BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF65947.1 sent8 ACF65947.1 GIB00763CH01 "hydrogenase-1 operon
protein HyaF2"
         (353 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

HOXQ_RALEH RecName: Full=Hydrogenase expression/formation protei...   168   6e-44
HYAF_ECOLI RecName: Full=Hydrogenase-1 operon protein hyaF;           135   7e-34
HUPH_RHOCA RecName: Full=Hydrogenase expression/formation protei...   123   3e-30
HOXQ_AZOVI RecName: Full=Hydrogenase expression/formation protei...   121   1e-29
HUPQ_AZOCH RecName: Full=Hydrogenase expression/formation protei...   120   1e-29
HUPH_RHILV RecName: Full=Hydrogenase expression/formation protei...   108   9e-26
HUPH_BRAJA RecName: Full=Hydrogenase expression/formation protei...   101   9e-24
RUBR_AZOVI RecName: Full=Rubredoxin;         Short=Rd;                 79   6e-17
RUBL_RHILV RecName: Full=Probable rubredoxin hupI;                     79   8e-17
RUBR_RALEH RecName: Full=Rubredoxin;         Short=Rd;                 77   2e-16
RUBL_BRAJA RecName: Full=Probable rubredoxin hupI;                     77   3e-16
RUBR_AZOCH RecName: Full=Rubredoxin in uptake hydrogenase operon;      76   5e-16
HUPJ_RHOCA RecName: Full=Probable rubredoxin hupJ;                     67   2e-13
RUBR1_METJA RecName: Full=Probable rubredoxin 1;         Short=R...    66   5e-13
NORV_SALPA RecName: Full=Anaerobic nitric oxide reductase flavor...    63   4e-12
NORV_SALTI RecName: Full=Anaerobic nitric oxide reductase flavor...    62   8e-12
NORV_SALPB RecName: Full=Anaerobic nitric oxide reductase flavor...    62   8e-12
NORV_SALAR RecName: Full=Anaerobic nitric oxide reductase flavor...    62   8e-12
NORV_ENT38 RecName: Full=Anaerobic nitric oxide reductase flavor...    62   1e-11
NORV_SHISS RecName: Full=Anaerobic nitric oxide reductase flavor...    61   1e-11
NORV_ECOHS RecName: Full=Anaerobic nitric oxide reductase flavor...    61   1e-11
NORV_SALTY RecName: Full=Anaerobic nitric oxide reductase flavor...    61   2e-11
NORV_SHIFL RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_SHIF8 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_SHIDS RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_SHIBS RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOUT RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOSM RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOLI RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOLC RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOL6 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOL5 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECOK1 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECODH RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECO57 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_ECO24 RecName: Full=Anaerobic nitric oxide reductase flavor...    60   2e-11
NORV_SALCH RecName: Full=Anaerobic nitric oxide reductase flavor...    60   4e-11
NORV_CITK8 RecName: Full=Anaerobic nitric oxide reductase flavor...    59   6e-11
NORV_KLEP7 RecName: Full=Anaerobic nitric oxide reductase flavor...    59   8e-11
RUBR_CLOTS RecName: Full=Rubredoxin;         Short=Rd;                 58   1e-10
RUBR_ANASP RecName: Full=Rubredoxin;         Short=Rd;                 58   1e-10
RUBR_METTH RecName: Full=Probable rubredoxin;         Short=RD;        57   2e-10
RUBR_ANAVT RecName: Full=Rubredoxin;         Short=Rd;                 57   2e-10
NORV_ERWCT RecName: Full=Anaerobic nitric oxide reductase flavor...    57   2e-10
NORV_SERP5 RecName: Full=Anaerobic nitric oxide reductase flavor...    57   3e-10
HRB_MOOTA RecName: Full=High molecular weight rubredoxin;AltName...    57   3e-10
NORV_PECCP RecName: Full=Anaerobic nitric oxide reductase flavor...    56   5e-10
RUBR_DESGI RecName: Full=Rubredoxin;         Short=Rd;                 55   7e-10
RUBR2_CLOPE RecName: Full=Rubredoxin 2;         Short=Rd 2;            55   1e-09
RUBR1_CHLTE RecName: Full=Rubredoxin 1;         Short=Rd 1;            54   2e-09
RUBR2_CHLTE RecName: Full=Rubredoxin 2;         Short=Rd 2;            54   2e-09
RUBR1_CLOPE RecName: Full=Rubredoxin 1;         Short=Rd 1;            54   2e-09
RUBR_TREPA RecName: Full=Rubredoxin;         Short=Rd;                 54   3e-09
RUBR_PYRFU RecName: Full=Rubredoxin;         Short=Rd;                 54   3e-09
RUBR2_PSEOL RecName: Full=Rubredoxin 2;AltName: Full=Two-iron ru...    54   3e-09
NORV_AERS4 RecName: Full=Anaerobic nitric oxide reductase flavor...    54   3e-09
RUBR_BUTME RecName: Full=Rubredoxin;         Short=Rd;                 53   4e-09
NORV_AERHH RecName: Full=Anaerobic nitric oxide reductase flavor...    53   4e-09
RUBR_HELMO RecName: Full=Rubredoxin;         Short=Rd;                 52   6e-09
RUBR1_DESDA RecName: Full=Rubredoxin 1;         Short=Rd-1;            52   6e-09
RUBR_PYRAB RecName: Full=Rubredoxin;         Short=Rd;                 52   1e-08
RUBR_SYNY3 RecName: Full=Rubredoxin;         Short=Rd;                 51   1e-08
RUBR_CLOAB RecName: Full=Rubredoxin;         Short=Rd;                 51   1e-08
RUBR_CLOST RecName: Full=Rubredoxin;         Short=Rd;                 51   2e-08
NORV_VIBVY RecName: Full=Anaerobic nitric oxide reductase flavor...    51   2e-08
NORV_VIBVU RecName: Full=Anaerobic nitric oxide reductase flavor...    51   2e-08
RUBR_CHLLT RecName: Full=Rubredoxin;         Short=Rd;                 50   2e-08
RUBR2_METJA RecName: Full=Probable rubredoxin 2;         Short=R...    50   2e-08
RUBR_DESVH RecName: Full=Rubredoxin;         Short=Rd;                 50   4e-08
RUBR_MEGEL RecName: Full=Rubredoxin;         Short=Rd;                 49   5e-08
RUBR_CLOPA RecName: Full=Rubredoxin;         Short=Rd;                 49   5e-08
NORV_VIBF1 RecName: Full=Anaerobic nitric oxide reductase flavor...    49   5e-08
RUBR_ACIAD RecName: Full=Rubredoxin;         Short=Rd;                 49   7e-08
RUBR3_CHLTE RecName: Full=Rubredoxin 3;         Short=Rd 3;            49   7e-08
NORV_ALISL RecName: Full=Anaerobic nitric oxide reductase flavor...    49   7e-08
RUBR2_DESDA RecName: Full=Rubredoxin 2;         Short=Rd-2;            49   9e-08
RUBR_DESVM RecName: Full=Rubredoxin;         Short=Rd;                 48   1e-07
RUBR3_RHOSQ RecName: Full=Rubredoxin 3;                                44   2e-06
RUBR3_RHOER RecName: Full=Rubredoxin 3;                                44   2e-06
RUBR4_RHOSQ RecName: Full=Rubredoxin 4;                                42   6e-06
RUBR4_RHOER RecName: Full=Rubredoxin 4;                                42   6e-06
RUBR_PEPAS RecName: Full=Rubredoxin;         Short=Rd;                 40   3e-05
RUBR2_RHOER RecName: Full=Rubredoxin 2;                                39   7e-05
RN126_MOUSE RecName: Full=RING finger protein 126;                     35   0.001

