# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26702.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF65952.1  [L=87]
Description: sent8 ACF65952.1 GIB00763CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
      0.084   15.4   0.0       0.12   14.9   0.0    1.2  1  PF08700  Vps51/Vps67
       0.36   13.3   0.0       0.57   12.7   0.0    1.3  1  PF08845  HSP20-like domain of unknown function (DUF1813)
          3   10.2   0.0        3.1   10.1   0.0    1.1  1  PF05728  Uncharacterised protein family (UPF0227)
          4   10.1   0.0         10    8.7   0.0    1.7  1  PF09036  Bcr-Abl oncoprotein oligomerisation domain
        4.3    7.7   0.0          5    7.5   0.0    1.1  1  PF10168  Nuclear pore component
        7.2    8.9   0.1         15    7.9   0.0    1.5  1  PF08277  PAN-like domain
        7.5    9.0   0.0         11    8.5   0.0    1.2  1  PF10805  Protein of unknown function (DUF2730)
        7.6    8.9   0.1        9.5    8.6   0.1    1.1  1  PF02637  GatB domain
        8.6    8.9   0.3         13    8.4   0.2    1.3  1  PF05377  Flagella accessory protein C (FlaC)
        9.1    8.8   0.1         13    8.3   0.1    1.2  1  PF06193  Orthopoxvirus A5L protein-like
         11    9.0   0.0         12    8.8   0.0    1.2  1  PF04880  NUDE protein, C-terminal conserved region
         12    7.9   0.0         14    7.6   0.0    1.1  1  PF10368  Putative cell-wall binding lipoprotein
         13    8.0   0.3         16    7.7   0.2    1.1  1  PF01050  Mannose-6-phosphate isomerase
         14    7.9   0.0         15    7.8   0.0    1.1  1  PF05729  NACHT domain
         23    6.9   1.2         27    6.7   0.2    1.5  1  PF02953  Tim10/DDP family zinc finger
         27    7.9   0.1         33    7.6   0.0    1.3  1  PF02597  ThiS family
         28    6.9   0.1         48    6.2   0.1    1.4  1  PF01160  Vertebrate endogenous opioids neuropeptide
         30    6.9   0.1         37    6.6   0.0    1.2  1  PF05064  Nsp1-like C-terminal region
         30    7.0   0.1         37    6.8   0.1    1.2  1  PF07889  Protein of unknown function (DUF1664)
         30    6.9   0.1         39    6.6   0.0    1.2  1  PF04740  Bacillus transposase protein
         32    5.6   0.0         30    5.7   0.0    1.0  1  PF05701  Plant protein of unknown function (DUF827)
         34    6.6   0.1         45    6.2   0.1    1.3  1  PF04246  Positive regulator of sigma(E), RseC/MucC
         34    6.3   0.1         41    6.0   0.0    1.1  1  PF11286  Protein of unknown function (DUF3087)
         36    7.2   0.0         47    6.9   0.0    1.2  1  PF10704  Protein of unknown function (DUF2508)
         39    5.7   0.0         33    6.0   0.0    1.1  1  PF03380  Caenorhabditis protein of unknown function, DUF282
         45    6.8   0.1         63    6.3   0.0    1.3  1  PF02256  Iron hydrogenase small subunit
         45    7.1   0.1         73    6.4   0.0    1.3  1  PF06156  Protein of unknown function (DUF972)
         47    6.4   0.0         68    5.9   0.0    1.2  1  PF06596  Photosystem II reaction centre X protein (PsbX)
         53    6.4   0.1         74    6.0   0.0    1.2  1  PF08826  DMPK coiled coil domain like
         59    6.4   1.3         57    6.4   0.0    1.5  1  PF08702  Fibrinogen alpha/beta chain family
         59    5.9   0.1    1.1e+02    5.1   0.0    1.4  1  PF11610  Scaffold protein Ste5-Fus5 binding region
         65    5.5   0.0         95    5.0   0.0    1.3  1  PF11622  Protein of unknown function (DUF3251)
         69    5.4   0.0         75    5.3   0.0    1.1  1  PF02115  RHO protein GDP dissociation inhibitor
         74    5.5   0.6         87    5.3   0.0    1.5  1  PF06951  Group XII secretory phospholipase A2 precursor (PLA
         90    5.2   0.0    1.1e+02    4.9   0.0    1.2  1  PF07258  HCaRG protein
      1e+02    5.2   0.1    1.1e+02    5.1   0.1    1.1  1  PF03233  Aphid transmission protein
      1e+02    5.5   0.1    1.5e+02    5.0   0.1    1.3  1  PF11437  Vanadium-binding protein 2
    1.3e+02    5.3   0.0    1.8e+02    4.9   0.0    1.2  1  PF09440  eIF3 subunit 6 N terminal domain
    1.6e+02    4.3   0.0    2.6e+02    3.6   0.0    1.3  1  PF12023  Domain of unknown function (DUF3511)
    1.7e+02    3.8   0.0    1.8e+02    3.6   0.0    1.1  1  PF07851  TMPIT-like protein
    1.7e+02    4.7   0.0    3.5e+02    3.8   0.0    1.5  1  PF09942  Uncharacterized conserved protein (DUF2174)
      2e+02    4.6   0.1    3.8e+02    3.8   0.1    1.5  1  PF03622  IBV 3B protein
    2.1e+02    3.1   0.1    2.2e+02    3.1   0.0    1.1  1  PF04108  Autophagy protein Apg17
    3.3e+02    2.6   0.0      4e+02    2.3   0.0    1.1  1  PF06273  Plant specific eukaryotic initiation factor 4B
    4.2e+02    3.6   0.0    9.1e+02    2.6   0.0    1.5  1  PF10426  Recombination-activating protein 1 zinc-finger doma


