BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF68005.1 sent8 nuoE GIB00763CH01 "NADH-quinone
oxidoreductase, E subunit"
         (166 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NUOE_SALTY RecName: Full=NADH-quinone oxidoreductase subunit E; ...   346   7e-98
NUOE_SALTI RecName: Full=NADH-quinone oxidoreductase subunit E; ...   346   7e-98
NUOE_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit E; ...   337   6e-95
NUOE_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit E; ...   337   6e-95
NUOE_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit E; ...   337   6e-95
NUOE_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit E; ...   242   2e-66
NUOE_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit E; ...   224   5e-61
NUOE_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit E; ...   191   4e-51
NUOE_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit E; ...   163   9e-43
NUOE2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E ...   107   7e-26
NUOE_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit E; ...   106   1e-25
NDUV2_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinon...   105   4e-25
NDUV2_RAT RecName: Full=NADH dehydrogenase [ubiquinone] flavopro...   103   1e-24
NDUV2_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   102   2e-24
NDUV2_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   100   9e-24
NDUV2_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   100   1e-23
NDUV2_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   100   1e-23
NDUV2_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   100   1e-23
NDUV2_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] flavop...   100   1e-23
NUOE_RICBR RecName: Full=NADH-quinone oxidoreductase subunit E; ...    87   1e-19
NUOE_RICFE RecName: Full=NADH-quinone oxidoreductase subunit E; ...    87   1e-19
NDUV2_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa ...    87   1e-19
NUOE_RICPR RecName: Full=NADH-quinone oxidoreductase subunit E; ...    85   4e-19
HOXF_RALEH RecName: Full=NAD-reducing hydrogenase hoxS subunit a...    85   4e-19
NUOE_RICTY RecName: Full=NADH-quinone oxidoreductase subunit E; ...    84   7e-19
NUOE_RICCN RecName: Full=NADH-quinone oxidoreductase subunit E; ...    82   4e-18
NUOE1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E ...    81   7e-18
NUOE_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit E; ...    80   2e-17
NUOE_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit E; ...    80   2e-17
NQO2_PARDE RecName: Full=NADH-quinone oxidoreductase chain 2;   ...    80   2e-17
NQO2_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 2; ...    79   3e-17
NDUV2_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa ...    78   5e-17
NDUV2_DICDI RecName: Full=NADH dehydrogenase [ubiquinone] flavop...    77   8e-17
NDUV2_SCHPO RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa ...    54   7e-10
Y1420_THEMA RecName: Full=Protein TM_1420;                             38   7e-05

>NUOE_SALTY RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  346 bits (888), Expect = 7e-98
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD
Sbjct: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK
Sbjct: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166


>NUOE_SALTI RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  346 bits (888), Expect = 7e-98
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD
Sbjct: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK
Sbjct: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166


>NUOE_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  337 bits (863), Expect = 6e-95
 Identities = 161/166 (96%), Positives = 163/166 (98%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           MHENQQPQTEAFELSAAEREAIEHE HHYEDPRAASIEALKIVQKQRGWVPDGAI+AIAD
Sbjct: 1   MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIAD 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHI GYQGIQAALEK LNIKPGQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           TFDGRFTLLPTCCLGNCDKGPNMMIDEDTH+HLTPEAIPELLERYK
Sbjct: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK 166


>NUOE_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  337 bits (863), Expect = 6e-95
 Identities = 161/166 (96%), Positives = 163/166 (98%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           MHENQQPQTEAFELSAAEREAIEHE HHYEDPRAASIEALKIVQKQRGWVPDGAI+AIAD
Sbjct: 1   MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIAD 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHI GYQGIQAALEK LNIKPGQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           TFDGRFTLLPTCCLGNCDKGPNMMIDEDTH+HLTPEAIPELLERYK
Sbjct: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK 166


