BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF69636.1 sent8 ACF69636.1 GIB00763CH01 "2,5-diketo-D-gluconic
acid reductase A"
         (289 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1vp5A [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE                    265   1e-73
1vp5B [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE                    264   2e-73
3f7jA [x.x.x] YVGN PROTEIN                                            223   7e-61
3d3fA [x.x.x] YVGN PROTEIN                                            223   7e-61
1vbjB [x.x.x] PROSTAGLANDIN F SYNTHASE                                214   3e-58
1vbjA [x.x.x] PROSTAGLANDIN F SYNTHASE                                214   3e-58
3b3dB [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE                         212   1e-57
3b3dA [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE                         212   1e-57
1mzrB [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A                      192   1e-51
1mzrA [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A                      192   1e-51
1zgdA [x.x.x] CHALCONE REDUCTASE                                      184   4e-49
3caqB [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE                    181   3e-48
3burA [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE                    181   3e-48
3h7rA [x.x.x] ALDO-KETO REDUCTASE                                     177   3e-47
1a80A [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A                  172   1e-45
1qwkA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1                  171   2e-45
3h7uA [x.x.x] ALDO-KETO REDUCTASE                                     171   2e-45
1hw6A [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE                    168   2e-44
1m9hA [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A                  166   6e-44
1jezA [c.1.7] XYLOSE REDUCTASE                                        166   8e-44
1j96B [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3              166   8e-44
2fgbA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  166   1e-43
1k8cA [c.1.7] XYLOSE REDUCTASE                                        164   2e-43
1z9aA [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE                    164   3e-43
1xjbB [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2                  164   3e-43
1xjbA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2                  164   3e-43
1mi3A [c.1.7] XYLOSE REDUCTASE                                        164   3e-43
1j96A [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3              164   3e-43
1ihiA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE                    164   3e-43
1xf0A [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  164   4e-43
1jezB [c.1.7] XYLOSE REDUCTASE                                        164   4e-43
1ye4A [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE                    163   7e-43
1zq5A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  162   9e-43
1sm9A [c.1.7] XYLOSE REDUCTASE                                        162   9e-43
2ipjA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2                  162   1e-42
1mrqA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1                  162   1e-42
3c3uA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1                  162   1e-42
1s1rA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  161   2e-42
1s1pA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  161   2e-42
1ry0A [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3                  161   2e-42
1zuaX [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER B10                 161   3e-42
1r38A [c.1.7] XYLOSE REDUCTASE                                        160   4e-42
2fvlA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C4                 157   3e-41
3h4gA [x.x.x] ALCOHOL DEHYDROGENASE [NADP+]                           155   1e-40
3cv7A [x.x.x] ALCOHOL DEHYDROGENASE                                   155   1e-40
2ao0A [x.x.x] ALDEHYDE DEHYDROGENASE                                  155   1e-40
1hqtA [c.1.7] ALDEHYDE REDUCTASE                                      155   2e-40
3cv6A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21                 152   9e-40
1q13B [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE                            151   3e-39
1q5mA [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE                            150   4e-39
2he5C [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21                150   4e-39
2he8A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21                150   6e-39
2p5nA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21                149   1e-38
2hejA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21                149   1e-38
2he8B [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21                149   1e-38
2ipgA [x.x.x] 3(17)ALPHA-HYDROXYSTEROID DEHYDROGENASE                 146   6e-38
2bgsA [x.x.x] ALDOSE REDUCTASE                                        145   2e-37
1frbA [x.x.x] FR-1 PROTEIN                                            144   4e-37
1c9wA [c.1.7] CHO REDUCTASE                                           142   2e-36
2ipwA [x.x.x] ALDOSE REDUCTASE                                        141   2e-36
2alrA [x.x.x] ALDEHYDE REDUCTASE                                      141   2e-36
2bgqA [x.x.x] ALDOSE REDUCTASE                                        140   6e-36
1az1A [x.x.x] ALDOSE REDUCTASE                                        136   7e-35
1ah3A [c.1.7 (1ekoA)] ALDOSE REDUCTASE                                135   1e-34
1ah0A [x.x.x] ALDOSE REDUCTASE                                        135   1e-34
2i16A [x.x.x] ALDOSE REDUCTASE                                        135   1e-34
1z8aA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
1us0A [c.1.7] ALDOSE REDUCTASE                                        135   2e-34
1pwmA [c.1.7] ALDOSE REDUCTASE                                        135   2e-34
2pdyA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdxA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdqA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdmA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdkA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdiA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdhA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdfA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pdbA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2is7A [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2ikiA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
1el3A [c.1.7] ALDOSE REDUCTASE                                        135   2e-34
2dv0A [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2agtA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
1adsA [c.1.7 (1ef3A)] ALDOSE REDUCTASE                                135   2e-34
2acsA [x.x.x] ALDOSE REDUCTASE                                        135   2e-34
2pd5A [x.x.x] ALDOSE REDUCTASE                                        134   3e-34
1afsA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE                    134   3e-34
2acuA [x.x.x] ALDOSE REDUCTASE                                        133   7e-34
1xgdA [x.x.x] ALDOSE REDUCTASE                                        132   1e-33
1ralA [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE                    132   1e-33
1lwiA [c.1.7] 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE        130   4e-33
1pyfA [c.1.7] IOLS PROTEIN                                             62   2e-12
1og6C [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF                         57   9e-11
1og6A [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF                         57   9e-11
1ynqA [x.x.x] OXIDOREDUCTASE                                           54   6e-10
1pz1A [c.1.7] GENERAL STRESS PROTEIN 69                                54   7e-10
1ynpA [x.x.x] OXIDOREDUCTASE                                           47   7e-08
3erpB [x.x.x] PUTATIVE OXIDOREDUCTASE                                  47   9e-08
1ynpB [x.x.x] OXIDOREDUCTASE                                           46   1e-07
1og6B [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF                         46   1e-07
1ur3M [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF                         46   2e-07
3erpA [x.x.x] PUTATIVE OXIDOREDUCTASE                                  43   1e-06
2bp1B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                 42   3e-06
2c91B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                 40   7e-06
2c91A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                 40   7e-06
2bp1A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                 39   1e-05
2clpI [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3                 38   3e-05
2clpA [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3                 38   3e-05
1gveA [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE                          38   4e-05
1gveB [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE                          37   7e-05
1lqaA [c.1.7] TAS PROTEIN                                              34   5e-04
1zsxA [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL BETA-2 SUBUNIT           34   6e-04

>1vp5A [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
          Length = 284

 Score =  265 bits (677), Expect = 1e-73
 Identities = 130/281 (46%), Positives = 190/281 (67%), Gaps = 3/281 (1%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L+N ++MP++G+GVF++   E+ ++ V  AI+ GYRLIDTAA Y NE+ VG A+++AI  
Sbjct: 7   LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDE 65

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRAL 125
           G+  REELF+T+KLWV D+  Y+  K   E SLKK  L+Y DLYL+HQ  GD   AW+A+
Sbjct: 66  GIVRREELFVTTKLWVSDVG-YESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAM 124

Query: 126 EDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQP 185
           E+ Y+ G ++AIGVSNFY   L +      I P VNQ+E+HP++ +   +E M++YN+QP
Sbjct: 125 EEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQP 184

Query: 186 EAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFA 245
           EAW P   GR   ++N +L+ IA+ + KT+AQV+LRW  Q+G+  IPK+ R+ER++EN +
Sbjct: 185 EAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENIS 244

Query: 246 IWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVRGCLGVK 286
           I+DF LT  +M +I  LD G       H +PE V+    +K
Sbjct: 245 IFDFELTQEDMEKIATLDEGQ-SAFFSHRDPEVVKWICSLK 284


>1vp5B [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
          Length = 283

 Score =  264 bits (675), Expect = 2e-73
 Identities = 129/275 (46%), Positives = 188/275 (68%), Gaps = 3/275 (1%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L+N ++MP++G+GVF++   E+ ++ V  AI+ GYRLIDTAA Y NE+ VG A+++AI  
Sbjct: 7   LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDE 65

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRAL 125
           G+  REELF+T+KLWV D+  Y+  K   E SLKK  L+Y DLYL+HQ  GD   AW+A+
Sbjct: 66  GIVRREELFVTTKLWVSDVG-YESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAM 124

Query: 126 EDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQP 185
           E+ Y+ G ++AIGVSNFY   L +      I P VNQ+E+HP++ +   +E M++YN+QP
Sbjct: 125 EEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQP 184

Query: 186 EAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFA 245
           EAW P   GR   ++N +L+ IA+ + KT+AQV+LRW  Q+G+  IPK+ R+ER++EN +
Sbjct: 185 EAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENIS 244

Query: 246 IWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVR 280
           I+DF LT  +M +I  LD G       H +PE V+
Sbjct: 245 IFDFELTQEDMEKIATLDEGQ-SAFFSHRDPEVVK 278


>3f7jA [x.x.x] YVGN PROTEIN
          Length = 276

 Score =  223 bits (567), Expect = 7e-61
 Identities = 121/259 (46%), Positives = 165/259 (63%), Gaps = 8/259 (3%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L N ++MP  G GVFKV +  E  +SV +AI++GYR IDTAA+Y NE+ VG  ++++   
Sbjct: 11  LHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA 70

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD-YFSAWRA 124
               REELFITSK+W +D   Y+   A  E SL++  LDY DLYL+H    D Y   WRA
Sbjct: 71  ----REELFITSKVWNEDQG-YETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRA 125

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
           LE  Y+ GK++AIGVSNF  H L    +   I PMVNQVE HP   Q    +  K   +Q
Sbjct: 126 LEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQ 185

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
            EAW+PL  G  +  +N +L +IA+ H K++AQV+LRW++Q GV  IPKS ++ RI EN 
Sbjct: 186 LEAWSPLMQG--QLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENA 243

Query: 245 AIWDFSLTDNEMAQINALD 263
            I+DF L+  +M +I+AL+
Sbjct: 244 DIFDFELSQEDMDKIDALN 262


>3d3fA [x.x.x] YVGN PROTEIN
          Length = 275

 Score =  223 bits (567), Expect = 7e-61
 Identities = 121/259 (46%), Positives = 165/259 (63%), Gaps = 8/259 (3%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L N ++MP  G GVFKV +  E  +SV +AI++GYR IDTAA+Y NE+ VG  ++++   
Sbjct: 10  LHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA 69

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD-YFSAWRA 124
               REELFITSK+W +D   Y+   A  E SL++  LDY DLYL+H    D Y   WRA
Sbjct: 70  ----REELFITSKVWNEDQG-YETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRA 124

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
           LE  Y+ GK++AIGVSNF  H L    +   I PMVNQVE HP   Q    +  K   +Q
Sbjct: 125 LEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQ 184

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
            EAW+PL  G  +  +N +L +IA+ H K++AQV+LRW++Q GV  IPKS ++ RI EN 
Sbjct: 185 LEAWSPLMQG--QLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENA 242

Query: 245 AIWDFSLTDNEMAQINALD 263
            I+DF L+  +M +I+AL+
Sbjct: 243 DIFDFELSQEDMDKIDALN 261


>1vbjB [x.x.x] PROSTAGLANDIN F SYNTHASE
          Length = 279

 Score =  214 bits (545), Expect = 3e-58
 Identities = 116/262 (44%), Positives = 163/262 (62%), Gaps = 8/262 (3%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LSN + MP++GFG++K+ D  E + + + AI+SGYR IDTAA+Y NE++ G    +AIA+
Sbjct: 12  LSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAG----RAIAS 67

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF-SAWRA 124
               REELF+T+KLW  D   Y+   +  E S+KK GL+Y DLYL+H    D F   W+A
Sbjct: 68  CGVPREELFVTTKLWNSDQG-YESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFIDTWKA 126

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
            E  Y   K++AIGVSNF+ H +    +  ++ PMVNQ+ELHP   Q A  E  K  N+ 
Sbjct: 127 FEKLYADKKVRAIGVSNFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIA 186

