BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF67703.1 sent8 ACF67703.1 GIB00763CH01 "threonine/homoserine
efflux transporter RhtA"
         (295 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

RHTA_SALTY RecName: Full=Inner membrane transporter rhtA;             492   e-141
RHTA_ECOLI RecName: Full=Inner membrane transporter rhtA;             459   e-131
RHTA_ECOL6 RecName: Full=Inner membrane transporter rhtA;             459   e-131
RHTA_ECO57 RecName: Full=Inner membrane transporter rhtA;             459   e-131
YWFM_BACSU RecName: Full=Uncharacterized transporter ywfM;             54   2e-09
Y1319_SYNY3 RecName: Full=Uncharacterized transporter sll1319;         44   2e-06
YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;             40   3e-05
Y1552_ARCFU RecName: Full=Uncharacterized transporter AF_1552;         39   4e-05
Y976A_HAEIN RecName: Full=Uncharacterized transporter HI0976.1;        36   4e-04
EAMA_SALTY RecName: Full=Probable amino-acid metabolite efflux p...    36   5e-04
YDED_BACSU RecName: Full=Uncharacterized transporter ydeD;             35   8e-04

>RHTA_SALTY RecName: Full=Inner membrane transporter rhtA;
          Length = 295

 Score =  492 bits (1266), Expect = e-141
 Identities = 283/295 (95%), Positives = 283/295 (95%)

Query: 1   MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60
           MPGSTRK            AMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
Sbjct: 1   MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60

Query: 61  PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120
           PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
Sbjct: 61  PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120

Query: 121 DFIWVVLAVLGLWFLLPLGQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVA 180
           DFIWVVLAVLGLWFLLPLGQDMSHVD            CWAVYILTGQRAGAEHGPATVA
Sbjct: 121 DFIWVVLAVLGLWFLLPLGQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVA 180

Query: 181 VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT 240
           VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT
Sbjct: 181 VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT 240

Query: 241 LMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDVK 295
           LMSMEPALAAVSGMIFLGETLTG            SMGSTLTIRREPQIKQVDVK
Sbjct: 241 LMSMEPALAAVSGMIFLGETLTGXXXXXXXXXXXXSMGSTLTIRREPQIKQVDVK 295


>RHTA_ECOLI RecName: Full=Inner membrane transporter rhtA;
          Length = 295

 Score =  459 bits (1180), Expect = e-131
 Identities = 244/294 (82%), Positives = 263/294 (89%)

Query: 1   MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60
           MPGS RK            AM+SIQ GASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
Sbjct: 1   MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60

Query: 61  PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120
           PWRLRFAKEQRLPLLFYG+SLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
Sbjct: 61  PWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120

Query: 121 DFIWVVLAVLGLWFLLPLGQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVA 180
           DF+WVVLAVLGLWFLLPLGQD+SHVD             WA+YIL+GQRAGAEHGPATVA
Sbjct: 121 DFVWVVLAVLGLWFLLPLGQDVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVA 180

Query: 181 VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT 240
           +GSLIAA+IFVPIGA+QAG+ALWHWS++PLGLAVA+LSTALPYSLEMIALTRLPTRTFGT
Sbjct: 181 IGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGT 240

Query: 241 LMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDV 294
           LMSMEPALAAVSGMIFLGETLT             SMGSTLT+R+E +IK++D+
Sbjct: 241 LMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGSTLTVRKESKIKELDI 294


>RHTA_ECOL6 RecName: Full=Inner membrane transporter rhtA;
          Length = 295

 Score =  459 bits (1180), Expect = e-131
 Identities = 244/294 (82%), Positives = 263/294 (89%)

Query: 1   MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60
           MPGS RK            AM+SIQ GASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
Sbjct: 1   MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60

Query: 61  PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120
           PWRLRFAKEQRLPLLFYG+SLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
Sbjct: 61  PWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120

Query: 121 DFIWVVLAVLGLWFLLPLGQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVA 180
           DF+WVVLAVLGLWFLLPLGQD+SHVD             WA+YIL+GQRAGAEHGPATVA
Sbjct: 121 DFVWVVLAVLGLWFLLPLGQDVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVA 180

Query: 181 VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT 240
           +GSLIAA+IFVPIGA+QAG+ALWHWS++PLGLAVA+LSTALPYSLEMIALTRLPTRTFGT
Sbjct: 181 IGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGT 240