>NUOE_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  337 bits (863), Expect = 6e-95
 Identities = 161/166 (96%), Positives = 163/166 (98%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           MHENQQPQTEAFELSAAEREAIEHE HHYEDPRAASIEALKIVQKQRGWVPDGAI+AIAD
Sbjct: 1   MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIAD 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHI GYQGIQAALEK LNIKPGQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           TFDGRFTLLPTCCLGNCDKGPNMMIDEDTH+HLTPEAIPELLERYK
Sbjct: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK 166


>NUOE_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 166

 Score =  242 bits (617), Expect = 2e-66
 Identities = 114/165 (69%), Positives = 133/165 (80%)

Query: 1   MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD 60
           M ++   QT+ F LS  ER +IEHE HHYEDPRAASIEALKIVQKQRGWVPDGAI AI +
Sbjct: 1   MSQSNLIQTDRFVLSETERSSIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIPAIGE 60

Query: 61  VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT 120
           VLGIPASDVEGVATFYSQIFRQPVGRH+IR CDS+VC+I G++ +   ++K L I  GQT
Sbjct: 61  VLGIPASDVEGVATFYSQIFRQPVGRHIIRVCDSMVCYIGGHESVVGEIQKQLGIGLGQT 120

Query: 121 TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERY 165
           T DGRFTLLP CCLGNCDK P +MID+DTH  + P+ + +LLE Y
Sbjct: 121 TADGRFTLLPVCCLGNCDKAPALMIDDDTHGDVRPDGVAKLLEAY 165


>NUOE_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 162

 Score =  224 bits (570), Expect = 5e-61
 Identities = 111/155 (71%), Positives = 129/155 (83%)

Query: 12  FELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEG 71
           F+L+  E  AIE++K +YED RA SIEALKIVQK+RGWV D AIYAIA++L I  SDVEG
Sbjct: 8   FKLTNEEINAIENQKKYYEDFRAISIEALKIVQKKRGWVSDQAIYAIAEILHINPSDVEG 67

Query: 72  VATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPT 131
           VATFYSQIFR+PVGR++IRYCDSVVC +TGY+ IQ ALE  L IK G+TT D RFTLLP 
Sbjct: 68  VATFYSQIFRKPVGRNIIRYCDSVVCFLTGYKRIQIALENYLKIKIGETTKDDRFTLLPV 127

Query: 132 CCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           CCLGNCDKGP +MI+EDT+S LTPE+IP LLE YK
Sbjct: 128 CCLGNCDKGPTIMINEDTYSVLTPESIPSLLESYK 162


>NUOE_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 168

 Score =  191 bits (485), Expect = 4e-51
 Identities = 95/155 (61%), Positives = 112/155 (72%)

Query: 12  FELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEG 71
           F L+  E   IE +K +YE+ R+ SIEALKIVQK+RGWV D              S+VE 
Sbjct: 14  FTLTTFEINEIEKQKKYYENSRSVSIEALKIVQKKRGWVCDQXXXXXXXXXXXXPSEVES 73

Query: 72  VATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPT 131
           VATFYSQI+RQPVGR+VIRYCDSVVC++TGY+ I+  LE  L IK G TT DGRFTLLP 
Sbjct: 74  VATFYSQIYRQPVGRNVIRYCDSVVCYLTGYEKIKKFLEDYLFIKIGNTTVDGRFTLLPV 133

Query: 132 CCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           CCLGNCDK P +MI+ED +SHL P+ IP LLE YK
Sbjct: 134 CCLGNCDKAPTIMINEDLYSHLNPDLIPNLLELYK 168


>NUOE_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 171

 Score =  163 bits (413), Expect = 9e-43
 Identities = 77/155 (49%), Positives = 111/155 (71%)

Query: 12  FELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEG 71
           F+L+  E+  I +   +Y   R++ IE LK VQK  GW+ +  I  +A +L I   D+E 
Sbjct: 17  FKLTIQEKIEIFNIIKNYRTVRSSLIEILKFVQKSYGWISNELITELACILKISKCDIEE 76

