# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26722.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF65854.1  [L=364]
Description: sent8 ACF65854.1 GIB00763CH01 "inner membrane ABC transporter permease protein .."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.4e-40  139.8  13.5    4.4e-40  139.8   9.4    1.8  1  PF00528  Binding-protein-dependent transport system inner me
  ------ inclusion threshold ------
       0.07   14.9   2.1       0.15   13.9   1.5    1.5  1  PF00002  7 transmembrane receptor (Secretin family)
       0.62   12.0   0.3       0.62   12.0   0.2    2.0  1  PF12534  Leucine-rich repeat containing protein 8
        3.6    8.9   3.4        1.2   10.5   0.4    1.7  1  PF00854  POT family
         30    6.8   0.0         53    6.0   0.0    1.3  1  PF09216  Pfg27
         42    6.2   0.1      1e+02    4.9   0.1    1.7  1  PF03578  HGWP repeat
         44    6.1   0.1         76    5.3   0.0    1.3  1  PF00566  TBC domain
         45    5.4   1.5         93    4.4   1.1    1.5  1  PF02949  7tm Odorant receptor
         51    5.7   0.0         78    5.1   0.0    1.2  1  PF06992  Replication protein P
         53    6.5   0.0      2e+02    4.7   0.0    1.9  1  PF12564  Type III restriction/modification enzyme methylatio
         75    5.9   0.0    1.7e+02    4.7   0.0    1.5  1  PF11446  Protein of unknown function (DUF2897)
         90    5.6   0.0    1.8e+02    4.6   0.0    1.4  1  PF06526  Protein of unknown function (DUF1107)
      1e+02    4.9   0.6    1.9e+02    4.0   0.4    1.4  1  PF04757  Pex2 / Pex12 amino terminal region
    1.1e+02    5.3   0.0    2.2e+02    4.3   0.0    1.4  1  PF08809  Phage related hypothetical protein (DUF1799)
    1.6e+02    4.1  25.3       0.22   13.5   5.3    2.7  2  PF02687  Predicted permease
    1.9e+02    4.2   4.3    1.9e+02    4.2   0.6    2.8  1  PF11293  Protein of unknown function (DUF3094)
    3.4e+02    3.8   0.0    7.3e+02    2.7   0.0    1.5  1  PF00624  Flocculin repeat
    3.7e+02    2.7   0.0    5.7e+02    2.1   0.0    1.2  1  PF09562  LlaMI restriction endonuclease
    4.4e+02    3.2   5.8         97    5.3   0.9    2.3  1  PF08054  Leucine operon leader peptide
    4.4e+02    3.8   0.1    1.3e+03    2.3   0.1    1.7  1  PF07646  Kelch motif
    5.4e+02    2.9   0.1    1.1e+03    1.9   0.1    1.5  1  PF07358  Protein of unknown function (DUF1482)
    6.2e+02    2.0   0.1      1e+03    1.3   0.1    1.2  1  PF08045  Cell division control protein 14, SIN component
    6.8e+02    2.9   0.5    1.8e+03    1.6   0.3    1.6  1  PF12121  Dermaseptin
    7.4e+02    2.2   0.1    1.1e+03    1.7   0.0    1.1  1  PF08657  DASH complex subunit Spc34
      1e+03    2.4   0.2    1.7e+03    1.7   0.1    1.3  1  PF08186  Wound-inducible basic protein family
    1.8e+03    1.4   7.1    3.9e+02    3.5   1.1    2.3  1  PF11023  Protein of unknown function (DUF2614)


Domain and alignment annotation for each model:
>> PF00528  Binding-protein-dependent transport system inner membrane component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.8   9.4   1.1e-43   4.4e-40       2     183 ..     152     359 ..     151     361 .. 0.99

  Alignments for each domain:
  == domain 1    score: 139.8 bits;  conditional E-value: 1.1e-43
     PF00528   2 illGilaalnrnkkldkllrpliivlsslPsfvlaillvlvf..........................vilsilghlilpviillllsaapyvrlirra 74 
                 i+lGi  a++ ++++d +++ +ii+++++P f++aill+++f                          +i ++l+h  lpv+++++ ++a++++l+ ++
  ACF65854.1 152 IPLGIRKAVHNGSRFDVWSSAFIIIGYAIPAFLFAILLIVFFaggsyydifplrglvsanfdtlpwyqKITDYLWHITLPVLATVIGGFAALTMLTKNS 250
                 89*************************************999********************************************************* PP