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
             AW+PLG G     E+  L+ I   + KT AQV+LRW +Q GV  IPKS  + RI+EN 
Sbjct: 187 VTAWSPLGQGH--LVEDARLKAIGGKYGKTAAQVMLRWEIQAGVITIPKSGNEARIKENG 244

Query: 245 AIWDFSLTDNEMAQINALDLGY 266
            I+DF LT  ++  I+ ++ G+
Sbjct: 245 NIFDFELTAEDIQVIDGMNAGH 266


>1vbjA [x.x.x] PROSTAGLANDIN F SYNTHASE
          Length = 281

 Score =  214 bits (545), Expect = 3e-58
 Identities = 116/262 (44%), Positives = 163/262 (62%), Gaps = 8/262 (3%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LSN + MP++GFG++K+ D  E + + + AI+SGYR IDTAA+Y NE++ G    +AIA+
Sbjct: 14  LSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAG----RAIAS 69

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF-SAWRA 124
               REELF+T+KLW  D   Y+   +  E S+KK GL+Y DLYL+H    D F   W+A
Sbjct: 70  CGVPREELFVTTKLWNSDQG-YESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFIDTWKA 128

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
            E  Y   K++AIGVSNF+ H +    +  ++ PMVNQ+ELHP   Q A  E  K  N+ 
Sbjct: 129 FEKLYADKKVRAIGVSNFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIA 188

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
             AW+PLG G     E+  L+ I   + KT AQV+LRW +Q GV  IPKS  + RI+EN 
Sbjct: 189 VTAWSPLGQGH--LVEDARLKAIGGKYGKTAAQVMLRWEIQAGVITIPKSGNEARIKENG 246

Query: 245 AIWDFSLTDNEMAQINALDLGY 266
            I+DF LT  ++  I+ ++ G+
Sbjct: 247 NIFDFELTAEDIQVIDGMNAGH 268


>3b3dB [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
          Length = 277

 Score =  212 bits (540), Expect = 1e-57
 Identities = 112/259 (43%), Positives = 158/259 (61%), Gaps = 4/259 (1%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L N ++MP  G GVF+V +  E   +V +AI  GYR IDTAA+YGN              
Sbjct: 8   LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXX 67

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM-GDYFSAWRA 124
                 +LFITSK+W  D+  Y+   A  E SL K GLDY DLYL+H  + G Y  AWRA
Sbjct: 68  XXXXXXDLFITSKVWNADLG-YEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRA 126

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
           LE  Y+ G++KAIGVSNF  H L +      I PM+NQVE HP   Q   +   ++  +Q
Sbjct: 127 LETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQ 186

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
            EAW+PL  G  +  ++ +L  IA  + K++AQ++LRW++Q G+  IPKST++ RI+EN 
Sbjct: 187 MEAWSPLMQG--QLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENA 244

Query: 245 AIWDFSLTDNEMAQINALD 263
           +++DF LT ++M +I+AL+
Sbjct: 245 SVFDFELTQDDMNRIDALN 263


>3b3dA [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
          Length = 280

 Score =  212 bits (540), Expect = 1e-57
 Identities = 112/259 (43%), Positives = 158/259 (61%), Gaps = 4/259 (1%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L N ++MP  G GVF+V +  E   +V +AI  GYR IDTAA+YGN              
Sbjct: 11  LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXX 70

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM-GDYFSAWRA 124
                 +LFITSK+W  D+  Y+   A  E SL K GLDY DLYL+H  + G Y  AWRA
Sbjct: 71  XXXXXXDLFITSKVWNADLG-YEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRA 129

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQ 184
           LE  Y+ G++KAIGVSNF  H L +      I PM+NQVE HP   Q   +   ++  +Q
Sbjct: 130 LETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQ 189

Query: 185 PEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENF 244
            EAW+PL  G  +  ++ +L  IA  + K++AQ++LRW++Q G+  IPKST++ RI+EN 
Sbjct: 190 MEAWSPLMQG--QLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENA 247

Query: 245 AIWDFSLTDNEMAQINALD 263
           +++DF LT ++M +I+AL+
Sbjct: 248 SVFDFELTQDDMNRIDALN 266


>1mzrB [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
          Length = 276

 Score =  192 bits (487), Expect = 1e-51
 Identities = 103/257 (40%), Positives = 151/257 (58%), Gaps = 11/257 (4%)

Query: 12  MPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTRE 71
           MP +G GV++ ++ EE   ++  A+  GYR IDTAA Y NE+ VG A++ A       RE
Sbjct: 16  MPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVN----RE 70

Query: 72  ELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---QAMGDYFSAWRALEDA 128
           ELFIT+KLW  D   +   +  +  SLKK  LDY DLYL+H    A+  Y  AW+ + + 
Sbjct: 71  ELFITTKLWNDD---HKRPREALLDSLKKLQLDYIDLYLMHWPVPAIDHYVEAWKGMIEL 127

Query: 129 YEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAW 188
            + G +K+IGV NF  H L    +   +TP++NQ+ELHP   Q         + +Q E+W
Sbjct: 128 QKEGLIKSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESW 187

Query: 189 APLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWD 248
           +PL  G    ++  +++ +AD + KT AQ+V+RW++  G+ VIPKS    RI ENF +WD
Sbjct: 188 SPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWD 247

Query: 249 FSLTDNEMAQINALDLG 265
           F L  +E+ +I  LD G
Sbjct: 248 FRLDKDELGEIAKLDQG 264


>1mzrA [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
          Length = 274

 Score =  192 bits (487), Expect = 1e-51
 Identities = 103/257 (40%), Positives = 151/257 (58%), Gaps = 11/257 (4%)

Query: 12  MPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTRE 71
           MP +G GV++ ++ EE   ++  A+  GYR IDTAA Y NE+ VG A++ A       RE
Sbjct: 14  MPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVN----RE 68

Query: 72  ELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---QAMGDYFSAWRALEDA 128
           ELFIT+KLW  D   +   +  +  SLKK  LDY DLYL+H    A+  Y  AW+ + + 
Sbjct: 69  ELFITTKLWNDD---HKRPREALLDSLKKLQLDYIDLYLMHWPVPAIDHYVEAWKGMIEL 125

Query: 129 YEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAW 188
            + G +K+IGV NF  H L    +   +TP++NQ+ELHP   Q         + +Q E+W
Sbjct: 126 QKEGLIKSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESW 185

Query: 189 APLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWD 248
           +PL  G    ++  +++ +AD + KT AQ+V+RW++  G+ VIPKS    RI ENF +WD
Sbjct: 186 SPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWD 245

Query: 249 FSLTDNEMAQINALDLG 265
           F L  +E+ +I  LD G
Sbjct: 246 FRLDKDELGEIAKLDQG 262


>1zgdA [x.x.x] CHALCONE REDUCTASE
          Length = 308

 Score =  184 bits (466), Expect = 4e-49
 Identities = 106/276 (38%), Positives = 160/276 (57%), Gaps = 24/276 (8%)

Query: 7   SNNLKMPMVGFGVFK-VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           S+ LKMP+VG G     T K++ + +++ AI+ GYR  DTAA YG+E A+G+A+++AI  
Sbjct: 11  SSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIEL 70

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------- 116
           GL TR++LF+TSKLWV +   + L    ++ SLK   LDY DLYL+H  +          
Sbjct: 71  GLVTRDDLFVTSKLWVTENHPH-LVIPALQKSLKTLQLDYLDLYLIHWPLSSQPGKFSFP 129

Query: 117 ---------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHP 167
                    D    W ++E++ + G  KAIGVSNF    L N      + P VNQVE++ 
Sbjct: 130 IDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNL 189

Query: 168 YFAQPAALETMKHYNVQPEAWAPL----GGGRHKPYENVMLQRIADAHQKTIAQVVLRWN 223
            + Q    E    + +   A++P+      G ++  EN ML+ IADAH K++AQ+ LRW 
Sbjct: 190 AWQQKKLREFCNAHGIVLTAFSPVRKGASRGPNEVMENDMLKEIADAHGKSVAQISLRWL 249

Query: 224 VQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
            ++GVT +PKS  +ER+ +N  I+D+SLT  +  +I
Sbjct: 250 YEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKI 285


>3caqB [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
          Length = 324

 Score =  181 bits (458), Expect = 3e-48
 Identities = 112/293 (38%), Positives = 161/293 (54%), Gaps = 36/293 (12%)

Query: 6   LSNNLKMPMVGFGVF---KVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           LS+   +P++G G +   K T K  C  SV  AI +GYR ID A +Y NE  VG+A+R+ 
Sbjct: 10  LSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREK 69

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GDY 118
           IA G   RE++F   KLW  +    ++ +  +E +L+   LDY DLY++   M    GD 
Sbjct: 70  IAEGKVRREDIFYCGKLWATNHVP-EMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDE 128

Query: 119 F-----------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                             + W A+E   +AG +K++GVSNF    L        ++  P+
Sbjct: 129 IYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPV 188

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENV---------MLQRIADA 210
            NQVE HPYF QP  L+  + +++   A++PLG  R+  + NV         +L  +   
Sbjct: 189 SNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKR 248

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + KT AQ+VLR+N+QRGV VIPKS   ERI+ENF I+DFSLT+ EM  I AL+
Sbjct: 249 YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN 301


>3burA [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
          Length = 325

 Score =  181 bits (458), Expect = 3e-48
 Identities = 112/293 (38%), Positives = 161/293 (54%), Gaps = 36/293 (12%)

Query: 6   LSNNLKMPMVGFGVF---KVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           LS+   +P++G G +   K T K  C  SV  AI +GYR ID A +Y NE  VG+A+R+ 
Sbjct: 11  LSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREK 70

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GDY 118
           IA G   RE++F   KLW  +    ++ +  +E +L+   LDY DLY++   M    GD 
Sbjct: 71  IAEGKVRREDIFYCGKLWATNHVP-EMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDE 129

Query: 119 F-----------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                             + W A+E   +AG +K++GVSNF    L        ++  P+
Sbjct: 130 IYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPV 189

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENV---------MLQRIADA 210
            NQVE HPYF QP  L+  + +++   A++PLG  R+  + NV         +L  +   
Sbjct: 190 SNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKR 249

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + KT AQ+VLR+N+QRGV VIPKS   ERI+ENF I+DFSLT+ EM  I AL+
Sbjct: 250 YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN 302


>3h7rA [x.x.x] ALDO-KETO REDUCTASE
          Length = 307

 Score =  177 bits (450), Expect = 3e-47
 Identities = 102/270 (37%), Positives = 148/270 (54%), Gaps = 27/270 (10%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L+   K+P VG G + +        ++  AI+ GYR ID A++YGNE  +G  ++K I  
Sbjct: 6   LNTGAKLPCVGLGTYAMV-----ATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGD 60

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------- 116
           G   REELFITSKLW  D    D+ KA +E +L+   +DY DLYL+H             
Sbjct: 61  GFVKREELFITSKLWSNDHLPEDVPKA-LEKTLQDLQIDYVDLYLIHWPASLKKESLMPT 119

Query: 117 -------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYF 169
                  D  S W+A+E  Y++GK +AIGVSNF +  L +     R+TP VNQVE HP +
Sbjct: 120 PEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVW 179

Query: 170 AQPAALETMKHYNVQPEAWAPLGGG-----RHKPYENVMLQRIADAHQKTIAQVVLRWNV 224
            Q    E  K   V    ++PLG       R K  +N ++  +A+   KT AQV LRW +
Sbjct: 180 QQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGL 239

Query: 225 QRGVTVIPKSTRQERIEENFAIWDFSLTDN 254
           Q G +V+PKS+   R++EN  ++D+S+ ++
Sbjct: 240 QTGHSVLPKSSSGARLKENLDVFDWSIPED 269


>1a80A [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
          Length = 277

