BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF68340.1 sent8 ACF68340.1 GIB00763CH01 "fimbrial subunit"
         (172 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2jmrA [x.x.x] FIMF                                                    102   8e-25
3bwuF [x.x.x] PROTEIN FIMF                                             84   2e-19
3bfqG [x.x.x] PROTEIN FIMG                                             55   2e-10
1pdkB [b.2.3] PROTEIN (PROTEIN PAPK)                                   49   1e-08
2uy7D [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN                         47   4e-08
2uy7B [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN                         46   7e-08
1ze3H [x.x.x] FIMH PROTEIN                                             36   7e-05
1klfB [b.2.3 - b.2.3] FIMH PROTEIN                                     36   7e-05
1kiuB [b.2.3 - b.2.3] FIMH PROTEIN                                     36   7e-05

>2jmrA [x.x.x] FIMF
          Length = 179

 Score =  102 bits (254), Expect = 8e-25
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 4/154 (2%)

Query: 22  DGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTAS 81
           D  + + G + DN CS++  S N  V +   + +QF   G  +   PF I L  CG+  S
Sbjct: 3   DSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS 62

Query: 82  GVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVV---TLSPGQ 138
            V V F+G ADS N +LLAL    S ASG+GI L ++ +  IPL   S  +   TL+PG+
Sbjct: 63  AVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALSWTTLTPGK 122

Query: 139 ASAHLQFYARYLADGGAVTPGDANASATFILAYE 172
            +  L FYAR +A    VT G  NA+ATF L Y+
Sbjct: 123 PNT-LNFYARLMATQVPVTAGHINATATFTLEYQ 155


>3bwuF [x.x.x] PROTEIN FIMF
          Length = 128

 Score = 84.3 bits (207), Expect = 2e-19
 Identities = 58/143 (40%), Positives = 74/143 (51%), Gaps = 18/143 (12%)

Query: 33  DNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAAD 92
           DN CS++  S N   A   V               PF I L  CG+  S V V F+G AD
Sbjct: 1   DNGCSVAAESTNFIGATTPVV--------------PFRILLSPCGNAVSAVKVGFTGVAD 46

Query: 93  SRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVV---TLSPGQASAHLQFYARY 149
           S N +LLAL    S ASG+GI L ++ +  IPL   S  +   TL+PG+ +  L FYAR 
Sbjct: 47  SHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALSWTTLTPGKPNT-LNFYARL 105

Query: 150 LADGGAVTPGDANASATFILAYE 172
           +A    VT G  NA+ATF L Y+
Sbjct: 106 MATQVPVTAGHINATATFTLEYQ 128


>3bfqG [x.x.x] PROTEIN FIMG
          Length = 132

 Score = 54.7 bits (130), Expect = 2e-10
 Identities = 41/136 (30%), Positives = 55/136 (40%), Gaps = 8/136 (5%)

Query: 36  CSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRN 95
           C++S  + N  V +G +       AG  SAW   A++L NC    S VT SFSGAADS  
Sbjct: 4   CTVS--TTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADS-- 59

Query: 96  TDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGA 155
                    +  A  I + L D +   +  G  +  V +     SAH     R L   G 
Sbjct: 60  ---TGYYKNQGTAQNIQLELQDDSGNTLNTG-ATKTVQVDDSSQSAHFPLQVRALTVNGG 115

Query: 156 VTPGDANASATFILAY 171
            T G   A  +    Y
Sbjct: 116 ATQGTIQAVISITYTY 131


>1pdkB [b.2.3] PROTEIN (PROTEIN PAPK)
          Length = 149

 Score = 48.9 bits (115), Expect = 1e-08
 Identities = 44/148 (29%), Positives = 63/148 (42%), Gaps = 7/148 (4%)

Query: 31  ITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASG--VTVSFS 88
           + D  C +S  S N +V     + R F+     S  + F I L+NC +TA G  VT++F 
Sbjct: 1   LLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFVIRLENCHATAVGKIVTLTFK 60

Query: 89  GAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYAR 148
           G  ++     L +T   +   GI +   D +  L P    +          S  L F A 
Sbjct: 61  GTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNSLELPFGAY 120