     PF00528  75 alrslpkdlveaaralGasrwqifrkvvlPnalppiitglilafggl.lggavlleflgswpGlgtllleailgydyseisnggvlalviavlllnlva 172
                 +l+++ k++v +ara+G+s++ i++k+v++na+  +i+g++ +f+++ ++g++l+e ++s +Glg+l  ea+ ++dy+ +  g++++++++ llln+++
  ACF65854.1 251 FLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMfFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMF-GTLYIFTLIGLLLNILS 348
                 ***********************************************99********************************.***************** PP

     PF00528 173 dilqrlldprv 183
                 di ++l+dpr+
  ACF65854.1 349 DISYTLVDPRI 359
                 **********8 PP

>> PF00002  7 transmembrane receptor (Secretin family)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.9   1.5   3.8e-05      0.15     113     220 ..     171     301 ..     159     314 .. 0.70

  Alignments for each domain:
  == domain 1    score: 13.9 bits;  conditional E-value: 3.8e-05
                 ----------------------....-----............---.-----------------------------.---------------------- CS
     PF00002 113 kvylliGwgvPavvvvvwaivr...kagyen............ekc.WlsnekkllwiikgpvlviilvNfvllin.ilrvlvqklrsketsekekkrk 194
                   +++iG+++Pa + ++ +iv      +y++            ++  W ++ +++lw i  pvl++++  f  l++ + +  +  +r++ + +++ k  
  ACF65854.1 171 SAFIIIGYAIPAFLFAILLIVFfagG-SYYDifplrglvsanfDTLpWYQKITDYLWHITLPVLATVIGGFAALTMlTKNSFLDEVRKQYVVTARAKGV 268
                 579*********99998888877764.44445999999999998888****99***********99988776554404445555666555444444433 PP

                 .......-------------------------- CS
     PF00002 195 .......klvkstlvllpLLGityvlflfapee 220
                        k v    +ll++ G   +++ ++++ 
  ACF65854.1 269 seknilwKHVFRNAMLLVIAGFPATFISMFFTG 301
                 555666656666666666666666665555554 PP

>> PF12534  Leucine-rich repeat containing protein 8
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   0.2   0.00016      0.62      21      50 ..     215     249 ..     212     253 .. 0.72

  Alignments for each domain:
  == domain 1    score: 12.0 bits;  conditional E-value: 0.00016
     PF12534  21 kPWwdvffdYLv.....llmllvavlagtlqltqd 50 
                 +PW+++ +dYL      +l ++++ +a +  lt++
  ACF65854.1 215 LPWYQKITDYLWhitlpVLATVIGGFAALTMLTKN 249
                 8*********9733333566777777777777665 PP

>> PF00854  POT family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.4   0.00031       1.2     103     133 ..     176     205 ..     158     219 .. 0.85

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.00031
     PF00854 103 laFgipailmilallvFllGsrvykkkappk 133
                 +++ ipa+l+++ l+vF++G + y  + p +
  ACF65854.1 176 IGYAIPAFLFAILLIVFFAGGSYYDIF-PLR 205
                 69******************9988766.555 PP

>> PF09216  Pfg27
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.014        53      81     108 ..      86     113 ..      83     119 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.014
     PF09216  81 iserliayvtdkeltedylkklddilkl 108
                 i+e    y +dk l e y+k l d+l  
  ACF65854.1  86 IAEITHRYGFDKPLHERYFKMLRDYLSF 113
                 556667799****************976 PP

>> PF03578  HGWP repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.027     1e+02      14      22 ..     226     234 ..     224     244 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.027
     PF03578  14 WpimPPllG 22 
                 W+i++P+l 
  ACF65854.1 226 WHITLPVLA 234
                 *******94 PP

>> PF00566  TBC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.02        76     149     191 ..     105     146 ..      90     159 .. 0.76

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.02
     PF00566 149 pelykhlekeeldlslfaikwfltlfarelpletvlrlwDlll 191
                 + l ++l + + + slf +  +ltl   +lp++++l lw +l+
  ACF65854.1 105 KMLRDYL-SFDFNDSLFRSASVLTLIKDSLPVSITLGLWSTLI 146
                 3344444.4589999************************8443 PP