 Score =  172 bits (436), Expect = 1e-45
 Identities = 100/264 (37%), Positives = 144/264 (54%), Gaps = 9/264 (3%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L++   +P +G+GVFKV   +  Q++V  A+  GYR IDTAA+YGNE+ V         
Sbjct: 6   VLNDGNSIPQLGYGVFKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXX 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---QAMGDYFSA 121
                R++LFIT+KLW  D  + D               D  DLYL+H    A  +Y  A
Sbjct: 65  X----RDDLFITTKLW-NDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAADNYVHA 119

Query: 122 WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHY 181
           W  + +   AG  ++IGVSN     L        + P VNQ+ELHP + Q    +    +
Sbjct: 120 WEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAH 179

Query: 182 NVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIE 241
           +V+ E+W PLG G++  +    +      H KT AQ VLRW++Q+G  V PKS R+ER+E
Sbjct: 180 DVKIESWGPLGQGKYDLFGAEPVTXXXXXHGKTPAQAVLRWHLQKGFVVFPKSVRRERLE 239

Query: 242 ENFAIWDFSLTDNEMAQINALDLG 265
           EN  ++DF LTD E+A I+A+D G
Sbjct: 240 ENLDVFDFDLTDTEIAAIDAMDPG 263


>1qwkA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
          Length = 312

 Score =  171 bits (433), Expect = 2e-45
 Identities = 105/283 (37%), Positives = 166/283 (58%), Gaps = 32/283 (11%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LSN ++MP++G G ++ +   E   +V +A+++GYRLIDTA+VY NE+A+G A+++ +  
Sbjct: 6   LSNGVEMPVIGLGTWQ-SSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEE 64

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQ--AMGDYFS--- 120
           G+  REELFIT+K W  ++A   L + G+  SLKK  L+Y DLYL H   A  D  S   
Sbjct: 65  GVVKREELFITTKAWTHELAPGKL-EGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHI 123

Query: 121 ------AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVN-QVELHPYFAQPA 173
                  WR  +  Y+AG  KA+GVSN+    ++     + +TP+ N QVELH YF Q  
Sbjct: 124 ASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISR-ALALGLTPVHNSQVELHLYFPQHD 182

Query: 174 ALETMKHYNVQPEAWAPLGG-GR----------------HKPYENVMLQRIADAHQKTIA 216
            ++  K +N+   ++A LG  GR                    ++  +  +A+   KT A
Sbjct: 183 HVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPA 242

Query: 217 QVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           QV+LR+ + RG  ++PKS ++ RI+ENF ++DFSLT+ ++A++
Sbjct: 243 QVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKL 285


>3h7uA [x.x.x] ALDO-KETO REDUCTASE
          Length = 312

 Score =  171 bits (433), Expect = 2e-45
 Identities = 104/279 (37%), Positives = 154/279 (55%), Gaps = 23/279 (8%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           L+   K P VG G ++ +       +V +A++ GYR ID A +YGNE  +G  ++K    
Sbjct: 7   LNTGAKFPSVGLGTWQASPGL-VGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFED 65

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQ-------AMG-- 116
            +  RE+LFITSKLW  D    D+ +A +  +LK   L+Y DLYL+H        ++G  
Sbjct: 66  RVVKREDLFITSKLWCTDHDPQDVPEA-LNRTLKDLQLEYVDLYLIHWPARIKKGSVGIK 124

Query: 117 -------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYF 169
                  D  S W+A+E  Y++GK +AIGVSNF    LA+  E  R+ P VNQVE HP +
Sbjct: 125 PENLLPVDIPSTWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSW 184

Query: 170 AQPAALETMKHYNVQPEAWAPLGGG-----RHKPYENVMLQRIADAHQKTIAQVVLRWNV 224
            Q    E  K   V   A++PLG       +    +N +L  +A+   K+ AQV LRW +
Sbjct: 185 RQTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGL 244

Query: 225 QRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           Q G +V+PKST + RI+ENF ++D+S+ D   A+   ++
Sbjct: 245 QMGHSVLPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIE 283


>1hw6A [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
          Length = 257

 Score =  168 bits (425), Expect = 2e-44
 Identities = 98/262 (37%), Positives = 141/262 (53%), Gaps = 14/262 (5%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L++   +P +G+GVFKV   +  Q++V  A+  GYR IDTAA+YGNE+ V         
Sbjct: 6   VLNDGNSIPQLGYGVFKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXX 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---QAMGDYFSA 121
                R++LFIT+KLW       D               D  DLYL+H    A  +Y  A
Sbjct: 65  X----RDDLFITTKLW------NDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAADNYVHA 114

Query: 122 WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHY 181
           W  + +   AG  ++IGVSN     L        + P VNQ+ELHP + Q    +    +
Sbjct: 115 WEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAH 174

Query: 182 NVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIE 241
           +V+ E+W PLG G++  +    +      H KT AQ VLRW++Q+G  V PKS R+ER+E
Sbjct: 175 DVKIESWGPLGQGKYDLFGAEPVTXXXXXHGKTPAQAVLRWHLQKGFVVFPKSVRRERLE 234

Query: 242 ENFAIWDFSLTDNEMAQINALD 263
           EN  ++DF LTD E+A I+A+D
Sbjct: 235 ENLDVFDFDLTDTEIAAIDAMD 256


>1m9hA [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
          Length = 277

 Score =  166 bits (421), Expect = 6e-44
 Identities = 97/264 (36%), Positives = 142/264 (53%), Gaps = 9/264 (3%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L++   +P +G+GV+KV   +  Q++V  A+  GYR IDTAA+YGNE+ V         
Sbjct: 6   VLNDGNSIPQLGYGVYKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXX 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---QAMGDYFSA 121
                R++LFIT+KLW  D  + D               D  DLYL+H    A  +Y  A
Sbjct: 65  X----RDDLFITTKLW-NDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAADNYVHA 119

Query: 122 WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHY 181
           W  + +   AG  ++IGVSN     L        + P VNQ+ELHP + Q    +    +
Sbjct: 120 WEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAH 179

Query: 182 NVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIE 241
           +V+ E+W PLG G++  +    +      H KT AQ VLRW++Q+G  V P S R+E +E
Sbjct: 180 DVKIESWGPLGQGKYDLFGAEPVTXXXXXHGKTPAQAVLRWHLQKGFVVFPGSVRREHLE 239

Query: 242 ENFAIWDFSLTDNEMAQINALDLG 265
           EN  ++DF LTD E+A I+A+D G
Sbjct: 240 ENLDVFDFDLTDTEIAAIDAMDPG 263


>1jezA [c.1.7] XYLOSE REDUCTASE
          Length = 300

 Score =  166 bits (420), Expect = 8e-44
 Identities = 109/289 (37%), Positives = 149/289 (51%), Gaps = 40/289 (13%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIA 216
            P V QVE HPY  QP  +E  +   V   A++ L       + +  ++ IA  + KT A
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSTL-------FAHDTIKAIAAKYNKTPA 235

Query: 217 QVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLG 265
           +V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+G
Sbjct: 236 EVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG 284


>1j96B [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
          Length = 318

 Score =  166 bits (420), Expect = 8e-44
 Identities = 101/281 (35%), Positives = 153/281 (54%), Gaps = 30/281 (10%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 16  MPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 76  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKILF 134

Query: 117 ---DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELHPYFAQ 171
              D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE HPYF Q
Sbjct: 135 DTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQ 194

Query: 172 PAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQVVLRW 222
              L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A + LR+
Sbjct: 195 RKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRY 254

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 255 QLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 295


>2fgbA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 312

 Score =  166 bits (419), Expect = 1e-43
 Identities = 100/275 (36%), Positives = 151/275 (54%), Gaps = 24/275 (8%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  + +  +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 16  MPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG----------DYF 119
           RE++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M           D  
Sbjct: 76  REDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEIFDIVDLC 134

Query: 120 SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELHPYFAQPAALET 177
           + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE HPYF +   L+ 
Sbjct: 135 TTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDF 194

Query: 178 MKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQVVLRWNVQRGV 228
            K  ++   A++ LG  R K +         E+ +L  +A  H++T A + LR+ +QRGV
Sbjct: 195 CKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGV 254

Query: 229 TVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 255 VVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 289


>1k8cA [c.1.7] XYLOSE REDUCTASE
          Length = 317

 Score =  164 bits (416), Expect = 2e-43
 Identities = 110/299 (36%), Positives = 152/299 (50%), Gaps = 43/299 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGRHKP--YENVMLQR 206
            P V QVE HPY  QP  +E  +   V         P+++   G   + P  + +  ++ 
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVNQGRALNTPTLFAHDTIKA 242

Query: 207 IADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLG 265
           IA  + KT A+V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+G
Sbjct: 243 IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG 301


>1z9aA [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
          Length = 319

 Score =  164 bits (415), Expect = 3e-43
 Identities = 111/301 (36%), Positives = 154/301 (51%), Gaps = 45/301 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGR--HKP--YENVML 204
            P V QVE HPY  QP  +E  +   V         P+++  +  GR  + P  + +  +
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTI 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
           + IA  + KT A+V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+
Sbjct: 243 KAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI 302

Query: 265 G 265
           G
Sbjct: 303 G 303


>1xjbB [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
          Length = 322

 Score =  164 bits (415), Expect = 3e-43
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 15  MPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 74

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 75  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 133

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE H
Sbjct: 134 GKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECH 193

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 194 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 253

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 254 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 299


>1xjbA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
          Length = 325

 Score =  164 bits (415), Expect = 3e-43
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 18  MPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 77

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 78  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 136

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE H
Sbjct: 137 GKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECH 196

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 197 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 256

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 257 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 302


>1mi3A [c.1.7] XYLOSE REDUCTASE
          Length = 319

 Score =  164 bits (415), Expect = 3e-43
 Identities = 111/301 (36%), Positives = 154/301 (51%), Gaps = 45/301 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGR--HKP--YENVML 204
            P V QVE HPY  QP  +E  +   V         P+++  +  GR  + P  + +  +
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTI 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
           + IA  + KT A+V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+
Sbjct: 243 KAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI 302

Query: 265 G 265
           G
Sbjct: 303 G 303


>1j96A [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
          Length = 323

 Score =  164 bits (415), Expect = 3e-43
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 16  MPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 76  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 134

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE H
Sbjct: 135 GKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECH 194

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 195 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 254

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 255 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 300


>1ihiA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
          Length = 320

 Score =  164 bits (415), Expect = 3e-43
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 14  MPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 73

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 74  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 132

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE H
Sbjct: 133 GKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECH 192

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 193 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 252

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 253 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 298


>1xf0A [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 316

 Score =  164 bits (414), Expect = 4e-43
 Identities = 101/284 (35%), Positives = 152/284 (53%), Gaps = 34/284 (11%)

Query: 12  MPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTRE 71
           MP++GFG +   + +  + + L AI +G+R ID+A +Y NE+ VG A+R  IA G   RE
Sbjct: 12  MPVLGFGTYAPPESKALEVTKL-AIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKRE 70

Query: 72  ELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------------- 116
           ++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M                
Sbjct: 71  DIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGK 129

Query: 117 ------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELHPY 168
                 D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE HPY
Sbjct: 130 VIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPY 189

Query: 169 FAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQVV 219
           F +   L+  K  ++   A++ LG  R K +         E+ +L  +A  H++T A + 
Sbjct: 190 FNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIA 249

Query: 220 LRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           LR+ +QRGV V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 250 LRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 293


>1jezB [c.1.7] XYLOSE REDUCTASE
          Length = 299

 Score =  164 bits (414), Expect = 4e-43
 Identities = 108/289 (37%), Positives = 148/289 (51%), Gaps = 39/289 (13%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 5   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 63

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 64  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 120

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 121 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 180

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIA 216
            P V QVE HPY  QP  +E  +   V   A++         + +  ++ IA  + KT A
Sbjct: 181 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSF------LFAHDTIKAIAAKYNKTPA 234

Query: 217 QVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLG 265
           +V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+G
Sbjct: 235 EVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG 283


>1ye4A [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
          Length = 319

