 1836
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)