>> PF02949  7tm Odorant receptor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   1.1     0.024        93     190     237 ..     294     339 ..     268     353 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.024
     PF02949 190 aindlisaallvqfllsalvlclllfqltffsgenvqaitvvlYllaa 237
                  i+ +++++ll++++ s   l+ll++++t+  + +v + t  ++  ++
  ACF65854.1 294 FISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIF--TL 339
                 5788999**********************888844444333333..33 PP

>> PF06992  Replication protein P
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0      0.02        78      27      81 ..     212     270 ..     206     281 .. 0.66

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.02
     PF06992  27 ydekpqvqqvaqiingvfsqllat....fpaslanrdqnelneirrqwvlafrengits 81 
                 +d  p  q++++ +  +   +lat    f a      +  l+e+r+q+v++ r +g++ 
  ACF65854.1 212 FDTLPWYQKITDYLWHITLPVLATviggFAALTMLTKNSFLDEVRKQYVVTARAKGVSE 270
                 56666666666555554444455411115544444555669*************99975 PP

>> PF12564  Type III restriction/modification enzyme methylation subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.052     2e+02      14      33 ..      98     117 ..      94     123 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.052
     PF12564  14 kikkrFfkkidgiliFkink 33 
                  +++r+fk++ ++l F++n+
  ACF65854.1  98 PLHERYFKMLRDYLSFDFND 117
                 589**************986 PP

>> PF11446  Protein of unknown function (DUF2897)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.045   1.7e+02       4      23 ..     224     243 ..     222     248 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.045
     PF11446   4 evwlIiilVlGvIvgNLavL 23 
                 + w I++ Vl+ ++g+ a+L
  ACF65854.1 224 YLWHITLPVLATVIGGFAAL 243
                 5799**************99 PP

>> PF06526  Protein of unknown function (DUF1107)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.047   1.8e+02      13      27 ..     292     306 ..     291     314 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.047
     PF06526  13 AkyvktlFkGrlyik 27 
                 A +++ +F G+l i+
  ACF65854.1 292 ATFISMFFTGSLLIE 306
                 78***********98 PP

>> PF04757  Pex2 / Pex12 amino terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.4     0.049   1.9e+02     140     164 ..     178     202 ..     170     205 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.049
     PF04757 140 saalealslvnlllFLlegtyysll 164
                 +a+ ++l+++ l++F  +g+yy+++
  ACF65854.1 178 YAIPAFLFAILLIVFFAGGSYYDIF 202
                 567789****************987 PP

>> PF08809  Phage related hypothetical protein (DUF1799)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.057   2.2e+02      44      73 ..      79     108 ..      75     109 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.057
     PF08809  44 tGLDysaleavlrllgikkeerdevfdalr 73 
                  GLD ++++++ +++g++k  +++ f+ lr
  ACF65854.1  79 RGLDPEVIAEITHRYGFDKPLHERYFKMLR 108
                 69*****************99999998876 PP

>> PF02687  Predicted permease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   6.0      0.53     2e+03     105     172 ..     172     248 ..     165     251 .. 0.76
   2 ?   13.5   5.3   5.6e-05      0.22      50     158 ..     226     344 ..     201     348 .. 0.65

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.53
     PF02687 105 alli...gliglllG.lllglllaqllsqallk.....fsssslpisldpisillllllilliallasllparrilk 172
                 a++i   +++++l + ll+ ++++   ++++        +++ lp +  + ++l+ + l +l+++++++++  +++k
  ACF65854.1 172 AFIIigyAIPAFLFAiLLIVFFAGGSYYDIFPLrglvsANFDTLPWYQKITDYLWHITLPVLATVIGGFAALTMLTK 248
                 44445557777777766666666666666555599999999*************************99999888777 PP

  == domain 2    score: 13.5 bits;  conditional E-value: 5.6e-05
     PF02687  50 iillllllsvlilllavlilllllsisirerrkeigilkalGaskkqifkqlllealligliglllG.lllglllaqllsqallk...........fss 136
                 +  +l +l+ +i+ +a+l +l   s++   r++ + + +a G+s k i++  +  ++++ +i+++ + ++  +++++ll  ++++           + s
  ACF65854.1 226 WHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPAtFISMFFTGSLLIEVMFSlnglgllgyeaTVS 324
                 4445555555555555555554444444499*******************9999999999999999989999999999999999988888655543333 PP