>HOXQ_RALEH RecName: Full=Hydrogenase expression/formation protein
           hoxQ;
          Length = 282

 Score =  168 bits (426), Expect = 6e-44
 Identities = 108/285 (37%), Positives = 157/285 (55%), Gaps = 12/285 (4%)

Query: 3   HSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIR 62
           +S  IPVV + GPGSQ E+E  +++ +P G+++   PVLPE    A L  A+ +L  ++ 
Sbjct: 2   NSFPIPVV-LLGPGSQAEDETLDYIHMPQGMSVYTPPVLPEPEQIACLTQAQSVLRAILD 60

Query: 63  DMDNPVATLPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQ-RIQETVFTGV 121
            +D      P P   +L A +++N  LL Q+LGEGE+SAR+   +G+ Q  IQE VF GV
Sbjct: 61  ALDRADPKQPNP-RIELWALDEENRQLLKQVLGEGEVSARI---EGEYQVYIQEAVFAGV 116

Query: 122 WRVREYNADQQRVADEIIIGPIPESIWQT--HXXXXXXXXXXXXXAGLMNGAFIAHEIAE 179
           WRV     D     D I +G  PE +     +              G+MN   I  EI +
Sbjct: 117 WRVVSTCPDA--TTDYIEVGAAPEVLRGAARYGANQWSLDVGRVPDGVMNAPSILAEIDD 174

Query: 180 RVKQ--PVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWR 237
           ++    P K  H++NLTLLP++  D  +LD  LG     I SRGYG CRI ST  P  WR
Sbjct: 175 QLLSWHPGKPVHVVNLTLLPMSPQDITFLDETLGAASVTILSRGYGNCRISSTAVPYCWR 234

Query: 238 VNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWL 282
           V YFN  +T + + +EI D+P++A A  +D+ D++  L   L+W+
Sbjct: 235 VVYFNSQDTTILNTVEITDLPEVACAAPEDLRDSHERLTEVLKWV 279


>HYAF_ECOLI RecName: Full=Hydrogenase-1 operon protein hyaF;
          Length = 285

 Score =  135 bits (339), Expect = 7e-34
 Identities = 85/282 (30%), Positives = 138/282 (48%), Gaps = 15/282 (5%)

Query: 11  NIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHI--LTTLIRDMDNPV 68
           ++ GPG+QP ++ F+  P      LP+T  + ++   A L    H   +  L+ ++ + +
Sbjct: 7   HLLGPGTQPNDDSFSMNP------LPITCQVNDEPSMAALEQCAHSPQVIALLNELQHQL 60

Query: 69  ATLPFPLSYKLNATEQQNSG----LLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRV 124
           +    PL                  ++ LLGEGE+S R+  +D  E  IQE +F G+WRV
Sbjct: 61  SERQPPLGEXXXXXXXXXXXXXRHFINTLLGEGEVSVRIQQADDSESEIQEAIFCGLWRV 120

