BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF68745.1 sent8 ACF68745.1 GIB00763CH01 "secreted effector
protein"
         (408 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cxbA [x.x.x] PROTEIN SIFA                                             40   2e-05

>3cxbA [x.x.x] PROTEIN SIFA
          Length = 302

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 15/115 (13%)

Query: 33  LWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVRGAYIKLRALASQGCKEQFIIES 92
           LWEKIK +FF+T  A+A  C+  +    E   T  ++   + +L+ LA    +++F + +
Sbjct: 10  LWEKIKDFFFSTGKAKADRCLHEML-FAERAPTRERLTEIFFELKELACASQRDRFQVHN 68

Query: 93  QEHADKLI---IKDDNGENIL--------SIEVECHPEAFGLAK---EINKSHPK 133
               D  I   I D N EN L        +   E     + L K   +I KSHP+
Sbjct: 69  PHENDATIILRIMDQNEENELLRITQNTDTFSCEVMGNLYFLMKDRPDILKSHPQ 123


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.337    0.147    0.479 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 967,557,692
Number of extensions: 39978455
Number of successful extensions: 93195
Number of sequences better than 1.0e-03: 1709
Number of HSP's gapped: 91056
Number of HSP's successfully gapped: 2027
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)