Query: 72  VATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPT 131
           +ATFYSQIFRQP+GR++I+YCDSVVC++ G + I+ +LEKNLN+  G+TT D +FTLLP 
Sbjct: 77  IATFYSQIFRQPIGRNIIKYCDSVVCYVNGCEKIRCSLEKNLNVNVGETTKDFKFTLLPI 136

Query: 132 CCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
           CCLGNCDK P +MI++D +S++T  ++  LLE Y+
Sbjct: 137 CCLGNCDKSPTIMINDDLYSNVTEYSVIVLLESYQ 171


>NUOE2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E 2;
          Length = 168

 Score =  107 bits (267), Expect = 7e-26
 Identities = 55/148 (37%), Positives = 82/148 (55%)

Query: 19  REAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQ 78
           RE IE     Y D R+A + AL I QK+ G +P   +  +A +LG+    V  +ATFY+ 
Sbjct: 4   REEIEAAAARYPDRRSAIMPALMIAQKEHGHLPGPVLEEVAQILGVERVWVYELATFYTL 63

Query: 79  IFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCD 138
              +P+GR  ++ CD+V C + G + +   LE  L I+ G+TT DG FTL    CLG C+
Sbjct: 64  FHTEPIGRFHLQLCDNVSCMLCGSEALLTHLETTLGIRKGETTPDGAFTLSTVECLGACE 123

Query: 139 KGPNMMIDEDTHSHLTPEAIPELLERYK 166
             P M + +D H +L    +  LLE ++
Sbjct: 124 MAPVMQVGDDYHGNLDAARLDALLESFR 151


>NUOE_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 160

 Score =  106 bits (265), Expect = 1e-25
 Identities = 51/154 (33%), Positives = 85/154 (55%)

Query: 12  FELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEG 71
           FE     +  ++   +++   R A +  L  +Q   G++P  ++  +AD+L +P + VEG
Sbjct: 6   FEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIPPESLKPLADMLELPLNHVEG 65

Query: 72  VATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPT 131
           V  FY    R+   ++ IR C S+VCH+ G   +  ALE  L IKPG+ T DG+F ++P 
Sbjct: 66  VVAFYDMFDREDKAKYRIRVCVSIVCHLMGTNKLLKALENILGIKPGEVTPDGKFKIVPV 125

Query: 132 CCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERY 165
            CLG C + P  M+++D +   +   + E+L RY
Sbjct: 126 QCLGACSEAPVFMVNDDEYKFESEVQLNEILSRY 159


>NDUV2_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;
          Length = 239

 Score =  105 bits (261), Expect = 4e-25
 Identities = 55/157 (35%), Positives = 86/157 (54%), Gaps = 2/157 (1%)

Query: 12  FELSAAEREAIEHEKHHYEDPRAAS--IEALKIVQKQRGWVPDGAIYAIADVLGIPASDV 69
           F+ ++  +E I+     Y +   A   I  L + Q+Q GW+P  A++ +A +L +P    
Sbjct: 42  FKFTSENQERIKAIMDIYPEGHKAGALIPLLDLAQRQHGWLPISAMHEVAKILEVPRMRA 101

Query: 70  EGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLL 129
             VATFY+   RQPVG++ ++ C +  C + G + I   +EK L I  G+TT DG FTL 
Sbjct: 102 YEVATFYTMFNRQPVGKYFLQVCATTPCMLRGAETITETIEKKLGIHAGETTKDGLFTLA 161

Query: 130 PTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
              CLG C   P + I++D    LTP+ + E+L+  K
Sbjct: 162 EVECLGACVNAPMIQINDDYFEDLTPKDVNEILDDLK 198


>NDUV2_RAT RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 248

 Score =  103 bits (257), Expect = 1e-24
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 12  FELSAAEREAIEHEKHHY-EDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDV 69
           F+ +    E IE    +Y E  RAA++   L + Q+Q GW+P  A+  +A+VL +P   V
Sbjct: 52  FDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRV 111

Query: 70  EGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLL 129
             VATFY+   R+PVG++ I+ C +  C +     I   L++ L IK G+TT D  FTL+
Sbjct: 112 YEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLI 171