Query: 125 REYNADQQRVADEIIIGPIPESIWQ--THXXXXXXXXXXXXXAGLMNGAFIAHEIAERVK 182
           R    ++  + D++  G  P ++WQ  T               GLMNG  +AHE+   V+
Sbjct: 121 RRRRGEKL-LEDKLEAGCAPLALWQAATQNLLPTDSLLPPPIDGLMNGLPLAHELLAHVR 179

Query: 183 QPVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFN 242
            P  +PH INLT LP+++ADR +L    G G   I + GYG+  I +T    VW +   +
Sbjct: 180 NPDAQPHSINLTQLPISEADRLFLSRLCGPGNIQIRTIGYGESYINATGLRHVWHLRCTD 239

Query: 243 DMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWLKE 284
            +   L +  EI  IP++ +A  +D+ D+   L    +WL E
Sbjct: 240 TLKGPLLESYEICPIPEVVLAAPEDLVDSAQRLSEVCQWLAE 281


>HUPH_RHOCA RecName: Full=Hydrogenase expression/formation protein
           hupH;
          Length = 275

 Score =  123 bits (308), Expect = 3e-30
 Identities = 81/274 (29%), Positives = 136/274 (49%), Gaps = 15/274 (5%)

Query: 14  GPGSQPE-EEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVATLP 72
           GPGSQPE +E+  ++ +P+G+    +  LPE    + +  A  +L  +    +       
Sbjct: 13  GPGSQPEGDEELGYMQLPSGMRT-YSAHLPEVEDSSAVTPALKLLDEIAAGAE--ACARG 69

Query: 73  FPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQ 132
              S+ L   + QN  L+ + +G+GE++ ++         +QE+VF GVW V     D+ 
Sbjct: 70  GMASFDLAGLDAQNRALIAETMGQGEVAMKI--RGIPALMVQESVFAGVWSVAGAGVDR- 126

Query: 133 RVADEIIIGPIPESIWQT--HXXXXXXXXXXXXXAGLMNGAFIAHEIAERVKQPVK-EPH 189
                I +G +P +                     G++N   +  E+ ++    V     
Sbjct: 127 -----IEVGAVPAAALSRAFEPFRKGQTALPPLSDGVVNAPALIAELFDKSAAYVGGAAD 181

Query: 190 IINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQ 249
           +INLTLLP  + D   LD+ LGEG   I SRGYG CRI +T  P VWRV ++N  + L+ 
Sbjct: 182 VINLTLLPHTEEDLTLLDYMLGEGAVTILSRGYGNCRITATATPHVWRVQFYNSTDALIL 241

Query: 250 DMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWLK 283
           D IE+  +P++A+A  +D+ED+   ++  LE ++
Sbjct: 242 DTIEVTTMPEVALAAREDLEDSAGRIREVLEAIR 275


>HOXQ_AZOVI RecName: Full=Hydrogenase expression/formation protein
           hoxQ;
          Length = 283

 Score =  121 bits (303), Expect = 1e-29
 Identities = 83/265 (31%), Positives = 123/265 (46%), Gaps = 13/265 (4%)

Query: 14  GPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVATLPF 73
           GPGS  EEE  +   +P  +     P LPE   P +L     I                 
Sbjct: 13  GPGSHGEEERPDCPSMPRAMRRFERPALPE---PGQLS-GHPIXXXXXXXXXXXXXXYRI 68

Query: 74  PLSYKLNATEQQNSG---LLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNAD 130
               ++   ++Q      LL Q+LGEGE++ +V     +  RIQETV  GVW V+     
Sbjct: 69  GEQSRVIGLDRQPKADLKLLQQILGEGEVAIQV--GGQRPARIQETVLAGVWWVQLQIGR 126

Query: 131 QQRVADEIIIGPIPESIWQTHXXXXXXXXXXXXXAGLMNGAFIAHEIAERVKQPVKE--- 187
            + V   + +  +P  + +                GL+N   +  E+ +  K+  +    
Sbjct: 127 GEVVGQWLEVADVPALVRRRAFAETRWPQLGELPDGLLNAGPVLVELLDAAKRHAERALA 186

Query: 188 -PHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNT 246
            PH +NL+LLP +  DR +L   LGEG   + SRGYG CRI ST  PG+W V YFN  + 
Sbjct: 187 TPHAVNLSLLPFSPEDRRFLAERLGEGSVTLLSRGYGNCRIASTATPGIWCVQYFNSSDR 246

Query: 247 LLQDMIEIADIPDIAVAGIDDIEDA 271
           L+ D +E+  IP +A A  +DI+D+
Sbjct: 247 LILDTLEVTGIPQVACAAQEDIDDS 271


>HUPQ_AZOCH RecName: Full=Hydrogenase expression/formation protein
           hupQ;
          Length = 284

 Score =  120 bits (302), Expect = 1e-29
 Identities = 85/266 (31%), Positives = 122/266 (45%), Gaps = 14/266 (5%)

Query: 14  GPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVATLPF 73
           GPGS  EE+  ++LP+P  ++    P LPE   P +L  +  I                 
Sbjct: 13  GPGSHGEEDRLDYLPMPREMHTFERPSLPE---PEQLD-SHPIXXXXXXXXXXXXXXYRI 68

Query: 74  PLSYKLNATEQQNSG---LLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNAD 130
               ++   ++Q      LL Q+LGEGE++ +V     +  RIQETV  GVW        
Sbjct: 69  GEQSRVIGLDRQPKADLKLLQQILGEGEVAIQV--GGQRPVRIQETVLAGVWXXXXXXXX 126