 Score =  163 bits (412), Expect = 7e-43
 Identities = 110/301 (36%), Positives = 154/301 (51%), Gaps = 45/301 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGR--HKP--YENVML 204
            P V QVE HPY  QP  +E  +   V         P+++  +  GR  + P  + +  +
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTI 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
           + IA  + KT A+V+LRW  QRG+ VIP+S   ER+ +N +   F LT  +  +I  LD+
Sbjct: 243 KAIAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI 302

Query: 265 G 265
           G
Sbjct: 303 G 303


>1zq5A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 314

 Score =  162 bits (411), Expect = 9e-43
 Identities = 100/283 (35%), Positives = 151/283 (53%), Gaps = 32/283 (11%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  + +  +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 12  MPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 71

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M              
Sbjct: 72  REDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPNGKV 130

Query: 117 -----DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELHPYF 169
                D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE HPYF
Sbjct: 131 IFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYF 190

Query: 170 AQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQVVL 220
            +   L+  K  ++   A++ LG  R K +         E+ +L  +A  H++T A + L
Sbjct: 191 NRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIAL 250

Query: 221 RWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           R+ +QRGV V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 251 RYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 293


>1sm9A [c.1.7] XYLOSE REDUCTASE
          Length = 319

 Score =  162 bits (411), Expect = 9e-43
 Identities = 110/301 (36%), Positives = 154/301 (51%), Gaps = 45/301 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+H  +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGR--HKP--YENVML 204
            P V QVE HPY  QP  +E  +   V         P+++  +  GR  + P  + +  +
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTI 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
           + IA  + KT A+V+LRW  QRG+ VIP+S   ER+ +N +   F LT  +  +I  LD+
Sbjct: 243 KAIAAKYNKTPAEVLLRWAAQRGIAVIPRSDLPERLVQNRSFNTFDLTKEDFEEIAKLDI 302

Query: 265 G 265
           G
Sbjct: 303 G 303


>2ipjA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
          Length = 321

 Score =  162 bits (410), Expect = 1e-42
 Identities = 101/286 (35%), Positives = 152/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG     +  K +  ++V  AI +G+  ID+A VY NE+ VG A+R  IA G   
Sbjct: 14  MPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVK 73

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 74  REDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 132

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF   +L        ++  P+ NQVE H
Sbjct: 133 GKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECH 192

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 193 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 252

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 253 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 298


>1mrqA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
          Length = 323

 Score =  162 bits (409), Expect = 1e-42
 Identities = 100/286 (34%), Positives = 152/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++   AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 16  MPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 76  REDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 134

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 135 GKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECH 194

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 195 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 254

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 255 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 300


>3c3uA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
          Length = 320

 Score =  162 bits (409), Expect = 1e-42
 Identities = 100/286 (34%), Positives = 152/286 (53%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  K +  ++   AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 13  MPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 72

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW  +    +L +  +E SLK   LDY DLYL+H  +              
Sbjct: 73  REDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN 131

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 132 GKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECH 191

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  +A  H++T A 
Sbjct: 192 PYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL 251

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 252 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 297


>1s1rA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 316

 Score =  161 bits (408), Expect = 2e-42
 Identities = 100/286 (34%), Positives = 151/286 (52%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  + +  +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 11  MPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 70

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M              
Sbjct: 71  REDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDEN 129

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 130 GKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECH 189

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF +   L+  K  ++   A++ LG  R K +         E+ +L  +A  H++T A 
Sbjct: 190 PYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPAL 249

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 250 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 295


>1s1pA [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 315

 Score =  161 bits (408), Expect = 2e-42
 Identities = 100/286 (34%), Positives = 151/286 (52%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  + +  +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 11  MPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 70

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M              
Sbjct: 71  REDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDEN 129

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 130 GKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECH 189

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF +   L+  K  ++   A++ LG  R K +         E+ +L  +A  H++T A 
Sbjct: 190 PYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPAL 249

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 250 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 295


>1ry0A [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
          Length = 319

 Score =  161 bits (408), Expect = 2e-42
 Identities = 100/286 (34%), Positives = 151/286 (52%), Gaps = 35/286 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  + +  +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 12  MPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK 71

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW       +L +  +E SLKK+ LDY DLYL+H  M              
Sbjct: 72  REDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDEN 130

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 131 GKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECH 190

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PYF +   L+  K  ++   A++ LG  R K +         E+ +L  +A  H++T A 
Sbjct: 191 PYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPAL 250

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           + LR+ +QRGV V+ KS  ++RI +N  +++F LT  +M  I+ LD
Sbjct: 251 IALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD 296


>1zuaX [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER B10
          Length = 317

 Score =  161 bits (407), Expect = 3e-42
 Identities = 103/285 (36%), Positives = 147/285 (51%), Gaps = 33/285 (11%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS   KMP+VG G +K +   + +++V  AI +GYR ID A VY NE  VG+A+++ I  
Sbjct: 8   LSTKAKMPIVGLGTWK-SPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQE 66

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------- 116
               RE+LFI SKLW        L +   E +LK   L Y D+YL+H   G         
Sbjct: 67  KAVKREDLFIVSKLW-PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFP 125

Query: 117 ------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQ 162
                        +  AW A+E+  + G +KA+GVSNF    +        ++  P+ NQ
Sbjct: 126 KDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQ 185

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQKT 214
           VE HPY  Q   ++      +   A++PLG       KP      E+  ++ IA  H+KT
Sbjct: 186 VECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKT 245

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
            AQV++R+++QR V VIPKS    RI EN  ++DF L+D EMA I
Sbjct: 246 AAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATI 290


>1r38A [c.1.7] XYLOSE REDUCTASE
          Length = 319

 Score =  160 bits (405), Expect = 4e-42
 Identities = 110/301 (36%), Positives = 153/301 (50%), Gaps = 45/301 (14%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS+   MP +GFG +K+ +    +Q V  AI++GYRL D A  YGNE  VGD V++AI  
Sbjct: 7   LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDE 65

Query: 66  GLCTREELFITSKLW--VQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF---- 119
           GL  REE+F+TSKLW    D  N + A     A LK   +DY DL+L+   +   F    
Sbjct: 66  GLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLK---VDYVDLFLIAFPIAFKFVPIE 122

Query: 120 -----------------------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI 156
                                    W+ALE    AGK+K+IGVSNF   +L +      I
Sbjct: 123 EKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATI 182

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQ--------PEAWAPLGGGR--HKP--YENVML 204
            P V QVE HPY  QP  +E  +   V         P+++  +  GR  + P  + +  +
Sbjct: 183 KPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTI 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
           + IA  + KT A+V+LRW  QRG+ VIPKS   ER+ +N +   F LT  +  +I  LD+
Sbjct: 243 KAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI 302

Query: 265 G 265
           G
Sbjct: 303 G 303


>2fvlA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C4
          Length = 323

 Score =  157 bits (398), Expect = 3e-41
 Identities = 100/289 (34%), Positives = 148/289 (51%), Gaps = 35/289 (12%)

Query: 12  MPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           MP++GFG +   +  +    +    AI +G+R ID+A +Y NE+ VG A+R  IA G   
Sbjct: 16  MPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------------- 116
           RE++F TSKLW        + +  +E+SLKK  LDY DLYLLH  M              
Sbjct: 76  REDIFYTSKLWCT-FFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDEN 134

Query: 117 --------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                   D  + W  +E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 135 GKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECH 194

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
           PY  Q   L+  K  ++   A + LG  RHK +         E+ +L  +A  H++T A 
Sbjct: 195 PYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKRTPAL 254

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           + LR+ +QRGV V+ KS  ++RI EN  +++F LT  +M  ++ L+  Y
Sbjct: 255 IALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNY 303


>3h4gA [x.x.x] ALCOHOL DEHYDROGENASE [NADP+]
          Length = 320

 Score =  155 bits (393), Expect = 1e-40
 Identities = 98/289 (33%), Positives = 153/289 (52%), Gaps = 32/289 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K ++  + + ++  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 7   LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVG 65

Query: 65  TGLCT-REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GD-- 117
            G    REELF+TSKLW       D+  A +  +L    L+Y DLYL+H       GD  
Sbjct: 66  PGKAVPREELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYAFERGDNP 124

Query: 118 ---------------YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 125 FPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQ 184

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK---PYENVML-----QRIADAHQKT 214
           VE HPY AQ   +   +   ++  A++PLG        P E V+L     Q +A+ + ++
Sbjct: 185 VECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS 244

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL+
Sbjct: 245 PAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN 293


>3cv7A [x.x.x] ALCOHOL DEHYDROGENASE
          Length = 322

 Score =  155 bits (393), Expect = 1e-40
 Identities = 98/289 (33%), Positives = 153/289 (52%), Gaps = 32/289 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K ++  + + ++  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 7   LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVG 65

Query: 65  TGLCT-REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GD-- 117
            G    REELF+TSKLW       D+  A +  +L    L+Y DLYL+H       GD  
Sbjct: 66  PGKAVPREELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYAFERGDNP 124

Query: 118 ---------------YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 125 FPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQ 184

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK---PYENVML-----QRIADAHQKT 214
           VE HPY AQ   +   +   ++  A++PLG        P E V+L     Q +A+ + ++
Sbjct: 185 VECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS 244

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL+
Sbjct: 245 PAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN 293


>2ao0A [x.x.x] ALDEHYDE DEHYDROGENASE
          Length = 324

 Score =  155 bits (393), Expect = 1e-40
 Identities = 98/289 (33%), Positives = 153/289 (52%), Gaps = 32/289 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K ++  + + ++  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 6   LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVG 64

Query: 65  TGLCT-REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GD-- 117
            G    REELF+TSKLW       D+  A +  +L    L+Y DLYL+H       GD  
Sbjct: 65  PGKAVPREELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYAFERGDNP 123

Query: 118 ---------------YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 124 FPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK---PYENVML-----QRIADAHQKT 214
           VE HPY AQ   +   +   ++  A++PLG        P E V+L     Q +A+ + ++
Sbjct: 184 VECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS 243

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL+
Sbjct: 244 PAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN 292


>1hqtA [c.1.7] ALDEHYDE REDUCTASE
          Length = 324

 Score =  155 bits (391), Expect = 2e-40
 Identities = 97/289 (33%), Positives = 153/289 (52%), Gaps = 32/289 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K ++  + + ++  A+  GYR ID AA++GNE  +G+A+++ + 
Sbjct: 6   LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETVG 64

Query: 65  TGLCT-REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GD-- 117
            G    REELF+TSKLW       D+  A +  +L    L+Y DLYL+H       GD  
Sbjct: 65  PGKAVPREELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYAFERGDNP 123

Query: 118 ---------------YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 124 FPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK---PYENVML-----QRIADAHQKT 214
           VE HPY AQ   +   +   ++  A++PLG        P E V+L     Q +A+ + ++
Sbjct: 184 VECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS 243

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL+
Sbjct: 244 PAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALN 292


>3cv6A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
          Length = 323

 Score =  152 bits (385), Expect = 9e-40
 Identities = 97/310 (31%), Positives = 161/310 (51%), Gaps = 37/310 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 9   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 68

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 69  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 127

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 128 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 187

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADA 210
            NQVE HPY  Q   L+  K  ++   A+  LG  R+ P+         +  +L  +A  
Sbjct: 188 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYPPWVDQNSPVLLDEPVLGSMAKK 247

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVG 268
           + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+ 
Sbjct: 248 YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIP 307

Query: 269 EAVKHFNPEF 278
            A+   +P +
Sbjct: 308 AAIFKGHPNW 317


>1q13B [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
          Length = 317

 Score =  151 bits (381), Expect = 3e-39
 Identities = 97/290 (33%), Positives = 148/290 (51%), Gaps = 30/290 (10%)

Query: 6   LSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAI 63
           LS+   +P++GFG +   +  K +  ++   AI +G+R ID+A  Y NE  VG A+R  I
Sbjct: 9   LSDGHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKI 68

Query: 64  ATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------- 116
           A G   RE++F TSKLW       +L +  +E SLK   LDY DLY++H           
Sbjct: 69  ADGTVKREDIFYTSKLWCT-FHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALKPGVEI 127