Query: 241 LMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDV 294
           LMSMEPALAAVSGMIFLGETLT             SMGSTLT+R+E +IK++D+
Sbjct: 241 LMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGSTLTVRKESKIKELDI 294


>RHTA_ECO57 RecName: Full=Inner membrane transporter rhtA;
          Length = 295

 Score =  459 bits (1180), Expect = e-131
 Identities = 244/294 (82%), Positives = 263/294 (89%)

Query: 1   MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60
           MPGS RK            AM+SIQ GASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
Sbjct: 1   MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK 60

Query: 61  PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120
           PWRLRFAKEQRLPLLFYG+SLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
Sbjct: 61  PWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV 120

Query: 121 DFIWVVLAVLGLWFLLPLGQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVA 180
           DF+WVVLAVLGLWFLLPLGQD+SHVD             WA+YIL+GQRAGAEHGPATVA
Sbjct: 121 DFVWVVLAVLGLWFLLPLGQDVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVA 180

Query: 181 VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT 240
           +GSLIAA+IFVPIGA+QAG+ALWHWS++PLGLAVA+LSTALPYSLEMIALTRLPTRTFGT
Sbjct: 181 IGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGT 240

Query: 241 LMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDV 294
           LMSMEPALAAVSGMIFLGETLT             SMGSTLT+R+E +IK++D+
Sbjct: 241 LMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGSTLTVRKESKIKELDI 294


>YWFM_BACSU RecName: Full=Uncharacterized transporter ywfM;
          Length = 296

 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 74/255 (29%), Positives = 117/255 (45%), Gaps = 33/255 (12%)

Query: 45  ALRLALGTLILIAFFKPWRLRFAKEQRLPLLFYG-LSLGGMNYLFYLSIQTVPLGIAVAL 103
           A RL +G   ++      R    K    PL+F   + +     LF+ +++   + +   +
Sbjct: 38  AFRLLIGGSAMLLAVWISRELHVKNWAWPLVFLAAVCMACYQPLFFTAVKETGIAVGTVI 97

Query: 104 EF------TGPLAVALFSSRRPVDFIWV--VLAVLGLWFLLPLGQDMSHVDXXXXXXXXX 155
                    G L  A+   +RP +  W+  VLA+ G W L     ++  +D         
Sbjct: 98  AIGSAPIIAGTLEWAVLK-KRPRNSWWIATVLALAGCWLLFSDSSNV-RIDXXXXXXXXX 155

Query: 156 XXXCWAVYILTGQRAGAEHGP-ATVAVGSLIAAIIFVPIGAVQAGDALWH----WSILPL 210
               +A Y L  +       P AT AV  +I+AI+  P+        LW     W + P 
Sbjct: 156 XXXSFAGYTLISKAMMKTQPPRATSAVVFMISAILLTPL--------LWQLDISWILTPR 207

Query: 211 GLA----VAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLT---- 262
           GL     + +++T   Y L    LT +P     TL   EP  A++ G+ F+GE L+    
Sbjct: 208 GLGTSLYIGLIATCAAYFLFAKGLTGVPASAAVTLSLAEPLTASLLGVFFIGEMLSPSSW 267

Query: 263 -GIQIMALCAIIAAS 276
            GI +M L  ++ ++
Sbjct: 268 LGIALMMLGLLVISA 282


>Y1319_SYNY3 RecName: Full=Uncharacterized transporter sll1319;
          Length = 329

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 48/215 (22%), Positives = 85/215 (39%), Gaps = 17/215 (7%)

Query: 73  PLLFYGLSLGGMNYLF----YLSIQTVPLGIAVALEFTGPLAVALFSSRR----PVDFIW 124
           P+++  +  G + +L+    Y+SI  +P GIA+ L FT P+  AL + R     P    W
Sbjct: 95  PVIWEAMGCGFLMFLYLVLLYISISFIPTGIAITLFFTYPIFTALLAWRLFNDVPSLLRW 154

Query: 125 VV--LAVLGLWFLLPL---GQDMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATV 179
           +V  L ++G +  +P    G+  + V              +A Y +  QR+     P   
Sbjct: 155 LVIGLTLIGTFLTIPYAYGGEQQTLV--LGVSTGIASGIVYAGYTVFAQRSFQRLHPVPF 212