Query: 131 QQRVADEIIIGPIPESIWQ-THXXXXXXXXXXXXXAGLMNGAFIAHEIAERVKQPVKE-- 187
                       IP  + +                  L+N   +  E+ E  KQ  +   
Sbjct: 127 XXXXXXXXXXADIPALVRRRAFAEARWPRLGATLPDDLLNAGPVLVELLEAAKQHAEHAS 186

Query: 188 --PHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMN 245
             PH+INL+LLP +  D+ +L   LGEG   + SRGYG CRI ST  PG+WRV YFN  +
Sbjct: 187 ATPHVINLSLLPFSAEDQRFLAEQLGEGPVTVLSRGYGNCRIASTATPGIWRVQYFNSTD 246

Query: 246 TLLQDMIEIADIPDIAVAGIDDIEDA 271
            L+ D +E+  IP  A A  +DI+D+
Sbjct: 247 RLILDTLEVTAIPQAACAAQEDIDDS 272


>HUPH_RHILV RecName: Full=Hydrogenase expression/formation protein
           hupH;
          Length = 282

 Score =  108 bits (269), Expect = 9e-26
 Identities = 57/171 (33%), Positives = 92/171 (53%), Gaps = 2/171 (1%)

Query: 112 RIQETVFTGVWRVREYNADQQRVADEIIIGPIPESIWQTHXXXXXXXXXXXXXAGLMNGA 171
           ++QE V  GVWR+R  + D + +AD I +  IP ++ Q               AG MN  
Sbjct: 108 QMQEAVMAGVWRIRFTDVDGRLIADYIEVASIPAAVRQACSGLPASISHGPAPAGAMNVM 167

Query: 172 FIAHEIAERVKQ--PVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVS 229
            +  EI +R+ +       H+I  +L P++  D  +L   LG G   + SRGYG CR+V+
Sbjct: 168 PVLTEIGDRIARYRDGDPAHVITFSLFPMSPEDMAFLQDALGAGPVQLTSRGYGTCRVVA 227

Query: 230 THFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLE 280
           T    VW V ++N M+T++ D +E+ +IP +A+A  +D  D+ A L++  E
Sbjct: 228 TGARNVWSVQFYNAMDTIILDTLEVCNIPSVAIAAEEDFRDSEARLRDIWE 278


>HUPH_BRAJA RecName: Full=Hydrogenase expression/formation protein
           hupH;
          Length = 287

 Score =  101 bits (252), Expect = 9e-24
 Identities = 62/178 (34%), Positives = 93/178 (52%), Gaps = 8/178 (4%)

Query: 107 DGKEQRIQETVFTGVWRVR-EYNADQQRVADEIIIGPIPESIWQTHXXXXXXXXXXXXXA 165
           DG   +IQE+V  G+WRVR E +A+ + +     IG +PE + +                
Sbjct: 110 DGSLAQIQESVLAGIWRVRLETDANHEYLE----IGAVPEIVKRAAADLTSADFEIGQVP 165

Query: 166 -GLMNGAFIAHEIAERVK--QPVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGY 222
            G MN   +  EI ER    +P     IIN TLLP++  D  +L   +  G   + SRGY
Sbjct: 166 EGAMNVLPVLAEIRERALAWRPGIRSQIINFTLLPMSPVDMSFLQDTIRNGPIQLVSRGY 225

Query: 223 GKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLE 280
           G CR++ST    VW V +FN M+T++ D +E+  +P +A+A  +D ED+   LK  +E
Sbjct: 226 GTCRVLSTGIRNVWSVQFFNAMDTIILDTLEVGGVPTVALAADEDFEDSAERLKEIIE 283


>RUBR_AZOVI RecName: Full=Rubredoxin;         Short=Rd;
          Length = 72

 Score = 79.0 bits (193), Expect = 6e-17
 Identities = 30/50 (60%), Positives = 37/50 (74%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           +ECK+CW  YDPA GD VWQIPPG PF+ LP +W CP C+  +  FMV+D
Sbjct: 22  LECKICWQRYDPAEGDPVWQIPPGTPFAALPAHWRCPRCDGDREQFMVVD 71


>RUBL_RHILV RecName: Full=Probable rubredoxin hupI;
          Length = 70

 Score = 78.6 bits (192), Expect = 8e-17
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEG 347
           RMEC +CW VYDPA GD VWQIPPG PFS L + W CP C+  +S FM + +G
Sbjct: 17  RMECGICWHVYDPAEGDPVWQIPPGTPFSNLTEDWRCPNCDALQSKFMRLGDG 69


>RUBR_RALEH RecName: Full=Rubredoxin;         Short=Rd;
          Length = 78

 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 29/50 (58%), Positives = 35/50 (70%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           R+ECK+CWW YDP +GD VWQI PG  FS LP +W CP C+     FMV+
Sbjct: 25  RLECKICWWEYDPEVGDPVWQIAPGTSFSALPAHWRCPNCDGEAEQFMVL 74


>RUBL_BRAJA RecName: Full=Probable rubredoxin hupI;
          Length = 69

 Score = 76.6 bits (187), Expect = 3e-16
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 293 VVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           V R+EC +CW VYDPA GDDV QI PG PF+ LP+ W CP C+  KS FM I+
Sbjct: 16  VTRLECGICWTVYDPADGDDVAQIAPGTPFAALPEEWHCPNCDAPKSKFMAIE 68