Domain and alignment annotation for each model:
>> PF08700  Vps51/Vps67
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.9   0.0   5.4e-05      0.12      53      84 ..      52      83 ..      51      86 .. 0.93

  Alignments for each domain:
  == domain 1    score: 14.9 bits;  conditional E-value: 5.4e-05
     PF08700 53 LisasdtIrkmkeemeqldpklselkqaieki 84
                Li+ +d++r++++e++q++++++ +k+ ++++
  ACF65952.1 52 LIAETDEVRDLRKELYQVKKSMKHIKAGVNNV 83
                8999**********************999987 PP

>> PF08845  HSP20-like domain of unknown function (DUF1813)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.7   0.0   0.00026      0.57      34      56 ..      31      53 ..      26      54 .. 0.90

  Alignments for each domain:
  == domain 1    score: 12.7 bits;  conditional E-value: 0.00026
     PF08845 34 eqaGFatGqpltisvmagrlvit 56
                e+aGF+tG  + +++++  l++ 
  ACF65952.1 31 EEAGFETGASVVVKISERGLILI 53
                89***************999975 PP

>> PF05728  Uncharacterised protein family (UPF0227)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.1   0.0    0.0014       3.1     124     169 ..      15      81 ..       4      86 .. 0.74

  Alignments for each domain:
  == domain 1    score: 10.1 bits;  conditional E-value: 0.0014
     PF05728 124 kalelsr.....................lkrperilvllskqDevldyrravaefraaaeiveddgd 169
                  ++++ +                     +k  er l+l +  Dev d r+++ + ++ ++ ++++ +
  ACF65952.1  15 TCMTTCYsqipsgdcqeeagfetgasvvVKISERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVN 81 
                 55555555555555555555556666668889999******************99999999998875 PP

>> PF09036  Bcr-Abl oncoprotein oligomerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.0    0.0047        10      22      51 ..      53      82 ..      38      84 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0047
                ----S----HHHHHHHHHHHHHHHHHHHHH CS
     PF09036 22 fmelrsvgdleqelerCkasirrlekevnk 51
                 +e   v+dl +el + k+s++++   vn+
  ACF65952.1 53 IAETDEVRDLRKELYQVKKSMKHIKAGVNN 82
                5678899*****************999995 PP

>> PF10168  Nuclear pore component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0022         5     632     658 ..      57      83 ..      42      86 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0022
     PF10168 632 eserdlkkelqrinkqlrslaaaleqv 658
                 +  rdl+kel +++k +++++a++++v
  ACF65952.1  57 DEVRDLRKELYQVKKSMKHIKAGVNNV 83 
                 5569********************987 PP

>> PF08277  PAN-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.0    0.0067        15      19      32 ..      10      23 ..       2      25 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0067
     PF08277 19 slswedCvskCled 32
                 ++ e+C++ C+++
  ACF65952.1 10 HINSETCMTTCYSQ 23
                6799********85 PP

>> PF10805  Protein of unknown function (DUF2730)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0048        11      64      91 ..      56      83 ..      44      86 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0048
     PF10805 64 akdvhaLkieltelrGelkelsaqiqsl 91
                +++v +L++el +++  +k ++a ++++
  ACF65952.1 56 TDEVRDLRKELYQVKKSMKHIKAGVNNV 83
                689********************99876 PP

>> PF02637  GatB domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.1    0.0043       9.5      71     122 ..      36      85 ..      32      86 .. 0.85

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0043
                 .--------------------.--------------...------------- CS
     PF02637  71 eepgkspeeiieekgLkqisdeeeleklveeviaenpkavedyksgkekalg 122
                 e+ g s+   i+e+gL  i +++e+++l +e  + + k+++ +k+g +++++
  ACF65952.1  36 ET-GASVVVKISERGLILIAETDEVRDLRKELYQVK-KSMKHIKAGVNNVVN 85 
                 55.77888889******************9988877.999999999888775 PP