Query: 130 PTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
              CLG C   P + I++D +  LTP+ I E+++  +
Sbjct: 172 EVECLGACVNAPMVQINDDYYEDLTPKDIEEIIDELR 208


>NDUV2_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 249

 Score =  102 bits (255), Expect = 2e-24
 Identities = 52/142 (36%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 26  KHHYEDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPV 84
           K++ E  +AA++   L + Q+Q GW+P  A+  +A++L +P   V  VATFY+   R+PV
Sbjct: 68  KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPV 127

Query: 85  GRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           G++ I+ C +  C +     I  A++K L IK G+TT D  FTL+   CLG C   P + 
Sbjct: 128 GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ 187

Query: 145 IDEDTHSHLTPEAIPELLERYK 166
           I+++ +  LTP+ I E+++  K
Sbjct: 188 INDNYYEDLTPKDIEEIIDELK 209


>NDUV2_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 248

 Score =  100 bits (249), Expect = 9e-24
 Identities = 50/133 (37%), Positives = 78/133 (58%)

Query: 34  AASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCD 93
           AA +  L + Q+Q GW+P  A+  +A+VL +P   V  VATFY+   R+PVG++ I+ C 
Sbjct: 76  AAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCT 135

Query: 94  SVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHL 153
           +  C +     I   L++ L IK G+TT D  FTL+   CLG C   P + I+++ +  L
Sbjct: 136 TTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDL 195

Query: 154 TPEAIPELLERYK 166
           TP+ I E+++  K
Sbjct: 196 TPKDIEEIIDELK 208


>NDUV2_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 249

 Score =  100 bits (248), Expect = 1e-23
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 26  KHHYEDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPV 84
           K++ E  +AA++   L + Q+Q GW+P  A+  +A+VL +P   V  VATFY+   R+PV
Sbjct: 68  KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPV 127

Query: 85  GRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           G++ I+ C +  C +     I  A++K L IK G+TT D  FTL+   CLG C   P + 
Sbjct: 128 GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ 187

Query: 145 IDEDTHSHLTPEAIPELLERYK 166
           I+++ +  LT + I E+++  K
Sbjct: 188 INDNYYEDLTAKDIEEIIDELK 209


>NDUV2_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 249

 Score =  100 bits (248), Expect = 1e-23
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 26  KHHYEDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPV 84
           K++ E  +AA++   L + Q+Q GW+P  A+  +A+VL +P   V  VATFY+   R+PV
Sbjct: 68  KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPV 127

Query: 85  GRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           G++ I+ C +  C +     I  A++K L IK G+TT D  FTL+   CLG C   P + 
Sbjct: 128 GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ 187

Query: 145 IDEDTHSHLTPEAIPELLERYK 166
           I+++ +  LT + I E+++  K
Sbjct: 188 INDNYYEDLTAKDIEEIIDELK 209


>NDUV2_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 249

 Score =  100 bits (248), Expect = 1e-23
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 26  KHHYEDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPV 84
           K++ E  +AA++   L + Q+Q GW+P  A+  +A+VL +P   V  VATFY+   R+PV
Sbjct: 68  KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPV 127

Query: 85  GRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           G++ I+ C +  C +     I  A++K L IK G+TT D  FTL+   CLG C   P + 
Sbjct: 128 GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ 187

Query: 145 IDEDTHSHLTPEAIPELLERYK 166
           I+++ +  LT + I E+++  K
Sbjct: 188 INDNYYEDLTAKDIEEIIDELK 209


>NDUV2_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;AltName: Full=NADH-ubiquinone
           oxidoreductase 24 kDa subunit;
          Length = 249

 Score =  100 bits (248), Expect = 1e-23
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 26  KHHYEDPRAASI-EALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPV 84
           K++ E  +AA++   L + Q+Q GW+P  A+  +A+VL +P   V  VATFY+   R+PV
Sbjct: 68  KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPV 127