>RUBR_AZOCH RecName: Full=Rubredoxin in uptake hydrogenase operon;
          Length = 72

 Score = 75.9 bits (185), Expect = 5e-16
 Identities = 28/51 (54%), Positives = 38/51 (74%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           +ECK+CW  YDPA+GD+VWQI  G PF+ LP +W CP C+  +  FMV+D+
Sbjct: 22  LECKICWHRYDPAVGDEVWQILAGTPFAALPAHWRCPQCDGDREQFMVVDD 72


>HUPJ_RHOCA RecName: Full=Probable rubredoxin hupJ;
          Length = 278

 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 26/48 (54%), Positives = 34/48 (70%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMV 343
           MECK+CW  YDPA GD+  Q+ PG PF+ LP+ W CP C+  K+ F+V
Sbjct: 26  MECKICWTPYDPASGDEFRQVLPGTPFTALPEDWHCPNCDAPKAQFIV 73


>RUBR1_METJA RecName: Full=Probable rubredoxin 1;         Short=RD
           1;
          Length = 80

 Score = 65.9 bits (159), Expect = 5e-13
 Identities = 28/54 (51%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVC--ETSKSGFMVIDE 346
           + +CKVC WVYDP  GD    IPP  PF +LPD W CPVC  +  K  F  +DE
Sbjct: 21  KYKCKVCGWVYDPLKGDPSQNIPPKTPFEELPDTWICPVCRGKVGKESFEPLDE 74


>NORV_SALPA RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 62.8 bits (151), Expect = 4e-12
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPALG+ +  + PG P+S++PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPALGEPLQDVAPGTPWSEVPDNFLCPECSLGKDVFDVL 474


>NORV_SALTI RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 62.0 bits (149), Expect = 8e-12
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPALG+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 474


>NORV_SALPB RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 62.0 bits (149), Expect = 8e-12
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPALG+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 474


>NORV_SALAR RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 62.0 bits (149), Expect = 8e-12
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPALG+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 474


>NORV_ENT38 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 482

 Score = 61.6 bits (148), Expect = 1e-11
 Identities = 24/49 (48%), Positives = 32/49 (65%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           M+C VC WVYDPALG+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 429 MQCSVCQWVYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 477


>NORV_SHISS RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 61.2 bits (147), Expect = 1e-11
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 277 NTLEWLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCET 336
           NT+   +    T+++   RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C  
Sbjct: 407 NTVVKEETSATTKSDLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSL 466

Query: 337 SKSGF 341
            K  F
Sbjct: 467 GKDVF 471


>NORV_ECOHS RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 61.2 bits (147), Expect = 1e-11
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 277 NTLEWLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCET 336
           NT+   +    T+++   RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C  
Sbjct: 407 NTVVKEETSATTKSDLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSL 466

Query: 337 SKSGF 341
            K  F
Sbjct: 467 GKDVF 471


>NORV_SALTY RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.8 bits (146), Expect = 2e-11
 Identities = 22/50 (44%), Positives = 33/50 (66%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPALG+ +  + PG P++ +PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPALGEPLQDVAPGTPWNDVPDNFLCPECSLGKDVFDVL 474


>NORV_SHIFL RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_SHIF8 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_SHIDS RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_SHIBS RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOUT RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOSM RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOLI RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOLC RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOL6 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOL5 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECOK1 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECODH RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_ECO57 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin homolog;         Short=FlRd homolog;    
               Short=FlavoRb homolog;
          Length = 411

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 357 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 403


>NORV_ECO24 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPA G+ +  + PG P+S++PD + CP C   K  F
Sbjct: 425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF 471


>NORV_SALCH RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 479

 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +M+C VC W+YDPA G+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 425 KMQCSVCQWIYDPAQGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 474


>NORV_CITK8 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 482

 Score = 58.9 bits (141), Expect = 6e-11
 Identities = 22/49 (44%), Positives = 31/49 (63%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           M+C VC W+YDPA G+ +  + PG P+S +PD + CP C   K  F V+
Sbjct: 429 MQCSVCQWIYDPAKGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL 477


>NORV_KLEP7 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 482

 Score = 58.5 bits (140), Expect = 8e-11
 Identities = 23/49 (46%), Positives = 31/49 (63%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           M+C VC WVYDPA G+    + PG P+S++PD + CP C   K  F V+
Sbjct: 429 MQCSVCQWVYDPAKGEPNQDVQPGTPWSEVPDNFLCPECSLGKDVFDVL 477


>RUBR_CLOTS RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 22/47 (46%), Positives = 27/47 (57%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           + +C VC ++YDP +GD    IPPG  F  LPD W CP C   K  F
Sbjct: 3   KWQCTVCGYIYDPEVGDPTQNIPPGTKFEDLPDDWVCPDCGVGKDQF 49


>RUBR_ANASP RecName: Full=Rubredoxin;         Short=Rd;
          Length = 111

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 24/53 (45%), Positives = 32/53 (60%)

Query: 289 ENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           EN  + R EC+ C +VY+P  GD+   I P  PF++LP  W CPVC   K+ F
Sbjct: 7   ENTVLDRFECRSCGYVYEPEKGDNKHDIAPETPFAELPINWRCPVCTAKKAAF 59


>RUBR_METTH RecName: Full=Probable rubredoxin;         Short=RD;
          Length = 63

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 23/58 (39%), Positives = 32/58 (55%)