Query: 117 --------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMV 160
                         D  + W A+E   +AG  K+IGVSNF    L        ++  P+ 
Sbjct: 128 IPTDEHGKAIFDTVDICATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVC 187

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKP----YENVMLQRIADAHQKTIA 216
           NQVE HPY  Q   LE  K   +   A++ LG  R        E+ ++  +A  HQ+T A
Sbjct: 188 NQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPSAPVLLEDPLIGALAKKHQQTPA 247

Query: 217 QVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
            + LR+ +QRG+ V+ KS  ++RI+EN  +++F L   +M  I++L+  +
Sbjct: 248 LIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNF 297


>1q5mA [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
          Length = 322

 Score =  150 bits (379), Expect = 4e-39
 Identities = 97/295 (32%), Positives = 149/295 (50%), Gaps = 35/295 (11%)

Query: 6   LSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAI 63
           LS+   +P++GFG +   +  K +  ++   AI +G+R ID+A  Y NE  VG A+R  I
Sbjct: 9   LSDGHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKI 68

Query: 64  ATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------- 116
           A G   RE++F TSKLW       +L +  +E SLK   LDY DLY++H           
Sbjct: 69  ADGTVKREDIFYTSKLWCT-FHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALKPGVEI 127

Query: 117 --------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMV 160
                         D  + W A+E   +AG  K+IGVSNF    L        ++  P+ 
Sbjct: 128 IPTDEHGKAIFDTVDICATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVC 187

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAH 211
           NQVE HPY  Q   LE  K   +   A++ LG  R   +         E+ ++  +A  H
Sbjct: 188 NQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWVDQSAPVLLEDPLIGALAKKH 247

Query: 212 QKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           Q+T A + LR+ +QRG+ V+ KS  ++RI+EN  +++F L   +M  I++L+  +
Sbjct: 248 QQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNF 302


>2he5C [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
          Length = 314

 Score =  150 bits (379), Expect = 4e-39
 Identities = 97/306 (31%), Positives = 161/306 (52%), Gaps = 33/306 (10%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 4   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 63

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 64  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 122

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 123 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 182

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGG---RHKP--YENVMLQRIADAHQKT 214
            NQVE HPY  Q   L+  K  ++   A+  LG G   ++ P   +  +L  +A  + +T
Sbjct: 183 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGWVDQNSPVLLDEPVLGSMAKKYNRT 242

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVGEAVK 272
            A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+  A+ 
Sbjct: 243 PALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIF 302

Query: 273 HFNPEF 278
             +P +
Sbjct: 303 KGHPNW 308


>2he8A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
          Length = 316

 Score =  150 bits (378), Expect = 6e-39
 Identities = 97/307 (31%), Positives = 161/307 (52%), Gaps = 34/307 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 5   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 64

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 65  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 123

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 124 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 183

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGG----RHKP--YENVMLQRIADAHQK 213
            NQVE HPY  Q   L+  K  ++   A+  LG G    ++ P   +  +L  +A  + +
Sbjct: 184 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGGWVDQNSPVLLDEPVLGSMAKKYNR 243

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVGEAV 271
           T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+  A+
Sbjct: 244 TPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAI 303

Query: 272 KHFNPEF 278
              +P +
Sbjct: 304 FKGHPNW 310


>2p5nA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
          Length = 323

 Score =  149 bits (375), Expect = 1e-38
 Identities = 96/310 (30%), Positives = 160/310 (51%), Gaps = 37/310 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 9   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 68

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 69  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 127

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 128 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 187

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADA 210
            NQVE HPY  Q   L+  K  ++   A+  LG  R+  +         +  +L  +A  
Sbjct: 188 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKK 247

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVG 268
           + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+ 
Sbjct: 248 YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIP 307

Query: 269 EAVKHFNPEF 278
            A+   +P +
Sbjct: 308 AAIFKGHPNW 317


>2hejA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
          Length = 318

 Score =  149 bits (375), Expect = 1e-38
 Identities = 96/310 (30%), Positives = 160/310 (51%), Gaps = 37/310 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 4   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 63

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 64  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 122

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 123 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 182

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADA 210
            NQVE HPY  Q   L+  K  ++   A+  LG  R+  +         +  +L  +A  
Sbjct: 183 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKK 242

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVG 268
           + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+ 
Sbjct: 243 YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIP 302

Query: 269 EAVKHFNPEF 278
            A+   +P +
Sbjct: 303 AAIFKGHPNW 312


>2he8B [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
          Length = 319

 Score =  149 bits (375), Expect = 1e-38
 Identities = 96/310 (30%), Positives = 160/310 (51%), Gaps = 37/310 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTD--KEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +  K + ++    AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 5   ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 64

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 65  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 123

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 124 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 183

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADA 210
            NQVE HPY  Q   L+  K  ++   A+  LG  R+  +         +  +L  +A  
Sbjct: 184 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKK 243

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVG 268
           + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+ 
Sbjct: 244 YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIP 303

Query: 269 EAVKHFNPEF 278
            A+   +P +
Sbjct: 304 AAIFKGHPNW 313


>2ipgA [x.x.x] 3(17)ALPHA-HYDROXYSTEROID DEHYDROGENASE
          Length = 319

 Score =  146 bits (369), Expect = 6e-38
 Identities = 96/310 (30%), Positives = 159/310 (51%), Gaps = 37/310 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLS--AIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           IL++   +P++GFG     +    +   L+  AI +G+   D+A+VY  ED VG+A+R  
Sbjct: 5   ILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSK 64

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M       
Sbjct: 65  IADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE 123

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
                          D  + W A+E   +AG  K+IGVSNF    L        ++  P+
Sbjct: 124 NFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPV 183

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADA 210
            NQVE HPY  Q   L+  K  ++   A+  LG  R+  +         +  +L  +A  
Sbjct: 184 CNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKK 243

Query: 211 HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL--DLGYVG 268
           + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L  ++ Y+ 
Sbjct: 244 YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIP 303

Query: 269 EAVKHFNPEF 278
            A+   +P +
Sbjct: 304 AAIFKGHPNW 313


>2bgsA [x.x.x] ALDOSE REDUCTASE
          Length = 308

 Score =  145 bits (365), Expect = 2e-37
 Identities = 84/272 (30%), Positives = 145/272 (53%), Gaps = 22/272 (8%)

Query: 2   EYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAI-RSGYRLIDTAAVYGNEDAVGDAVR 60
           ++ +L +   MP VG G ++     +   SV +AI  +GYR +DTAA YG E  VG  ++
Sbjct: 2   DHFVLKSGHAMPAVGLGTWRAGS--DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLK 59

Query: 61  KAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG---- 116
            A+  G+  R++LF+TSK+W  ++A  +  +  +E +LK   LDY DLY +H        
Sbjct: 60  AAMEAGI-DRKDLFVTSKIWCTNLAP-ERVRPALENTLKDLQLDYIDLYHIHWPFRLKDG 117

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV 163
                        D    W+ +E+  + G +K IGV N+    L     + +I P V Q+
Sbjct: 118 AHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQM 177

Query: 164 ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWN 223
           E+HP +      E  K + +   A++PLG        + +++++A+   KT  QV+++W 
Sbjct: 178 EMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWA 237

Query: 224 VQRGVTVIPKSTRQERIEENFAIWDFSLTDNE 255
           +QRG +VIPKS++ ERI+EN  ++ + + + +
Sbjct: 238 LQRGTSVIPKSSKDERIKENIQVFGWEIPEED 269


>1frbA [x.x.x] FR-1 PROTEIN
          Length = 315

 Score =  144 bits (362), Expect = 4e-37
 Identities = 94/285 (32%), Positives = 139/285 (48%), Gaps = 33/285 (11%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS   KMP+VG G +K +   + +++V +AI +GYR ID A  Y NE+ VG+A+++ I  
Sbjct: 6   LSTKAKMPIVGLGTWK-SPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKE 64

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------- 116
               RE+LFI SKLW        L K   +               +H   G         
Sbjct: 65  KAVQREDLFIVSKLWPTCFEK-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGLQPGKELFP 123

Query: 117 ------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQ 162
                        +  AW  +E+  + G +KA+GVSNF    +        ++  P+ NQ
Sbjct: 124 KDDQGRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQKT 214
           VE HPY  Q   ++      +   A++PLG       KP      E+  ++ IA  H+KT
Sbjct: 184 VECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKT 243

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
            AQV++R+++QR V VIPKS    RI+EN  ++DF L+D EMA I
Sbjct: 244 SAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI 288


>1c9wA [c.1.7] CHO REDUCTASE
          Length = 315

 Score =  142 bits (357), Expect = 2e-36
 Identities = 95/285 (33%), Positives = 137/285 (48%), Gaps = 33/285 (11%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
           LS   KMP+VG G ++ +   + +++V  AI +GYR ID A  Y NE  VG+A+++ I  
Sbjct: 6   LSTKAKMPIVGLGTWQ-SPPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQEKIKE 64

Query: 66  GLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--------- 116
               RE+LFI SKLW        L K   +               +H   G         
Sbjct: 65  KAVRREDLFIVSKLWPTCFER-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGLQPGKELFP 123

Query: 117 ------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQ 162
                        +  AW  +E+  + G +KA+GVSNF    +        ++  P+ NQ
Sbjct: 124 KDDQGNVLTSKITFLDAWEVMEELVDEGLVKALGVSNFNHFQIERILNKPGLKHKPVTNQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQKT 214
           VE HPY  Q   +E      +   A++PLG       KP      E+  ++ IA  H+KT
Sbjct: 184 VECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRPWAKPEDPSLLEDPKIKEIAAKHKKT 243

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
            AQV++R+++QR V VIPKS    RI ENF ++DF L+D EMA I
Sbjct: 244 SAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATI 288


>2ipwA [x.x.x] ALDOSE REDUCTASE
          Length = 309

 Score =  141 bits (356), Expect = 2e-36
 Identities = 94/283 (33%), Positives = 145/283 (51%), Gaps = 32/283 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLK------------------KSGLDYF 106
             +  REELFI SKLW        L K   + +                    K G ++F
Sbjct: 63  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 121

Query: 107 DLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMVNQV 163
            L  +  +  +    W A+E+  + G +KAIG+SNF  H+          ++  P VNQ+
Sbjct: 122 PLDNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAVNQI 180

Query: 164 ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY-------ENVMLQRIADAHQKTIA 216
           E HPY  Q   ++  +   +   A++PLG    +PY       E+  ++ IA  H KT A
Sbjct: 181 ECHPYLTQEKLIQYCQSKGIVVTAYSPLGSP-DRPYAEDPSLLEDPRIKAIAAKHNKTTA 239

Query: 217 QVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           QV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 240 QVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 282


>2alrA [x.x.x] ALDEHYDE REDUCTASE
          Length = 312

 Score =  141 bits (356), Expect = 2e-36
 Identities = 91/281 (32%), Positives = 142/281 (50%), Gaps = 28/281 (9%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K ++  + + +V  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 6   LLHTGQKMPLIGLGTWK-SEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVG 64

Query: 65  TGLCT-REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GD-- 117
            G    REELF+TSKLW       D+  A +  +L    L+Y DLYL+H       GD  
Sbjct: 65  PGKAVPREELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYAFERGDNP 123

Query: 118 ---------------YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 124 FPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRW 222
           VE HPY AQ   +   +   ++  A++                +    + ++ AQ++LRW
Sbjct: 184 VECHPYLAQNELIAHCQARGLEVTAYSXXXXXXXXXXXXXXXXK----YGRSPAQILLRW 239

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            VQR V  IPKS    RI +N  ++DF+ +  EM Q+NAL+
Sbjct: 240 QVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN 280


>2bgqA [x.x.x] ALDOSE REDUCTASE
          Length = 305

 Score =  140 bits (352), Expect = 6e-36
 Identities = 86/273 (31%), Positives = 145/273 (53%), Gaps = 31/273 (11%)