Query: 85  GRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           G++ I+ C +  C +     I  A++K L IK G+TT D  FTL+   CLG C   P + 
Sbjct: 128 GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ 187

Query: 145 IDEDTHSHLTPEAIPELLERYK 166
           I+++ +  LT + I E+++  K
Sbjct: 188 INDNYYEDLTAKDIEEIIDELK 209


>NUOE_RICBR RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 167

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 25  EKHHYEDPRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQP 83
           +K+  E  R+A +  L + Q+Q G W+P  AI  +A++L +P      VATFY+    +P
Sbjct: 23  KKYPPEGKRSAILPLLDLAQRQNGGWLPVPAIEYVANMLEMPYMRAYEVATFYTMFNLKP 82

Query: 84  VGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNM 143
           VG++ I+ C +  C + G   I    ++ L IK  + T D +F+L+   CLG C   P +
Sbjct: 83  VGKNHIQVCTTTPCWLRGSDDIMKTCKEKLGIKDEEVTKDQKFSLIEIECLGACVNAPVV 142

Query: 144 MIDEDTHSHLTPEAIPELLERYK 166
            I++D +  LTPE +  ++++ +
Sbjct: 143 QINDDYYEDLTPEKMEAIIDKLR 165


>NUOE_RICFE RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 167

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 50/142 (35%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 25  EKHHYEDPRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQP 83
           +K+     R+A +  L + Q+Q G W+P  AI  +A++L +P      VATFYS    + 
Sbjct: 20  KKYPPHGKRSAILPLLDLAQRQNGGWLPVPAIEYVANMLEMPYMRAYEVATFYSMFNLKR 79

Query: 84  VGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNM 143
           VG++ I+ C +  C + G   I    EK L IK  +TT D +FTL    CLG C   P +
Sbjct: 80  VGKYHIQVCTTTPCWLHGSDDIMKICEKKLGIKLKETTEDQKFTLSEIECLGACVNAPVV 139

Query: 144 MIDEDTHSHLTPEAIPELLERY 165
            I++D +  LT E + +L++ Y
Sbjct: 140 QINDDYYEDLTEEKMEKLIDEY 161


>NDUV2_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
           subunit, mitochondrial;         EC=1.6.5.3;       
           EC=1.6.99.3;Flags: Precursor;
          Length = 263

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 53/159 (33%), Positives = 83/159 (52%), Gaps = 4/159 (2%)

Query: 12  FELSAAEREAIEHEKHHY--EDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDV 69
           F+ SA   + IE     Y  +  +AA +  L + Q+Q G+     +  +A +L +P   V
Sbjct: 61  FKFSADNEKVIEEIIKRYPPQYKKAAVMPLLDLGQRQHGFCSISVMNEVARLLEMPPMRV 120

Query: 70  EGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQG--IQAALEKNLNIKPGQTTFDGRFT 127
             VA+FY+   R PVG+  ++ C +  C + G     I  A++++L IK G+TT DG FT
Sbjct: 121 YEVASFYTMYNRTPVGKFHVQACTTTPCQLGGCGSDVIVKAIKEHLGIKQGETTPDGLFT 180

Query: 128 LLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
            +   CLG C   P + I++D    LTPE I ++L   K
Sbjct: 181 FIEVECLGACANAPMVQINDDYFEDLTPETIKQVLSALK 219


>NUOE_RICPR RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 177

 Score = 85.1 bits (209), Expect = 4e-19
 Identities = 48/142 (33%), Positives = 76/142 (53%), Gaps = 1/142 (0%)

Query: 25  EKHHYEDPRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQP 83
           +K+  E  R+A +  L + Q+Q G W+   AI  +A++L +P      VATFY+     P
Sbjct: 25  KKYPPEGKRSAILPLLDLAQRQNGGWLHVSAIEYVANMLEMPYMRAYEVATFYTMFNLNP 84

Query: 84  VGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNM 143
           +G++ I+ C +  C + G   I    EK L IK  +TT D +FTL    CLG C   P +
Sbjct: 85  IGKYHIQVCTTTPCWLRGSDNIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNAPVV 144