Query: 149 YLADGGA-----VTPGDANASATFILAY 171
            +A   A     V PGD  A+ATF L Y
Sbjct: 121 VVATPEALRTKSVVPGDYEATATFELTY 148


>2uy7D [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN
          Length = 154

 Score = 47.0 bits (110), Expect = 4e-08
 Identities = 43/158 (27%), Positives = 66/158 (41%), Gaps = 13/158 (8%)

Query: 23  GRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTA-- 80
           G+V  + T+ D  CS+S  S + ++  G +S + F  AG  S      I+L NC  TA  
Sbjct: 2   GKVTFNNTVVDAPCSISQKSADQSIDFGQLS-KSFLEAGGVSKPMDLDIELVNCDITAFK 60

Query: 81  -----SGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLS 135
                  V ++F+G   + ++D L    G    +G  I +    K ++  G E D  TL 
Sbjct: 61  GGAKKGTVKLAFTGPIVNGHSDELDTNGG----TGTAIVVQGAGKNVVFDGSEGDANTLK 116

Query: 136 PGQASAH-LQFYARYLADGGAVTPGDANASATFILAYE 172
            G+   H               T G  +A A F L Y+
Sbjct: 117 DGENVLHYTXXXXXXXXXXXXXTEGAFSAVANFNLTYQ 154


>2uy7B [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN
          Length = 156

 Score = 46.2 bits (108), Expect = 7e-08
 Identities = 43/160 (26%), Positives = 66/160 (41%), Gaps = 15/160 (9%)

Query: 23  GRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTA-- 80
           G+V  + T+ D  CS+S  S + ++  G +S + F  AG  S      I+L NC  TA  
Sbjct: 2   GKVTFNNTVVDAPCSISQKSADQSIDFGQLS-KSFLEAGGVSKPMDLDIELVNCDITAFK 60

Query: 81  -------SGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVT 133
                    V ++F+G   + ++D L    G    +G  I +    K ++  G E D  T
Sbjct: 61  GGNGAKKGTVKLAFTGPIVNGHSDELDTNGG----TGTAIVVQGAGKNVVFDGSEGDANT 116

Query: 134 LSPGQASAH-LQFYARYLADGGAVTPGDANASATFILAYE 172
           L  G+   H               T G  +A A F L Y+
Sbjct: 117 LKDGENVLHYTXXXXXXXXXXXXXTEGAFSAVANFNLTYQ 156


>1ze3H [x.x.x] FIMH PROTEIN
          Length = 122

 Score = 36.2 bits (82), Expect = 7e-05
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 12/100 (12%)

Query: 74  QNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVT 133
           QN G   SG T      AD+ N+ +   TA  S A G+G+ L  +N T+IP    ++ V+
Sbjct: 34  QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVS 82

Query: 134 LSP-GQASAHLQFYARYLADGGAVTPGDANASATFILAYE 172
           L   G ++  L   A Y   GG VT G+  +       Y+
Sbjct: 83  LGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ 122


>1klfB [b.2.3 - b.2.3] FIMH PROTEIN
          Length = 279

 Score = 36.2 bits (82), Expect = 7e-05
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 12/100 (12%)

Query: 74  QNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVT 133
           QN G   SG T      AD+ N+ +   TA  S A G+G+ L  +N T+IP    ++ V+
Sbjct: 191 QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVS 239

Query: 134 LSP-GQASAHLQFYARYLADGGAVTPGDANASATFILAYE 172
           L   G ++  L   A Y   GG VT G+  +       Y+
Sbjct: 240 LGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ 279


>1kiuB [b.2.3 - b.2.3] FIMH PROTEIN
          Length = 279

 Score = 36.2 bits (82), Expect = 7e-05
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 12/100 (12%)

Query: 74  QNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVT 133
           QN G   SG T      AD+ N+ +   TA  S A G+G+ L  +N T+IP    ++ V+
Sbjct: 191 QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVS 239

Query: 134 LSP-GQASAHLQFYARYLADGGAVTPGDANASATFILAYE 172
           L   G ++  L   A Y   GG VT G+  +       Y+
Sbjct: 240 LGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ 279


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 900,583,994
Number of extensions: 36277283
Number of successful extensions: 88298
Number of sequences better than 1.0e-03: 1720
Number of HSP's gapped: 86902
Number of HSP's successfully gapped: 1933
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)