Query: 180 AVGSLIAAIIFVPIGAV--QAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRT 237
              S               Q  +    W  + +G  ++ L T   + L    +  +    
Sbjct: 213 TWISFATTXXXXXXXXXXWQPHEGNLPWLAITIGSLLSALFTLAGHVLNNWGIHLIGASR 272

Query: 238 FGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAI 272
              + +  PAL  V   + + E+LT IQI  +C +
Sbjct: 273 AAIIGATNPALTVVLAGLAIQESLTNIQIFGVCLV 307


>YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;
          Length = 305

 Score = 39.7 bits (91), Expect = 3e-05
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 209 PLGLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMA 268
           P+ L  A+L+  L Y L+ I L  LP   F  ++  +P L  V   ++LGE++  ++++ 
Sbjct: 69  PIYLVSALLNITLFYGLQTIGLNYLPAGLFSAIVFFQPVLMGVFSWLWLGESMFVMKVIG 128

Query: 269 L-------CAIIAASMGSTLTI 283
           L         I AA  G  +++
Sbjct: 129 LILGFAGVAVISAAGFGGHISV 150


>Y1552_ARCFU RecName: Full=Uncharacterized transporter AF_1552;
          Length = 270

 Score = 39.3 bits (90), Expect = 4e-05
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 160 WAVYILTGQRAGAEHGPATVA-----VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAV 214
           +A+  +  + A  +H P  +      +GS      F+  G V +    W W+I      +
Sbjct: 152 YAIVFVLSKEARKKHSPWRITFYNLGLGSAALLPYFLMFGRVGS----WLWAI-----GL 202

Query: 215 AVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAIIA 274
            V+ TA+P+ L    +  +  +    L  +EP  A + G  + GETLT  Q++    I+A
Sbjct: 203 GVVPTAVPFVLFSYGMKYVKVQRAPILALIEPLCAGLVGYFYFGETLTLTQLIGGAMILA 262


>Y976A_HAEIN RecName: Full=Uncharacterized transporter HI0976.1;
          Length = 170

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 203 WHWSILPLGLA----VAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLG 258
           W  S+   G+A    +A+  + L Y L    L  +     G L+++EP    +  +  LG
Sbjct: 79  WQISLNSTGIAGLLYLAIGCSWLAYWLWNKGLNSVDANISGVLVALEPLFGILFAVSLLG 138

Query: 259 ETLTGIQIMALCAIIAASMGSTL 281
           ETL+    + +  I+ A++GSTL
Sbjct: 139 ETLSFSAALGITIIMLATLGSTL 161


>EAMA_SALTY RecName: Full=Probable amino-acid metabolite efflux
           pump;
          Length = 299

 Score = 35.8 bits (81), Expect = 5e-04
 Identities = 21/63 (33%), Positives = 31/63 (49%)

Query: 212 LAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCA 271
           L +A ++T L Y +    L R  T     L  + P +   S  + LGETLTG+Q+     
Sbjct: 218 LYLAFVATILGYGIWGALLGRYETWRVAPLSLLVPVVGLASAAVLLGETLTGMQLAGAVL 277

Query: 272 IIA 274
           I+A
Sbjct: 278 IMA 280


>YDED_BACSU RecName: Full=Uncharacterized transporter ydeD;
          Length = 319

 Score = 35.0 bits (79), Expect = 8e-04
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 74  LLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRR------PVDFIWVVL 127
           L+F  L +  + Y +  SIQ     +A  L++  P+ V +++  R        D I VVL
Sbjct: 80  LIFGLLGMLAVQYTYMASIQHGNAAVATLLQYLSPVIVIIYTLLRKQTVLTKQDIITVVL 139

Query: 128 AVLGLWFLLPLG 139
           A++G +FLL  G
Sbjct: 140 ALVGCFFLLTNG 151


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.322    0.139    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,555,025,125
Number of extensions: 382654655
Number of successful extensions: 1108741
Number of sequences better than 1.0e-03: 25314
Number of HSP's gapped: 1054541
Number of HSP's successfully gapped: 58487
Length of query: 271
Length of database: 100,000
Length adjustment: 0
Effective length of query: 271
Effective length of database: 100,000
Effective search space: 27100000
Effective search space used: 27100000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)