Query: 144 MIDEDTHSHLTPEAIPELLERY 165
            I++D +  L    + +L+E+Y
Sbjct: 145 QINDDYYEDLNEAKMEKLIEQY 166


>HOXF_RALEH RecName: Full=NAD-reducing hydrogenase hoxS subunit
           alpha;         EC=1.12.1.2;
          Length = 602

 Score = 85.1 bits (209), Expect = 4e-19
 Identities = 45/138 (32%), Positives = 73/138 (52%)

Query: 29  YEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHV 88
           Y   R   I+ L  VQ + G +PD  +  +   L +   D+   A+FY     +P G++ 
Sbjct: 12  YRSDRTRLIDILWDVQHEYGHIPDAVLPQLGAGLKLSPLDIRETASFYHFFLDKPSGKYR 71

Query: 89  IRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDED 148
           I  C+SV+  I GYQ ++ ALE+   I+ G+T  +G F L  T C+G  D+ P M+ID+ 
Sbjct: 72  IYLCNSVIAKINGYQAVREALERETGIRFGETDPNGMFGLFDTPCIGLSDQEPAMLIDKV 131

Query: 149 THSHLTPEAIPELLERYK 166
             + L P  I +++ + K
Sbjct: 132 VFTRLRPGKITDIIAQLK 149


>NUOE_RICTY RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 170

 Score = 84.3 bits (207), Expect = 7e-19
 Identities = 49/142 (34%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query: 25  EKHHYEDPRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQP 83
           +K+     R+A +  L + Q+Q G W+   AI  +A++L +P      VATFYS     P
Sbjct: 25  KKYPPNGKRSAILPLLDLAQRQNGGWLHISAIEYVANMLEMPYMRAYEVATFYSMFNLSP 84

Query: 84  VGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNM 143
           VG++ I+ C +  C + G   I    EK L IK  +TT D +FTL    CLG C   P +
Sbjct: 85  VGKYHIQVCTTTPCWLRGSDDIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNAPVV 144

Query: 144 MIDEDTHSHLTPEAIPELLERY 165
            I++D +  L    + +L+E+Y
Sbjct: 145 QINDDYYEDLNEAKMEKLIEQY 166


>NUOE_RICCN RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 167

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 1/141 (0%)

Query: 25  EKHHYEDPRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQP 83
           +K+     R+A +  L + Q+Q G W+P  AI  +A++L +P      VATFY+    + 
Sbjct: 23  KKYPPHGKRSAILPLLDLAQRQNGGWLPVPAIEYVANMLAMPYIRAYEVATFYTMFNLKR 82

Query: 84  VGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNM 143
           VG++ I+ C +  C + G   I    EK L +K  +TT D +FTL    CLG C   P +
Sbjct: 83  VGKYHIQVCTTTPCWLRGSDDIMKICEKKLGVKLKETTEDQKFTLSEIECLGACVNAPVV 142

Query: 144 MIDEDTHSHLTPEAIPELLER 164
            I++D +  LT + + +++++
Sbjct: 143 QINDDYYEDLTQDKMGKIIDK 163


>NUOE1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E 1;
          Length = 275

 Score = 80.9 bits (198), Expect = 7e-18
 Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 1/162 (0%)

Query: 6   QPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIP 65
           QP   AF    A       +K+     ++A I  L   Q+Q GWV   AI ++AD+LG+ 
Sbjct: 12  QPAAFAFSKENAAWAEATIKKYPEGREQSAVIPLLMRAQEQDGWVTRAAIESVADMLGMA 71

Query: 66  ASDVEGVATFYSQIFRQPVG-RHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDG 124
              V  VATFY+Q   QPVG R  ++ C +  C + G + +    +K +  +P      G
Sbjct: 72  YIRVLEVATFYTQFQLQPVGTRAHVQVCGTTPCMLRGAEDLIKICKKKIASEPFTLNEGG 131