Query: 2   EYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAI-RSGYRLIDTAAVYGNEDAVGDAVR 60
           ++ +L +   MP VG G +      +   SV +AI  +GYR +DTAA YG E  VG  ++
Sbjct: 6   DHFVLKSGHAMPAVGLGTW------DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLK 59

Query: 61  KAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG---- 116
            A+  G+  R++LF+TSK+W  ++A  +  +  +E +LK   LDY DLY +H        
Sbjct: 60  AAMEAGI-DRKDLFVTSKIWCTNLAP-ERVRPALENTLKDLQLDYIDLYHIHWPFRLKDG 117

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV 163
                        D    W+ +E+  + G +K IGV N+    L     + +I P V Q+
Sbjct: 118 AHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQM 177

Query: 164 ELHPYFAQPAALETMKHYNVQPEAWAPLGGG-RHKPYENVMLQRIADAHQKTIAQVVLRW 222
           E+HP +      E  K + +   A++PLG    H P    +++++A+   KT  QV+++W
Sbjct: 178 EMHPGWKNDKIFEACKKHGIHITAYSPLGKNLAHDP----VVEKVANKLNKTPGQVLIKW 233

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNE 255
            +QRG +VIPKS++ ERI+EN  ++ + + + +
Sbjct: 234 ALQRGTSVIPKSSKDERIKENIQVFGWEIPEED 266


>1az1A [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  136 bits (343), Expect = 7e-35
 Identities = 92/288 (31%), Positives = 140/288 (48%), Gaps = 37/288 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 63  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 121

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 180

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAH 211
           NQ+E HPY  Q   ++  +   +   A++PLG    +PY         E+  ++ IA  H
Sbjct: 181 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSP-DRPYAKPEDPSLLEDPRIKAIAAKH 239

Query: 212 QKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
            KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 240 NKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 287


>1ah3A [c.1.7 (1ekoA)] ALDOSE REDUCTASE
          Length = 314

 Score =  135 bits (341), Expect = 1e-34
 Identities = 92/283 (32%), Positives = 138/283 (48%), Gaps = 33/283 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG  +++ + 
Sbjct: 4   VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQ 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  RE+LFI SKLW  D    +L K   + +             +H   G        
Sbjct: 63  GQVVKREDLFIVSKLWCTDHEK-NLVKGACQTTXXXXXXXXXXXXXIHWPTGFKPGKDPF 121

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVN 161
                        D+   W A+E+  + G +KAIGVSNF    +        ++  P VN
Sbjct: 122 PLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVN 181

Query: 162 QVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQK 213
           Q+E+HPY  Q   +E  K   +   A++PLG       KP      E+  ++ IA  + K
Sbjct: 182 QIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNK 241

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEM 256
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M
Sbjct: 242 TTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDM 284


>1ah0A [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (341), Expect = 1e-34
 Identities = 92/283 (32%), Positives = 138/283 (48%), Gaps = 33/283 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG  +++ + 
Sbjct: 5   VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQ 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  RE+LFI SKLW  D    +L K   + +             +H   G        
Sbjct: 64  GQVVKREDLFIVSKLWCTDHEK-NLVKGACQTTXXXXXXXXXXXXXIHWPTGFKPGKDPF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVN 161
                        D+   W A+E+  + G +KAIGVSNF    +        ++  P VN
Sbjct: 123 PLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVN 182

Query: 162 QVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQK 213
           Q+E+HPY  Q   +E  K   +   A++PLG       KP      E+  ++ IA  + K
Sbjct: 183 QIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNK 242

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEM 256
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M
Sbjct: 243 TTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDM 285


>2i16A [x.x.x] ALDOSE REDUCTASE
          Length = 312

 Score =  135 bits (340), Expect = 1e-34
 Identities = 92/286 (32%), Positives = 139/286 (48%), Gaps = 34/286 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 6   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 65  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 123

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 182

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP----YENVMLQRIADAHQK 213
           NQ+E HPY  Q   ++  +   +   A++PLG       KP     E+  ++ IA  H K
Sbjct: 183 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPDPSLLEDPRIKAIAAKHNK 242

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 243 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>1z8aA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>1us0A [c.1.7] ALDOSE REDUCTASE
          Length = 313

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 6   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 65  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 123

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 182

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 183 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 242

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 243 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 289


>1pwmA [c.1.7] ALDOSE REDUCTASE
          Length = 316

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 6   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 65  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 123

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 182

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 183 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 242

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 243 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 289


>2pdyA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdxA [x.x.x] ALDOSE REDUCTASE
          Length = 312

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdqA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdmA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdkA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdiA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdhA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2pdfA [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 63  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 121

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 180

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 181 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 240

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 241 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 287


>2pdbA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEPF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2is7A [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESNGVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHD 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2ikiA [x.x.x] ALDOSE REDUCTASE
          Length = 311

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>1el3A [c.1.7] ALDOSE REDUCTASE
          Length = 316

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 6   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 65  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 123

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 182

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 183 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 242

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 243 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 289


>2dv0A [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 63  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 121

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 180

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 181 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 240

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 241 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 287


>2agtA [x.x.x] ALDOSE REDUCTASE
          Length = 316

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 6   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 65  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 123

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 182

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 183 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 242

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 243 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 289


>1adsA [c.1.7 (1ef3A)] ALDOSE REDUCTASE
          Length = 315

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>2acsA [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  135 bits (339), Expect = 2e-34
 Identities = 92/287 (32%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 63  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 121

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 180

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 181 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 240

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 241 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 287


>2pd5A [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  134 bits (338), Expect = 3e-34
 Identities = 91/287 (31%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A +Y NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHIYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>1afsA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
          Length = 319

 Score =  134 bits (338), Expect = 3e-34
 Identities = 93/298 (31%), Positives = 149/298 (50%), Gaps = 35/298 (11%)

Query: 12  MPMVGFG--VFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           +P++GFG  V +   K+E  ++   AI +G+R  D+A +Y  E+ VG A+R  I  G   
Sbjct: 16  IPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GDYF------ 119
           RE++F TSKLW       +L +  +E +LK + LDY DLY++H  M    GD F      
Sbjct: 76  REDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEH 134

Query: 120 -----------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                        W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 135 GKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECH 194

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
            Y  Q   L+  K  ++   ++  LG  R K +         ++ +L  IA  +++T A 
Sbjct: 195 LYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPAL 254

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFN 275
           V LR+ +QRGV  + +S   +RI+E   +++F L   +M  ++ L+  +     K+F+
Sbjct: 255 VALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFD 312


>2acuA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  133 bits (334), Expect = 7e-34
 Identities = 91/287 (31%), Positives = 139/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A V+ NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL 288


>1xgdA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  132 bits (333), Expect = 1e-33
 Identities = 91/287 (31%), Positives = 138/287 (48%), Gaps = 35/287 (12%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K +   +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +             +H   G        
Sbjct: 64  EQVVKREELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET---VRITPMV 160
                        +    W A+E+  + G +KAIG+SNF  H+          ++  P V
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFN-HLQVEMILNKPGLKYKPAV 181

Query: 161 NQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH---KP-----YENVMLQRIADAHQ 212
           NQ+E HPY  Q   ++  +   +   A++PLG       KP      E+  ++ IA  H 
Sbjct: 182 NQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHN 241

Query: 213 KTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQI 259
           KT AQV++R+ +QR + VIPKS   E I ENF ++DF L+  +M  +
Sbjct: 242 KTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTL 288


>1ralA [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
          Length = 308

 Score =  132 bits (332), Expect = 1e-33
 Identities = 91/289 (31%), Positives = 145/289 (50%), Gaps = 35/289 (12%)

Query: 12  MPMVGFG--VFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           +P++GFG  V +   K+E  ++   AI +G+R  D+A +Y  E+ VG A+R  I  G   
Sbjct: 16  IPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVK 75

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GDYF------ 119
           RE++F TSKLW       +L +  +E +LK + LDY DLY++H  M    GD F      
Sbjct: 76  REDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEH 134

Query: 120 -----------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELH 166
                        W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H
Sbjct: 135 GKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECH 194

Query: 167 PYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQRIADAHQKTIAQ 217
            Y  Q   L+  K  ++   ++  LG  R K +         ++ +L  IA  +++T A 
Sbjct: 195 LYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPAL 254

Query: 218 VVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           V LR+ +QRGV  + +S   +RI+E   +++F L   +M  ++ L+  +
Sbjct: 255 VALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNF 303


>1lwiA [c.1.7] 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
          Length = 305

 Score =  130 bits (328), Expect = 4e-33
 Identities = 92/292 (31%), Positives = 146/292 (50%), Gaps = 31/292 (10%)

Query: 12  MPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTRE 71
           +P++GFG   V  K+E  ++   AI +G+R  D+A +Y  E+ VG A+R  I  G   RE
Sbjct: 16  IPVLGFGT-TVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKRE 74

Query: 72  ELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM----GDYF-------- 119
           ++F TSKLW       +L +  +E +LK + LDY DLY++H  M    GD F        
Sbjct: 75  DIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGK 133

Query: 120 ---------SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPMVNQVELHPY 168
                      W A+E   +AG  K+IGVSNF    L        ++  P+ NQVE H Y
Sbjct: 134 LLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLY 193

Query: 169 FAQPAALETMKHYNVQPEAWAPLGG----GRHKP--YENVMLQRIADAHQKTIAQVVLRW 222
             Q   L+  K  ++   ++  LG      +  P   ++ +L  IA  +++T A V LR+
Sbjct: 194 LNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRY 253

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHF 274
            +QRGV  + +S   +RI+E   +++F L   +M  ++ L+  +     K+F
Sbjct: 254 QLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF 305


>1pyfA [c.1.7] IOLS PROTEIN
          Length = 309

 Score = 62.0 bits (149), Expect = 2e-12
 Identities = 70/290 (24%), Positives = 123/290 (42%), Gaps = 51/290 (17%)

Query: 16  GFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAVRKAIATGLCTREE 72
           G  ++   ++E  ++ V  AIR+G  L DTA +YG   +E+ +G+ +R+        RE+
Sbjct: 24  GHNLYPNLNEETGKELVREAIRNGVTL-DTAYIYGIGRSEELIGEVLREF------NRED 76

Query: 73  LFITSKLWVQDMANY-------DLAKAGIEASLKKSGLDYFDLYLLH--QAMGDYFSAWR 123
           + I +K   +   N        D  K  ++ SLK+   DY DL+ +H          A  
Sbjct: 77  VVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVN 136

Query: 124 ALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNV 183
           AL +  +AGK+++IGVSNF    L    +   +  +  +  L    A+       K +N+
Sbjct: 137 ALNEK-KAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNI 195

Query: 184 QPEAWAPLGGG-------------------------RHKPYENV----MLQRIADAHQKT 214
               + PL  G                           +  EN+     L  IA+ H   
Sbjct: 196 SFIPYFPLVSGLLAGKYTEDTTFPEGDLRNEQEHFKGERFKENIRKVNKLAPIAEKHNVD 255

Query: 215 IAQVVLRWNVQRGV--TVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL 262
           I  +VL W + R     +IP + R +++ +N    D +L+  +++ I+ L
Sbjct: 256 IPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTADVTLSQEDISFIDKL 305


>1og6C [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
          Length = 298

 Score = 56.6 bits (135), Expect = 9e-11
 Identities = 69/280 (24%), Positives = 111/280 (39%), Gaps = 35/280 (12%)

Query: 18  GVFKVTDKEECQQSVLSAIRS----GYRLIDTAAVYGN---EDAVGDAVRKAIATGLCTR 70
           G +++ D     + ++S I      G   +D A +YG    E A G+A++ A       R
Sbjct: 20  GYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLAPHL----R 75

Query: 71  EELFITSKLWVQDMA-----------NYDLAKAGIEASLKKSGLDYFDLYLLHQA--MGD 117
           E + I SK  +   A           + D      E SL     D+ DL L+H+   + D
Sbjct: 76  ERMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMD 135