Query: 288 TENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           +E   + R +C+VC ++YDP  G+     PPG PF  LP+ W CP C   K  F  +D
Sbjct: 6   SEVSAMKRYKCRVCGYIYDPEKGEPRTDTPPGTPFEDLPETWRCPSCGAKKKMFKPLD 63


>RUBR_ANAVT RecName: Full=Rubredoxin;         Short=Rd;
          Length = 111

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 24/53 (45%), Positives = 31/53 (58%)

Query: 289 ENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           EN  + R EC+ C +VY+P  GD    I P  PF++LP  W CPVC   K+ F
Sbjct: 7   ENTVLDRFECRSCGYVYEPEKGDSKHDIAPETPFAELPINWRCPVCTAKKAAF 59


>NORV_ERWCT RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 509

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 286 PVTENEPVVR-----MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSG 340
           P +  +P V+     M+C VC W+YDPALG+ +  + PG  +S +PD + CP C   K  
Sbjct: 445 PQSATQPTVQSESGCMQCSVCQWIYDPALGEPMQDVTPGTMWSDVPDSFLCPECGLGKDV 504

Query: 341 F 341
           F
Sbjct: 505 F 505


>NORV_SERP5 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 485

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           RM+C VC W+YDPALG+ +  + PG  + ++PD + CP C   K  F
Sbjct: 431 RMQCSVCLWIYDPALGEPMQDVAPGTCWQEVPDDFLCPECAMGKEVF 477


>HRB_MOOTA RecName: Full=High molecular weight rubredoxin;AltName:
           Full=Nitric oxide reductase NADH:FprA oxidoreductase;
          Length = 229

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 21/47 (44%), Positives = 28/47 (59%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           + +C +C +VYDP  GD    I PG PF+ LP+ W CP+C   K  F
Sbjct: 180 KYQCTICNYVYDPVQGDPEHGIAPGTPFADLPEDWTCPICGAGKDAF 226


>NORV_PECCP RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 503

 Score = 55.8 bits (133), Expect = 5e-10
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           M+C VC W+YDPALG+ +  + PG  +S +PD + CP C   K  F
Sbjct: 454 MQCSVCQWIYDPALGEPMQDVTPGTMWSDVPDSFLCPECGLGKDVF 499


>RUBR_DESGI RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 55.5 bits (132), Expect = 7e-10
 Identities = 24/44 (54%), Positives = 25/44 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC + YDPA GD    I PG  F  LPD W CPVC  SK  F
Sbjct: 6   CTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAF 49


>RUBR2_CLOPE RecName: Full=Rubredoxin 2;         Short=Rd 2;
          Length = 53

 Score = 54.7 bits (130), Expect = 1e-09
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC ++YDPA+GD    + PG  F  +PD W CP+C   KS F
Sbjct: 6   CDVCGYIYDPAVGDPDNGVEPGTEFKDIPDDWVCPLCGVDKSQF 49


>RUBR1_CHLTE RecName: Full=Rubredoxin 1;         Short=Rd 1;
          Length = 69

 Score = 54.3 bits (129), Expect = 2e-09
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 287 VTENEPV-----VRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           V E+EP          C  C ++YDPA G+    I PG+PF +LPD W CPVC   K+ F
Sbjct: 3   VKESEPAQADLQASWMCAECGYIYDPAEGNLETNIRPGMPFDKLPDDWSCPVCNHPKNQF 62


>RUBR2_CHLTE RecName: Full=Rubredoxin 2;         Short=Rd 2;
          Length = 52

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           +C +C ++Y+P  GD    IP G  F  LPD W CPVC   K  F  I
Sbjct: 5   KCNICGYIYNPETGDPEGDIPAGTSFESLPDSWMCPVCGAGKEEFTKI 52


>RUBR1_CLOPE RecName: Full=Rubredoxin 1;         Short=Rd 1;
          Length = 53

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           C VC ++YDP +GD    + PG  F  +PD W CP+C+  K+ F  ++
Sbjct: 6   CDVCGYIYDPVVGDPDNGVAPGTKFKDIPDTWVCPLCKLDKTHFSKVE 53


>RUBR_TREPA RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           C +C W Y+P +GD    IP G  F  LPD+W CP+C   K+ F+ +
Sbjct: 6   CDLCGWGYNPEVGDADGGIPAGTAFENLPDHWECPLCGVDKTSFVKV 52


>RUBR_PYRFU RecName: Full=Rubredoxin;         Short=Rd;
          Length = 54

 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           CK+C ++YD   GD    I PG  F +LPD W CP+C   KS F  +++
Sbjct: 6   CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 54


>RUBR2_PSEOL RecName: Full=Rubredoxin 2;AltName: Full=Two-iron
           rubredoxin;
          Length = 173

 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           C  C  +YD ALGD+     PG  F  +PD WCCP C  +K  +++ +E
Sbjct: 124 CITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATKEDYVLYEE 172



 Score = 45.1 bits (105), Expect = 1e-06
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCET-SKSGFMVIDEG 347
           +C  C +VYD + G+      PG P+  +P+ WCCP C    K  FM+I+ G
Sbjct: 5   KCPDCNYVYDESAGNVHEGFSPGTPWHLIPEDWCCPDCAVRDKLDFMLIESG 56


>NORV_AERS4 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 521

 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           M C VC W+YDPALG+    + PG P++++PD + CP C   K  F
Sbjct: 467 MLCTVCQWIYDPALGEPDQLVAPGTPWARVPDSFLCPGCGIGKEVF 512