Query: 125 RFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK 166
             +     C G C   P +MI +DT   LTPE + E+++R++
Sbjct: 132 TLSWEEVECQGACVNAPMVMIFKDTFEDLTPERLEEIIDRFE 173


>NUOE_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 252

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 41/135 (30%), Positives = 73/135 (54%)

Query: 29  YEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHV 88
           Y D R+A +  L +VQ +  ++    +   AD LG+  ++V  VA+FY+   R+P G ++
Sbjct: 51  YPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTMYRRRPTGEYL 110

Query: 89  IRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDED 148
           +  C + +C + G   I   L+++L +   +TT DG  TL    C   CD  P +M++ +
Sbjct: 111 VGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYAPVVMVNWE 170

Query: 149 THSHLTPEAIPELLE 163
              + TPE+  EL++
Sbjct: 171 FFDNQTPESARELVD 185


>NUOE_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit E;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit E;AltName: Full=NDH-1 subunit E;
          Length = 252

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 41/135 (30%), Positives = 73/135 (54%)

Query: 29  YEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHV 88
           Y D R+A +  L +VQ +  ++    +   AD LG+  ++V  VA+FY+   R+P G ++
Sbjct: 51  YPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTMYRRRPTGEYL 110

Query: 89  IRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDED 148
           +  C + +C + G   I   L+++L +   +TT DG  TL    C   CD  P +M++ +
Sbjct: 111 VGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYAPVVMVNWE 170

Query: 149 THSHLTPEAIPELLE 163
              + TPE+  EL++
Sbjct: 171 FFDNQTPESARELVD 185


>NQO2_PARDE RecName: Full=NADH-quinone oxidoreductase chain 2;      
             EC=1.6.99.5;AltName: Full=NADH dehydrogenase I, chain
           2;AltName: Full=NDH-1, chain 2;
          Length = 239

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 52/161 (32%), Positives = 78/161 (48%), Gaps = 3/161 (1%)

Query: 8   QTEAFELSAAEREAIEHEKHHYEDPR--AASIEALKIVQKQRGWVPDGAIYAIADVLGIP 65
           Q ++FE + A  E    +   Y + R  +A I  L   Q+Q GW+   AI   AD+LG+P
Sbjct: 9   QPDSFEFTPANLEWARAQMTKYPEGRQQSAIIPVLWRAQEQEGWLSRPAIEYCADLLGMP 68

Query: 66  ASDVEGVATFYSQIFRQPVGRHV-IRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDG 124
                 VATFY     QPVG    I+ C +  C I G + +    ++ +  +P   + DG
Sbjct: 69  YIRALEVATFYFMFQLQPVGSVAHIQICGTTTCMICGAEDLIRVCKEKIAPEPHALSADG 128

Query: 125 RFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERY 165
           RF+     CLG C   P   I +D +  LT E +  L++R+
Sbjct: 129 RFSWEEVECLGACTNAPMAQIGKDFYEDLTVEKLAALIDRF 169


>NQO2_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 2;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I chain
           2;AltName: Full=NDH-1 subunit 2;
          Length = 181

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 40/125 (32%), Positives = 71/125 (56%)

Query: 26  KHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVG 85
           K+  E  RAA +  L+ VQ++ GW+    I  IA ++G   ++V GVA+FYS     P G
Sbjct: 17  KYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTG 76

Query: 86  RHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMI 145
           ++ ++ C ++ C + G + +   L + L I PG+ T DG F++    CLG+C   P + +
Sbjct: 77  KYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQV 136

Query: 146 DEDTH 150
           +++ +
Sbjct: 137 NDEPY 141


>NDUV2_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
           subunit, mitochondrial;         EC=1.6.5.3;       
           EC=1.6.99.3;Flags: Precursor;
          Length = 255

 Score = 78.2 bits (191), Expect = 5e-17
 Identities = 49/168 (29%), Positives = 87/168 (51%), Gaps = 13/168 (7%)