Query: 118 YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVEL---HPYFAQPAA 174
                 A +  +++GK++  GVSNF     A     +  T   NQVE+   H        
Sbjct: 136 ADEVADAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVHXXXXXXXX 195

Query: 175 LETMKHYNVQPEAWAPLGGGR------HKPYENVMLQRIADAHQKTIAQVVLRWNVQRGV 228
                   V+P AW+ LGGGR       +P  + +     + +  +I QVV  W ++   
Sbjct: 196 XXXXXXXRVRPMAWSCLGGGRLFNDDYFQPLRDELAVVAEELNAGSIEQVVNAWVLRLPS 255

Query: 229 TVIP--KSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
             +P   S + ER+          +T  +  +I    LGY
Sbjct: 256 QPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY 295


>1og6A [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
          Length = 297

 Score = 56.6 bits (135), Expect = 9e-11
 Identities = 69/280 (24%), Positives = 111/280 (39%), Gaps = 35/280 (12%)

Query: 18  GVFKVTDKEECQQSVLSAIRS----GYRLIDTAAVYGN---EDAVGDAVRKAIATGLCTR 70
           G +++ D     + ++S I      G   +D A +YG    E A G+A++ A       R
Sbjct: 20  GYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLAPHL----R 75

Query: 71  EELFITSKLWVQDMA-----------NYDLAKAGIEASLKKSGLDYFDLYLLHQA--MGD 117
           E + I SK  +   A           + D      E SL     D+ DL L+H+   + D
Sbjct: 76  ERMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMD 135

Query: 118 YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVEL---HPYFAQPAA 174
                 A +  +++GK++  GVSNF     A     +  T   NQVE+   H        
Sbjct: 136 ADEVADAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVHXXXXXXXX 195

Query: 175 LETMKHYNVQPEAWAPLGGGR------HKPYENVMLQRIADAHQKTIAQVVLRWNVQRGV 228
                   V+P AW+ LGGGR       +P  + +     + +  +I QVV  W ++   
Sbjct: 196 XXXXXXXRVRPMAWSCLGGGRLFNDDYFQPLRDELAVVAEELNAGSIEQVVNAWVLRLPS 255

Query: 229 TVIP--KSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
             +P   S + ER+          +T  +  +I    LGY
Sbjct: 256 QPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY 295


>1ynqA [x.x.x] OXIDOREDUCTASE
          Length = 288

 Score = 53.9 bits (128), Expect = 6e-10
 Identities = 44/191 (23%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 7   SNNLKMPMVGFGVFKV-TDKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAVRKA 62
           +++L +  +GFG   + TD+ + ++ +   +  G   +DTA +Y    NE  VG A++  
Sbjct: 9   TSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGR 68

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD--YFS 120
                  R+++ + +K+W  D +   + +A ++ SL++   DY DLY LH    D     
Sbjct: 69  -------RQDIILATKVWWWDPSKAYIKEA-VKDSLRRLQTDYIDLYQLHGGTIDDPIDE 120

Query: 121 AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKH 180
              A E+  + G ++  G+S+   +V+  + +   I  ++ Q  +               
Sbjct: 121 TIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSI--------------- 165

Query: 181 YNVQPEAWAPL 191
            + +PE W PL
Sbjct: 166 LDRRPEEWFPL 176


>1pz1A [c.1.7] GENERAL STRESS PROTEIN 69
          Length = 325

 Score = 53.5 bits (127), Expect = 7e-10
 Identities = 40/130 (30%), Positives = 67/130 (51%), Gaps = 17/130 (13%)

Query: 24  DKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAVRKAIATGLCTREELFITSKL- 79
           D++   +++ +A+  G  LIDTA  YG   +E+ VG A+++        R+++ + +K  
Sbjct: 30  DEKTSIETIRAALDQGITLIDTAPAYGFGQSEEIVGKAIKEY------KRDQVILATKTA 83

Query: 80  --WVQDM----ANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDY-FSAWRALEDAYEAG 132
             W  +     AN       +E SLK+   DY DLY +H             +++ Y+AG
Sbjct: 84  LDWKNNQLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVPIEETAEVKELYDAG 143

Query: 133 KLKAIGVSNF 142
           K++AIGVSNF
Sbjct: 144 KIRAIGVSNF 153


>1ynpA [x.x.x] OXIDOREDUCTASE
          Length = 283

 Score = 47.0 bits (110), Expect = 7e-08
 Identities = 42/191 (21%), Positives = 84/191 (43%), Gaps = 34/191 (17%)

Query: 7   SNNLKMPMVGFGVFKV-TDKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAVRKA 62
           +++L +  +GFG   + TD+ + ++ +   +  G   +DTA +Y    NE  VG A++  
Sbjct: 9   TSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGR 68

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD--YFS 120
                  R+++ + +K+      +    K  ++ SL++   DY DLY LH    D     
Sbjct: 69  -------RQDIILATKV------SKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDE 115

Query: 121 AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKH 180
              A E+  + G ++  G+S+   +V+  + +   I  ++ Q  +               
Sbjct: 116 TIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSI--------------- 160

Query: 181 YNVQPEAWAPL 191
            + +PE W PL
Sbjct: 161 LDRRPEEWFPL 171


>3erpB [x.x.x] PUTATIVE OXIDOREDUCTASE
          Length = 306

 Score = 46.6 bits (109), Expect = 9e-08
 Identities = 60/262 (22%), Positives = 115/262 (43%), Gaps = 27/262 (10%)

Query: 8   NNLKMPMVGFGV---FKVTDKEECQQSVLS-AIRSGYRLIDTAAVYGNEDAVGDAVRKAI 63
           + +K+P +  G+   F  T + E  +++L  A   G    D A  YG      +     I
Sbjct: 20  SGVKLPAISLGLWHNFGDTTRVENSRALLQRAFDLGITHFDLANNYGPPPGSAECNFGRI 79

Query: 64  ATG--LCTREELFITSK----LWVQDMANYDLAK---AGIEASLKKSGLDYFDLYLLHQA 114
                L  R+EL I++K    +W     ++   K   A ++ SLK+ GL+Y D++  H+ 
Sbjct: 80  LQEDFLPWRDELIISTKAGYTMWDGPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRP 139

Query: 115 MGD--YFSAWRALEDAYEAGKLKAIGVSNF---YAHVLANFCETVRITPMVNQ--VELHP 167
             +       +AL+     GK   +G+SN+    A    +  E +    +++Q    L  
Sbjct: 140 DPETPLKETMKALDHLVRHGKALYVGISNYPADLARQAIDILEDLGTPCLIHQPKYSLFE 199

Query: 168 YFAQPAALETMKHYNVQPEAWAPLGGG----RHKPYENV-MLQRIADAHQKTIAQVVLRW 222
            + +   L  ++   V   A++PL GG    R+   E V  L  +A    + ++Q+ L W
Sbjct: 200 RWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRYDKLEKVRRLNELAARRGQKLSQMALAW 259

Query: 223 NVQRG--VTVIPKSTRQERIEE 242
            ++     +V+  +++  +IE+
Sbjct: 260 VLRNDNVTSVLIGASKPSQIED 281


>1ynpB [x.x.x] OXIDOREDUCTASE
          Length = 298

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 46/196 (23%), Positives = 83/196 (42%), Gaps = 29/196 (14%)

Query: 7   SNNLKMPMVGFGVFKV-TDKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAVRKA 62
           +++L +  +GFG   + TD+ + ++ +   +  G   +DTA +Y    NE  VG A++  
Sbjct: 9   TSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGR 68

Query: 63  -----IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
                +AT +  R E       W    A     K  ++ SL++   DY DLY LH    D
Sbjct: 69  RQDIILATKVGNRFEQGKEGWWWDPSKA---YIKEAVKDSLRRLQTDYIDLYQLHGGTID 125

Query: 118 --YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                   A E+  + G ++  G+S+   +V+  + +   I  ++ Q  +          
Sbjct: 126 DPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSI---------- 175

Query: 176 ETMKHYNVQPEAWAPL 191
                 + +PE W PL
Sbjct: 176 -----LDRRPEEWFPL 186


>1og6B [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
          Length = 294

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 64/276 (23%), Positives = 106/276 (38%), Gaps = 31/276 (11%)

Query: 18  GVFKVTDKEECQQSVLSAIRS----GYRLIDTAAVYGN---EDAVGDAVRKAIATGLCTR 70
           G +++ D     + ++S I      G   +D A +YG    E A G+A++ A       R
Sbjct: 20  GYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLAPHL----R 75

Query: 71  EELFITSKLWVQDMA-----------NYDLAKAGIEASLKKSGLDYFDLYLLHQA--MGD 117
           E + I SK  +   A           + D      E SL     D+ DL L+H+   + D
Sbjct: 76  ERMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMD 135

Query: 118 YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVEL---HPYFAQPAA 174
                 A +  +++GK++  GVSNF     A     +  T   NQVE+   H        
Sbjct: 136 ADEVADAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVHXXXXXXXX 195

Query: 175 LETMKHYNVQPEAWA--PLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIP 232
                   V+P AW+         +P  + +     + +  +I QVV  W ++     +P
Sbjct: 196 XXXXXXXRVRPMAWSCRLFNDDYFQPLRDELAVVAEELNAGSIEQVVNAWVLRLPSQPLP 255

Query: 233 --KSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
              S + ER+          +T  +  +I    LGY
Sbjct: 256 IIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY 291


>1ur3M [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
          Length = 290

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 57/208 (27%), Positives = 84/208 (40%), Gaps = 30/208 (14%)

Query: 39  GYRLIDTAAVYGN---EDAVGDAVRKAIATGLCTREELFITSKLWVQDMA---------- 85
           G   +D A +YG    E A G+A++  +A  L  RE   I SK  +   A          
Sbjct: 42  GVTTVDHADIYGGYQCEAAFGEALK--LAPHLRERE---IVSKCGIATTAREENVIGHYI 96

Query: 86  -NYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-DYFSAWRALEDAYEAGKLKAIGVSNFY 143
            + D      E SL     D+ DL L+H+    D      A +  +++GK++  GVSNF 
Sbjct: 97  TDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLDADEVADAFKHLHQSGKVRHFGVSNFT 156

Query: 144 AHVLANFCETVRITPMVNQVEL---HPYFAQPAALETMKHYNVQPEAWAPLGGGR----- 195
               A     +  T   NQVE+   H                V+P AW+ LGGGR     
Sbjct: 157 PAQFALLQSRLPFTLATNQVEISPVHXXXXXXXXXXXXXXXRVRP-AWSCLGGGRLFNDD 215

Query: 196 -HKPYENVMLQRIADAHQKTIAQVVLRW 222
             +P  + +     + +  +I QVV  W
Sbjct: 216 YFQPLRDELAVVAEELNAGSIEQVVNAW 243


>3erpA [x.x.x] PUTATIVE OXIDOREDUCTASE
          Length = 312

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 59/267 (22%), Positives = 115/267 (43%), Gaps = 32/267 (11%)

Query: 8   NNLKMPMVGFGV---FKVTDKEECQQSVLS-AIRSGYRLIDTAAVYGNEDAVGDAVRKAI 63
           + +K+P +  G+   F  T + E  +++L  A   G    D A  YG      +     I
Sbjct: 20  SGVKLPAISLGLWHNFGDTTRVENSRALLQRAFDLGITHFDLANNYGPPPGSAECNFGRI 79

Query: 64  ATG--LCTREELFITSK----LWVQDMANYDLAK---AGIEASLKKSGLDYFDLYLLHQA 114
                L  R+EL I++K    +W     ++   K   A ++ SLK+ GL+Y D++  H+ 
Sbjct: 80  LQEDFLPWRDELIISTKAGYTMWDGPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRP 139

Query: 115 MGD--YFSAWRALEDAYEAGKLKAIGVSNF---YAHVLANFCETVRITPMVNQ--VELHP 167
             +       +AL+     GK   +G+SN+    A    +  E +    +++Q    L  
Sbjct: 140 DPETPLKETMKALDHLVRHGKALYVGISNYPADLARQAIDILEDLGTPCLIHQPKYSLFE 199