>RUBR_BUTME RecName: Full=Rubredoxin;         Short=Rd;
          Length = 53

 Score = 53.1 bits (126), Expect = 4e-09
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C +C +VYDPA+GD    + PG  F+ LP+ W CP C  SK  F
Sbjct: 6   CDICGYVYDPAVGDPDNGVAPGTAFADLPEDWVCPECGVSKDEF 49


>NORV_AERHH RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 495

 Score = 53.1 bits (126), Expect = 4e-09
 Identities = 22/46 (47%), Positives = 28/46 (60%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           M C VC WVYDPA G+    + PG P++Q+PD + CP C   K  F
Sbjct: 441 MLCTVCQWVYDPAQGEPDQLVAPGTPWAQVPDSFLCPGCGIGKEVF 486


>RUBR_HELMO RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 52.4 bits (124), Expect = 6e-09
 Identities = 23/44 (52%), Positives = 25/44 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC +VYDPA GD    I PG  F  LP  W CP+C  SK  F
Sbjct: 6   CLVCGYVYDPAKGDPDHGIAPGTAFEDLPADWVCPLCGVSKDEF 49


>RUBR1_DESDA RecName: Full=Rubredoxin 1;         Short=Rd-1;
          Length = 45

 Score = 52.4 bits (124), Expect = 6e-09
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC + YDPA  D+V       PF QLPD WCCPVC  SK  F
Sbjct: 6   CNVCGYEYDPAEHDNV-------PFDQLPDDWCCPVCGVSKDQF 42


>RUBR_PYRAB RecName: Full=Rubredoxin;         Short=Rd;
          Length = 53

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 22/53 (41%), Positives = 29/53 (54%)

Query: 293 VVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           + +  CK+C ++YD   GD    I PG  F  LPD W CP+C   KS F  I+
Sbjct: 1   MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE 53


>RUBR_SYNY3 RecName: Full=Rubredoxin;         Short=Rd;
          Length = 115

 Score = 51.2 bits (121), Expect = 1e-08
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           EC+ C +VY P+ GD    + PG PF  LP  W CPVC   ++ F+   E
Sbjct: 19  ECRACGYVYIPSQGDQKTSVSPGTPFEALPLNWKCPVCGAPRNYFISTGE 68


>RUBR_CLOAB RecName: Full=Rubredoxin;         Short=Rd;
          Length = 54

 Score = 51.2 bits (121), Expect = 1e-08
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           C VC ++YDPA GD    + PG  F  +PD W CP+C   K  F   +E
Sbjct: 6   CVVCGYIYDPAEGDPDNGVNPGTSFEDIPDDWVCPLCGVGKDQFEPSEE 54


>RUBR_CLOST RecName: Full=Rubredoxin;         Short=Rd;
          Length = 53

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 20/44 (45%), Positives = 25/44 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC +VYDP +GD    I PG  F  +P+ W CP+C   K  F
Sbjct: 6   CTVCGYVYDPEVGDPDNNINPGTSFQDIPEDWVCPLCGVGKDQF 49


>NORV_VIBVY RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 494

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 284 EYPVTENEPVVR---------MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVC 334
           + P+TE  P            M C VC WVYDPA G+    I  G  ++ +PDY+ CP C
Sbjct: 423 QQPLTETTPTADAAHSADCQCMVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPEC 482

Query: 335 ETSKSGFM 342
              K  F+
Sbjct: 483 HLGKDVFV 490


>NORV_VIBVU RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 494

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 284 EYPVTENEPVVR---------MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVC 334
           + P+TE  P            M C VC WVYDPA G+    I  G  ++ +PDY+ CP C
Sbjct: 423 QQPLTETTPTADAAHSADCQCMVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPEC 482

Query: 335 ETSKSGFM 342
              K  F+
Sbjct: 483 HLGKDVFV 490


>RUBR_CHLLT RecName: Full=Rubredoxin;         Short=Rd;
          Length = 53

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 22/44 (50%), Positives = 25/44 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC +VYDPA G+    I PG  F  LP+ W CPVC   K  F
Sbjct: 6   CSVCGYVYDPADGEPDDPIDPGTGFEDLPEDWVCPVCGVDKDLF 49


>RUBR2_METJA RecName: Full=Probable rubredoxin 2;         Short=RD
           2;
          Length = 55

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 293 VVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           + R +C +C WVYD   G+    IPPG  F  LPD + CP C   K+ F  ID
Sbjct: 4   MARYQC-MCGWVYDEDKGEPSQNIPPGTKFEDLPDTFRCPQCGLGKNAFRKID 55


>RUBR_DESVH RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 22/44 (50%), Positives = 24/44 (54%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC + YDPA GD    + PG  F  LP  W CPVC   KS F
Sbjct: 6   CTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEF 49


>RUBR_MEGEL RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 49.3 bits (116), Expect = 5e-08
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           + EC +C ++YD A GDD   +  G  F+ LP  W CP C   K  F+ +D
Sbjct: 3   KYECSICGYIYDEAEGDD-GNVAAGTKFADLPADWVCPTCGADKDAFVKMD 52


>RUBR_CLOPA RecName: Full=Rubredoxin;         Short=Rd;
          Length = 54

 Score = 49.3 bits (116), Expect = 5e-08
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++E
Sbjct: 6   CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 54