     PF02687 137 sslpisldpisillllllilli 158
                  + p+ + +++i++l  ++ll+
  ACF65854.1 325 RDYPVMFGTLYIFTL--IGLLL 344
                 333333333333333..33333 PP

>> PF11293  Protein of unknown function (DUF3094)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.6     0.048   1.9e+02      38      55 .]     133     150 ..     119     150 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.048
     PF11293  38 lAvvigLGLlsRllsrLa 55 
                 l v i LGL s l+ +L+
  ACF65854.1 133 LPVSITLGLWSTLIIYLV 150
                 789***********9997 PP

>> PF00624  Flocculin repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.19   7.3e+02      30      43 ..     140     153 ..     137     154 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.19
     PF00624  30 GneTTeTIYyVeTP 43 
                 G   T +IY+V +P
  ACF65854.1 140 GLWSTLIIYLVSIP 153
                 7889*******999 PP

>> PF09562  LlaMI restriction endonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.15   5.7e+02     173     202 ..      89     118 ..      82     142 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.15
     PF09562 173 lakwygvernllskkgkalkdkledkfndk 202
                 +++ yg++++l  +  k l+d l+  fnd 
  ACF65854.1  89 ITHRYGFDKPLHERYFKMLRDYLSFDFNDS 118
                 7789************************96 PP

>> PF08054  Leucine operon leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.9     0.025        97       2      14 ..     334     345 ..     333     347 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.025
     PF08054   2 lHivRflglLLLN 14 
                 l+i +++g LLLN
  ACF65854.1 334 LYIFTLIG-LLLN 345
                 79******.9998 PP

>> PF07646  Kelch motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.34   1.3e+03      14      37 ..     191     214 ..     190     218 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.34
     PF07646  14 iyvvGGahtdngllsssdlnvldp 37 
                 ++  GG+++d ++l+  +   +d+
  ACF65854.1 191 VFFAGGSYYDIFPLRGLVSANFDT 214
                 6889***********999988886 PP

>> PF07358  Protein of unknown function (DUF1482)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.28   1.1e+03       1      18 [.     184     201 ..     184     203 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.28
     PF07358   1 lfALvLtVclldGesqdi 18 
                 lfA++L V++  G + di
  ACF65854.1 184 LFAILLIVFFAGGSYYDI 201
                 6************99998 PP

>> PF08045  Cell division control protein 14, SIN component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1      0.26     1e+03     138     171 ..     124     157 ..     118     161 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.26
     PF08045 138 llldLlepanksaiqvalistLvhiLlkspkntr 171
                  +l L++++ +++i+  l stL+  L+  p  +r
  ACF65854.1 124 SVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIR 157
                 5899**********************98887776 PP

>> PF12121  Dermaseptin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.3      0.46   1.8e+03       1       6 [.     140     145 ..     140     145 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.46
                 ----ST CS
     PF12121   1 GLWstI 6  
                 GLWst+
  ACF65854.1 140 GLWSTL 145
                 9****7 PP

>> PF08657  DASH complex subunit Spc34
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.28   1.1e+03      26      43 ..     115     132 ..     114     139 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.28
     PF08657  26 FtNAllkspdItaLIrDt 43 
                 F ++l +s+++ +LI+D+
  ACF65854.1 115 FNDSLFRSASVLTLIKDS 132
                 999**************7 PP

>> PF08186  Wound-inducible basic protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.1      0.45   1.7e+03       3      12 ..     113     122 ..     111     124 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.45
     PF08186   3 YdvnsaLfRs 12 
                 +d n  LfRs
  ACF65854.1 113 FDFNDSLFRS 122
                 9********9 PP

>> PF11023  Protein of unknown function (DUF2614)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   1.1       0.1   3.9e+02      14      47 ..     281     314 ..     270     325 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.1
     PF11023  14 falslvfvgllvmyvgilfkeseiilvillllgl 47 
                  a+ lv++g+   ++ ++f  s +i v++ l gl
  ACF65854.1 281 NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGL 314
                 599*******************999999988765 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (364 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       405  (0.0339993); expected 238.2 (0.02)
Passed bias filter:                      225  (0.0188885); expected 238.2 (0.02)
Passed Vit filter:                        28  (0.00235057); expected 11.9 (0.001)
Passed Fwd filter:                        28  (0.00235057); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              26  [number of targets reported over threshold]
# CPU time: 0.25u 0.05s 00:00:00.30 Elapsed: 00:00:00
# Mc/sec: 3143.36
//