Query: 168 YFAQPAALETMKHYNVQPEAWAPLGGGR-HKPYENV---------MLQRIADAHQKTIAQ 217
            + +   L  ++   V   A++PL GG+    Y N+          L  +A    + ++Q
Sbjct: 200 RWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRYLNITADKLEKVRRLNELAARRGQKLSQ 259

Query: 218 VVLRWNVQRG--VTVIPKSTRQERIEE 242
           + L W ++     +V+  +++  +IE+
Sbjct: 260 MALAWVLRNDNVTSVLIGASKPSQIED 286


>2bp1B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 320

 Score = 41.6 bits (96), Expect = 3e-06
 Identities = 41/177 (23%), Positives = 75/177 (42%), Gaps = 20/177 (11%)

Query: 31  SVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTREELFITSKLWVQDMANYDLA 90
           +V + +  G+  +DTA +Y   D   + +          R ++   +  W       D  
Sbjct: 23  AVRAFLERGHTELDTAFMYS--DGQSETIXXXXXXXXXCRVKIATKANPWDGKSLKPDSV 80

Query: 91  KAGIEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAIGVSNFYAHV 146
           ++ +E SLK+      DL+ LH    D+ +       A +  ++ GK   +G+SN+ +  
Sbjct: 81  RSQLETSLKRLQCPQVDLFYLHAP--DHGTPVEETLHACQRLHQEGKFVELGLSNYASWE 138

Query: 147 LANFCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAWAPLGGG 194
           +A  C   +    I P V Q     Y A    +ET     ++H+ ++  A+ PL GG
Sbjct: 139 VAEICTLCKSNGWILPTVYQ---GMYNATTRQVETELFPCLRHFGLRFYAYNPLAGG 192


>2c91B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 324

 Score = 40.4 bits (93), Expect = 7e-06
 Identities = 43/183 (23%), Positives = 75/183 (40%), Gaps = 15/183 (8%)

Query: 24  DKEECQQSVLSAIRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWV 81
           D      SV + +  G+  +DTA +Y  G  + +            CT  ++   +  W 
Sbjct: 17  DASASAASVRAFLERGHSELDTAFMYCDGQSENIXXXXXXXXXXXDCT-VKIATKANPWE 75

Query: 82  QDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWR----ALEDAYEAGKLKAI 137
                 D  ++ +E SLK+      DL+ LH    D+ +       A    ++ GK   +
Sbjct: 76  GKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAP--DHSTPVEETLCACHQLHQEGKFVEL 133

Query: 138 GVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAA--LETMKHYNVQPEAWAPL 191
           G+SN+ +  +A  C   +    I P V Q   +    Q  A  L  ++H+ ++  A+ PL
Sbjct: 134 GLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPL 193

Query: 192 GGG 194
            GG
Sbjct: 194 AGG 196


>2c91A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 325

 Score = 40.4 bits (93), Expect = 7e-06
 Identities = 43/183 (23%), Positives = 75/183 (40%), Gaps = 15/183 (8%)

Query: 24  DKEECQQSVLSAIRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWV 81
           D      SV + +  G+  +DTA +Y  G  + +            CT  ++   +  W 
Sbjct: 18  DASASAASVRAFLERGHSELDTAFMYCDGQSENIXXXXXXXXXXXDCT-VKIATKANPWE 76

Query: 82  QDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWR----ALEDAYEAGKLKAI 137
                 D  ++ +E SLK+      DL+ LH    D+ +       A    ++ GK   +
Sbjct: 77  GKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAP--DHSTPVEETLCACHQLHQEGKFVEL 134

Query: 138 GVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAA--LETMKHYNVQPEAWAPL 191
           G+SN+ +  +A  C   +    I P V Q   +    Q  A  L  ++H+ ++  A+ PL
Sbjct: 135 GLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPL 194

Query: 192 GGG 194
            GG
Sbjct: 195 AGG 197


>2bp1A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 323

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 42/179 (23%), Positives = 76/179 (42%), Gaps = 21/179 (11%)

Query: 31  SVLSAIRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWVQDMANYD 88
           +V + +  G+  +DTA +Y  G  + +            C R ++   +  W       D
Sbjct: 23  AVRAFLERGHTELDTAFMYSDGQSETIXXXXXXXXXXXDC-RVKIATKANPWDGKSLKPD 81

Query: 89  LAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAIGVSNFYA 144
             ++ +E SLK+      DL+ LH    D+ +       A +  ++ GK   +G+SN+ +
Sbjct: 82  SVRSQLETSLKRLQCPQVDLFYLHAP--DHGTPVEETLHACQRLHQEGKFVELGLSNYAS 139

Query: 145 HVLANFCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAWAPLGGG 194
             +A  C   +    I P V Q     Y A    +ET     ++H+ ++  A+ PL GG
Sbjct: 140 WEVAEICTLCKSNGWILPTVYQ---GMYNATTRQVETELFPCLRHFGLRFYAYNPLAGG 195


>2clpI [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
          Length = 322

 Score = 38.1 bits (87), Expect = 3e-05
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 21/174 (12%)

Query: 36  IRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWVQDMANYDLAKAG 93
           +  G+  IDTA VY  G  + +            C R ++   +     +    D  +  
Sbjct: 27  LERGHTEIDTAFVYSEGQSETIXXXXXXXXXXSDC-RVKIDTKAIPLFGNSLKPDSLRFQ 85

Query: 94  IEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAIGVSNFYAHVLAN 149
           +E SLK+      DL+ LH  M D+ +      RA    ++ GK   +G+SN+ A  +A 
Sbjct: 86  LETSLKRLQCPRVDLFYLH--MPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAE 143

Query: 150 FCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAWAPLGGG 194
            C   +    I P V Q     Y A    +ET     ++H+ ++  A+ PL GG
Sbjct: 144 ICTLCKSNGWILPTVYQ---GMYNAITRQVETELFPCLRHFGLRFYAFNPLAGG 194


>2clpA [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
          Length = 323

 Score = 38.1 bits (87), Expect = 3e-05
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 21/174 (12%)

Query: 36  IRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWVQDMANYDLAKAG 93
           +  G+  IDTA VY  G  + +            C R ++   +     +    D  +  
Sbjct: 28  LERGHTEIDTAFVYSEGQSETIXXXXXXXXXXSDC-RVKIDTKAIPLFGNSLKPDSLRFQ 86

Query: 94  IEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAIGVSNFYAHVLAN 149
           +E SLK+      DL+ LH  M D+ +      RA    ++ GK   +G+SN+ A  +A 
Sbjct: 87  LETSLKRLQCPRVDLFYLH--MPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAE 144

Query: 150 FCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAWAPLGGG 194
            C   +    I P V Q     Y A    +ET     ++H+ ++  A+ PL GG
Sbjct: 145 ICTLCKSNGWILPTVYQ---GMYNAITRQVETELFPCLRHFGLRFYAFNPLAGG 195


>1gveA [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
          Length = 324

 Score = 37.7 bits (86), Expect = 4e-05
 Identities = 44/186 (23%), Positives = 80/186 (43%), Gaps = 21/186 (11%)

Query: 24  DKEECQQSVLSAIRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWV 81
           D     +SV + ++ G+  IDTA VY  G  + +            C  +     + ++ 
Sbjct: 17  DVTSSSRSVRAFLQRGHTEIDTAFVYANGQSETIXXXXXXXXXRSGCKVKIATKAAPMFG 76

Query: 82  QDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAI 137
           + +   D+ +  +E SLK+      DL+ LH    D+ +      +A    ++ GK   +
Sbjct: 77  KTLKPADV-RFQLETSLKRLQCPRVDLFYLH--FPDHGTPIEETLQACHQLHQEGKFVEL 133

Query: 138 GVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAW 188
           G+SN+ +  +A  C   +    I P V Q     Y A    +ET     ++H+ ++  A+
Sbjct: 134 GLSNYVSWEVAEICTLCKKNGWIMPTVYQ---GMYNAITRQVETELFPCLRHFGLRFYAF 190

Query: 189 APLGGG 194
            PL GG
Sbjct: 191 NPLAGG 196


>1gveB [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
          Length = 301

 Score = 37.0 bits (84), Expect = 7e-05
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 21/186 (11%)

Query: 24  DKEECQQSVLSAIRSGYRLIDTAAVY--GNEDAVGDAVRKAIATGLCTREELFITSKLWV 81
           D      SV + ++ G+  IDTA VY  G  + +            C  +     + ++ 
Sbjct: 17  DVTSSSASVRAFLQRGHTEIDTAFVYANGQSETIXXXXXXXXXRSGCKVKIATKAAPMFG 76

Query: 82  QDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS----AWRALEDAYEAGKLKAI 137
           + +   D+ +  +E SLK+      DL+ LH    D+ +      +A    ++ GK   +
Sbjct: 77  KTLKPADV-RFQLETSLKRLQCPRVDLFYLH--FPDHGTPIEETLQACHQLHQEGKFVEL 133

Query: 138 GVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAALET-----MKHYNVQPEAW 188
           G+SN+ +  +A  C   +    I P V Q     Y A    +ET     ++H+ ++  A+
Sbjct: 134 GLSNYVSWEVAEICTLCKKNGWIMPTVYQ---GMYNAITRQVETELFPCLRHFGLRFYAF 190

Query: 189 APLGGG 194
            PL GG
Sbjct: 191 NPLAGG 196


>1lqaA [c.1.7] TAS PROTEIN
          Length = 346

 Score = 34.3 bits (77), Expect = 5e-04
 Identities = 59/242 (24%), Positives = 93/242 (38%), Gaps = 56/242 (23%)

Query: 3   YSILSNNLKMPMVGFGVFKVTDKE---ECQQSVLSAIRSGYRLIDTAAVYG--------- 50
           + I  ++L++  +G G     ++    +    +  A+  G  LID A +Y          
Sbjct: 4   HRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQG 63

Query: 51  -NEDAVGDAVRKAIATGLCTREELFITSKLWVQDMANY-----DLA------KAGIEASL 98
             E  VG+ + K       +RE+L I SK+      N      D A      +  +  SL
Sbjct: 64  LTETYVGNWLAKH-----GSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSL 118

Query: 99  KKSGLDYFDLYLLH------QAMGDYFSAWR-------------ALEDAYEAGKLKAIGV 139
           K+   DY DLY +H         G    +W              AL +   AGK++ IGV
Sbjct: 119 KRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGV 178

Query: 140 SN-------FYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLG 192
           SN        Y H LA+  +  RI  + N   L     +    E  ++  V+  A++ LG
Sbjct: 179 SNETAFGVMRYLH-LADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLG 237

Query: 193 GG 194
            G
Sbjct: 238 FG 239


>1zsxA [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL BETA-2 SUBUNIT
          Length = 323

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 47/210 (22%), Positives = 84/210 (40%), Gaps = 28/210 (13%)

Query: 8   NNLKMPMVGFGVF-----KVTDKEECQQSVLSAIRSGYRLIDTAAVYG---NEDAVGDAV 59
           + L++  +G G +     ++TD E  +Q +  A  +G  L DTA VY     E  +G+ +
Sbjct: 9   SGLRVSCLGLGTWVTFGGQITD-EMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNII 67

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKA------GIEASLKKSGLDYFDLYLLHQ 113
           +K        R  L IT+K++    A  +   +      G++ASL++  L+Y D+   ++
Sbjct: 68  KKK----GWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANR 123

Query: 114 AMGD--YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHP 167
              +       RA+      G     G S + +  +       R      P+  Q E H 
Sbjct: 124 PDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHM 183

Query: 168 YFAQPAAL---ETMKHYNVQPEAWAPLGGG 194
           +  +   +   E      V    W+PL  G
Sbjct: 184 FQREKVEVQLPELFHKIGVGAMTWSPLACG 213


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 804,400,296
Number of extensions: 32281563
Number of successful extensions: 79539
Number of sequences better than 1.0e-03: 2394
Number of HSP's gapped: 76910
Number of HSP's successfully gapped: 3036
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.9 bits)