>NORV_VIBF1 RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 496

 Score = 49.3 bits (116), Expect = 5e-08
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           M C VC WVYDP +G+    + P  P+S +P+ + CP C   K  F+ I
Sbjct: 447 MLCSVCNWVYDPEIGEPNQGVEPNTPWSSVPNDFLCPECHLGKDVFVEI 495


>RUBR_ACIAD RecName: Full=Rubredoxin;         Short=Rd;
          Length = 54

 Score = 48.9 bits (115), Expect = 7e-08
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           + +C VC W+YD A G     I PG  +  +PD W CP C  SK  F +I+
Sbjct: 3   KYQCIVCGWIYDEAEGWPQDGIAPGTKWEDIPDDWTCPDCGVSKVDFEMIE 53


>RUBR3_CHLTE RecName: Full=Rubredoxin 3;         Short=Rd 3;
          Length = 53

 Score = 48.9 bits (115), Expect = 7e-08
 Identities = 22/44 (50%), Positives = 24/44 (54%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C  C + YDPA GD    I PG  F  LP+ W CPVC   KS F
Sbjct: 6   CVPCGYEYDPADGDPENGIEPGTAFEDLPEDWVCPVCGVDKSFF 49


>NORV_ALISL RecName: Full=Anaerobic nitric oxide reductase
           flavorubredoxin;         Short=FlRd;       
           Short=FlavoRb;
          Length = 499

 Score = 48.9 bits (115), Expect = 7e-08
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVI 344
           M C VC WVYDP +G+    + P   +  +PDY+ CP C   K  F+ +
Sbjct: 450 MLCTVCNWVYDPEIGEPNQGVEPNTAWIDVPDYFLCPECNLGKDVFVEV 498


>RUBR2_DESDA RecName: Full=Rubredoxin 2;         Short=Rd-2;
          Length = 62

 Score = 48.5 bits (114), Expect = 9e-08
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 291 EPVVRMECKV--CWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           EP     C++  C +VYDP  GD   ++P G  F  LP+ W CPVC   K  F
Sbjct: 3   EPQDMWRCQMVNCGYVYDPDRGDKRRKVPAGTKFEDLPEDWRCPVCGAGKKSF 55


>RUBR_DESVM RecName: Full=Rubredoxin;         Short=Rd;
          Length = 52

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341
           C VC + YDPA GD    + PG  F  +P  W CP+C   KS F
Sbjct: 6   CTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEF 49


>RUBR3_RHOSQ RecName: Full=Rubredoxin 3;
          Length = 61

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVC 334
           C VC +VYD + G      P G P+  +PD WCCP C
Sbjct: 6   CPVCEYVYDESKGAPREGFPAGTPWDAVPDDWCCPDC 42


>RUBR3_RHOER RecName: Full=Rubredoxin 3;
          Length = 61

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVC 334
           C VC +VYD + G      P G P+  +PD WCCP C
Sbjct: 6   CPVCEYVYDESKGAPREGFPAGTPWDAVPDDWCCPDC 42


>RUBR4_RHOSQ RecName: Full=Rubredoxin 4;
          Length = 60

 Score = 42.4 bits (98), Expect = 6e-06
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           +C  C + YD A+G     I PG  +  +P+ W CP C  +KS F +++
Sbjct: 8   QCAQCGFEYDEAVGWPEDGIEPGTRWDDIPEDWSCPDCGAAKSDFFMVE 56


>RUBR4_RHOER RecName: Full=Rubredoxin 4;
          Length = 60

 Score = 42.4 bits (98), Expect = 6e-06
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           +C  C + YD A+G     I PG  +  +P+ W CP C  +KS F +++
Sbjct: 8   QCAQCGFEYDEAVGWPEDGIEPGTRWDDIPEDWSCPDCGAAKSDFFMVE 56


>RUBR_PEPAS RecName: Full=Rubredoxin;         Short=Rd;
          Length = 53

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 11/57 (19%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVP-----FSQLPDYWCCPVCETSKSGFMVIDE 346
           + EC +C ++YDPAL      + P  P     F  + + W CP+C   K  F V ++
Sbjct: 3   KFECTLCGYIYDPAL------VGPDTPDQDGAFEDVSENWVCPLCGAGKEDFEVYED 53


>RUBR2_RHOER RecName: Full=Rubredoxin 2;
          Length = 63

 Score = 38.9 bits (89), Expect = 7e-05
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 298 CKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
           C  C + YD A+G     I PG  + ++P+ W CP C  +K  F +++
Sbjct: 13  CLQCGFEYDEAIGWPDDGIEPGTRWDEIPEDWSCPDCGAAKVDFEMVE 60


>RN126_MOUSE RecName: Full=RING finger protein 126;
          Length = 313

 Score = 35.0 bits (79), Expect = 0.001
 Identities = 25/71 (35%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 276 KNTLEWLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQ------LPDYW 329
           K  ++ L   PVTE      +EC VC    D ALG+ V Q+P    F        L  + 
Sbjct: 209 KEKIQALPTVPVTEEHVGSGLECPVC--KEDYALGESVRQLPCNHLFHDSCIVPWLEQHD 266

Query: 330 CCPVCETSKSG 340
            CPVC  S +G
Sbjct: 267 SCPVCRKSLTG 277


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.325    0.134    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,630,253,988
Number of extensions: 345184298
Number of successful extensions: 828589
Number of sequences better than 1.0e-03: 14101
Number of HSP's gapped: 812822
Number of HSP's successfully gapped: 15743
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.2 bits)