Query: 12  FELSAAEREAIEHEKHHYED--PRAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASD 68
           +E S A +  ++    +Y     ++A I  L + Q+Q G W+P  A+ A+A V+ +    
Sbjct: 47  WEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLAQQQNGGWLPVSAMNAVAKVIEVAPIR 106

Query: 69  VEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTL 128
           V  VATFYS   R  VG++ +  C +  C I G + I++AL  +L +K G+ T DG F++
Sbjct: 107 VYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRDIESALLDHLGVKRGEVTKDGLFSV 166

Query: 129 LPTCCLGNCDKGPNMMIDEDTH----------SHLTPEAIPELLERYK 166
               C+G C   P + + + ++            +TPE + E++E+ +
Sbjct: 167 GEMECMGCCVNAPMITVADYSNGSEGYTYNYFEDVTPEKVVEIVEKLR 214


>NDUV2_DICDI RecName: Full=NADH dehydrogenase [ubiquinone]
           flavoprotein 2, mitochondrial;         EC=1.6.5.3;      
             EC=1.6.99.3;Flags: Precursor;
          Length = 247

 Score = 77.4 bits (189), Expect = 8e-17
 Identities = 43/135 (31%), Positives = 71/135 (52%), Gaps = 1/135 (0%)

Query: 33  RAASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRY 91
           ++A I  L + Q+Q G W+   A+  +A + GI       VA+FY+   R  +G + ++ 
Sbjct: 75  QSALIPLLDLAQRQNGGWISLRAMDKVAHICGIAPMTAYEVASFYTMFNRTKIGENFVQV 134

Query: 92  CDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHS 151
           C +  C + G   I    + +L I+ G+TT D +FTL+   CLG C   P M I++D + 
Sbjct: 135 CTTTPCMLRGSGEIIKTCKSHLGIQVGETTPDNKFTLVEVECLGACVNAPMMCINDDFYE 194

Query: 152 HLTPEAIPELLERYK 166
            LT  +   LL++ K
Sbjct: 195 DLTSASTINLLDQIK 209


>NDUV2_SCHPO RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
           subunit homolog C11E3.12, mitochondrial;       
           EC=1.6.-.-;Flags: Precursor;
          Length = 162

 Score = 54.3 bits (129), Expect = 7e-10
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 23/140 (16%)

Query: 34  AASIEALKIVQKQRG-WVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYC 92
           AA +  L + Q+Q G W+P  A+Y IA + G+    V  +   Y   F     +  +R C
Sbjct: 29  AALVPLLDLAQRQHGTWIPPTAMYEIASLAGVSIDYVHSLILAYPNDFFWRPKKPRVRIC 88

Query: 93  DSVVCHITGYQGIQAALEKNLNIKPGQTTFDGR---------FTLLPTCCLGNCDKGPNM 143
           +S +C        QAA E+      G + +D +         F +  T CLGNC +GP M
Sbjct: 89  NSWMCQ-------QAAEEQ------GNSNWDSQCRSVATKYGFDVENTGCLGNCFQGPAM 135

Query: 144 MIDEDTHSHLTPEAIPELLE 163
            I++  +   T E + +++E
Sbjct: 136 WINDKIYGVNTKEKLVDIME 155


>Y1420_THEMA RecName: Full=Protein TM_1420;
          Length = 75

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 88  VIRYCDSVVCHITG-YQGIQA--ALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMM 144
           ++R C    CH+ G Y+ ++    L+K  N K           L  + C GNC +G  + 
Sbjct: 2   IVRVCMGSSCHLKGSYEVVRRFQELQKKYNFK-----------LYGSLCFGNCSQGVCVE 50

Query: 145 IDEDTHSHLTPEAIPELLER 164
           ID    S +TPE   E+L++
Sbjct: 51  IDGRLFSRVTPENAEEILKK 70


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,109,066,220
Number of extensions: 402245964
Number of successful extensions: 995641
Number of sequences better than 1.0e-03: 19344
Number of HSP's gapped: 973047
Number of HSP's successfully gapped: 23944
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)