BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF65897.1 sent8 ACF65897.1 GIB00763CH01 "conserved domain
protein"
         (73 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGDR_SHIFL RecName: Full=Uncharacterized lipoprotein ygdR;Flags:...    74   3e-16
YGDR_ECOLI RecName: Full=Uncharacterized lipoprotein ygdR;Flags:...    74   3e-16
YGDR_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:...    74   3e-16
YGDR_ECO57 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:...    74   3e-16
YGDI_ECOLI RecName: Full=Uncharacterized lipoprotein ygdI;Flags:...    71   3e-15
YGDI_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdI;Flags:...    71   3e-15

>YGDR_SHIFL RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
          Precursor;
          Length = 72

 Score = 74.3 bits (181), Expect = 3e-16
 Identities = 32/71 (45%), Positives = 52/71 (73%)

Query: 1  MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE 60
          MKK  +      + F ++GC+++YVM TK+G+ I+T GKP++D +TG+ SY DQ+GN  +
Sbjct: 1  MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQ 60

Query: 61 INSNDVAQLIK 71
          IN +DV+Q+I+
Sbjct: 61 INRDDVSQIIE 71


>YGDR_ECOLI RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
          Precursor;
          Length = 72

 Score = 74.3 bits (181), Expect = 3e-16
 Identities = 32/71 (45%), Positives = 52/71 (73%)

Query: 1  MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE 60
          MKK  +      + F ++GC+++YVM TK+G+ I+T GKP++D +TG+ SY DQ+GN  +
Sbjct: 1  MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQ 60

Query: 61 INSNDVAQLIK 71
          IN +DV+Q+I+
Sbjct: 61 INRDDVSQIIE 71


>YGDR_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
          Precursor;
          Length = 72

 Score = 74.3 bits (181), Expect = 3e-16
 Identities = 32/71 (45%), Positives = 52/71 (73%)

Query: 1  MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE 60
          MKK  +      + F ++GC+++YVM TK+G+ I+T GKP++D +TG+ SY DQ+GN  +
Sbjct: 1  MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQ 60

Query: 61 INSNDVAQLIK 71
          IN +DV+Q+I+
Sbjct: 61 INRDDVSQIIE 71


>YGDR_ECO57 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
          Precursor;
          Length = 72

 Score = 74.3 bits (181), Expect = 3e-16
 Identities = 32/71 (45%), Positives = 52/71 (73%)

Query: 1  MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE 60
          MKK  +      + F ++GC+++YVM TK+G+ I+T GKP++D +TG+ SY DQ+GN  +
Sbjct: 1  MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQ 60

Query: 61 INSNDVAQLIK 71
          IN +DV+Q+I+
Sbjct: 61 INRDDVSQIIE 71


>YGDI_ECOLI RecName: Full=Uncharacterized lipoprotein ygdI;Flags:
          Precursor;
          Length = 75

 Score = 70.9 bits (172), Expect = 3e-15
 Identities = 34/74 (45%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1  MKKLFICSGLGMMFFMLAGCT-TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQR 59
          MKK        M+ F L+ C+ +NYVM T +G+TIV+ GKPQ D +TGM SY D  GN++
Sbjct: 1  MKKTAAIISACMLTFALSACSGSNYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQ 60

Query: 60 EINSNDVAQLIKAD 73
          +IN  DV ++++ D
Sbjct: 61 QINRTDVKEMVELD 74


>YGDI_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdI;Flags:
          Precursor;
          Length = 75

 Score = 70.9 bits (172), Expect = 3e-15
 Identities = 34/74 (45%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1  MKKLFICSGLGMMFFMLAGCT-TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQR 59
          MKK        M+ F L+ C+ +NYVM T +G+TIV+ GKPQ D +TGM SY D  GN++
Sbjct: 1  MKKTAAIISACMLTFALSACSGSNYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQ 60

Query: 60 EINSNDVAQLIKAD 73
          +IN  DV ++++ D
Sbjct: 61 QINRTDVKEMVELD 74


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.337    0.147    0.479 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,146,232,051
Number of extensions: 413670349
Number of successful extensions: 972501
Number of sequences better than 1.0e-03: 12134
Number of HSP's gapped: 956225
Number of HSP's successfully gapped: 14101
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)