>> PF05377  Flagella accessory protein C (FlaC)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.2    0.0059        13      16      41 ..      59      84 ..      50      85 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0059
     PF05377 16 vatvrkeleelsksvekikenvkdvl 41
                v  +rkel +++ks  +ik  v +v+
  ACF65952.1 59 VRDLRKELYQVKKSMKHIKAGVNNVV 84
                78899999999999999999999987 PP

>> PF06193  Orthopoxvirus A5L protein-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.1     0.006        13     106     135 ..      56      85 ..      42      86 .. 0.87

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.006
     PF06193 106 snsvqdiikefnsvkkdmkqLqaetndLvt 135
                 + +v d+ ke+ +vkk mk+++a  n+ v+
  ACF65952.1  56 TDEVRDLRKELYQVKKSMKHIKAGVNNVVN 85 
                 56899******************9999885 PP

>> PF04880  NUDE protein, C-terminal conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.0    0.0055        12      24      54 ..      46      74 ..      30      86 .. 0.72

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.0055
     PF04880 24 dEkesLrvevqRLkDEarDLkqEl.ivrerlr 54
                 E++++++      DE+rDL++El  v+  ++
  ACF65952.1 46 SERGLILIAE---TDEVRDLRKELyQVKKSMK 74
                5566655554...6**********66766554 PP

>> PF10368  Putative cell-wall binding lipoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0062        14      51     109 ..      20      77 ..       9      81 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0062
     PF10368  51 lyeqiielnkddneeikklseeavenvekRekllkkEkesiekseeefksakktiekie 109
                  y+qi   ++ + e+  ++   +v ++++R  +l +E + + +  +e+ ++kk++++i+
  ACF65952.1  20 CYSQI-PSGDCQEEAGFETGASVVVKISERGLILIAETDEVRDLRKELYQVKKSMKHIK 77 
                 67777.66666667777788899999*******************************97 PP

>> PF01050  Mannose-6-phosphate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.2    0.0073        16       4      39 ..      40      75 ..      37      85 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0073
     PF01050  4 edlvvvetkdavlvadkdkvqdvkkiveklkaeere 39
                + +v ++++  +l+a++d+v+d++k + ++k++ ++
  ACF65952.1 40 SVVVKISERGLILIAETDEVRDLRKELYQVKKSMKH 75
                55677889999*************999999987765 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0067        15      46      99 ..      12      65 ..       6      83 .. 0.72

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0067
     PF05729 46 srsknarsladlLfsqlpepaapvsevwivllelperlLlilDglDelvsdlgq 99
                + ++ +++   ++ s  ++++a  +++ +v++++ er L+++   De+++  ++
  ACF65952.1 12 NSETCMTTCYSQIPSGDCQEEAGFETGASVVVKISERGLILIAETDEVRDLRKE 65
                554444566667777778888888889********************8765444 PP

>> PF02953  Tim10/DDP family zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.2     0.012        27      21      36 ..      13      28 ..       6      33 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.012
                HHHHHHHH--TTTSSS CS
     PF02953 21 tenCfekCitsypgse 36
                +e+C++ C++++p+++
  ACF65952.1 13 SETCMTTCYSQIPSGD 28
                589*******999886 PP

>> PF02597  ThiS family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0     0.015        33      15      51 ..      50      86 ..      31      87 .] 0.87

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.015
                EEEEC--SBHHHHHHHHHHHTHHHHHCTTTEEEEETT CS
     PF02597 15 elelaegstvaelleaLgerypelaelerrvavavNg 51
                 +++ae + v++l+++L +  +  +  +++v+  vNg
  ACF65952.1 50 LILIAETDEVRDLRKELYQVKKSMKHIKAGVNNVVNG 86
                6788999**********99998888888999999998 PP

>> PF01160  Vertebrate endogenous opioids neuropeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.1     0.022        48      36      55 ..       9      28 ..       3      33 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.022
     PF01160 36 keiNslvCtLECegklssak 55
                ++iNs +C+  C  +++s +
  ACF65952.1  9 RHINSETCMTTCYSQIPSGD 28
                69**********99999865 PP

>> PF05064  Nsp1-like C-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.016        37      51      84 ..      50      83 ..      30      86 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.016
     PF05064 51 rlLvengekiskLysevvkaeqeqnkldqeLdfv 84
                 +L+   +++++L +e ++++++ +++   ++ v
  ACF65952.1 50 LILIAETDEVRDLRKELYQVKKSMKHIKAGVNNV 83
                57999******************99998766655 PP

>> PF07889  Protein of unknown function (DUF1664)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1     0.016        37      86     115 ..      54      83 ..      39      86 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.016
     PF07889  86 eikeevtevredlsnikedvksvqqvvegL 115
                 + ++ev ++r++l ++k+ +k+++  v+++
  ACF65952.1  54 AETDEVRDLRKELYQVKKSMKHIKAGVNNV 83 
                 445778888888888888888877777664 PP

>> PF04740  Bacillus transposase protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.018        39      10      38 ..      57      85 ..      53      87 .] 0.79

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.018
     PF04740 10 eaidqlkkelkelkeqleklkkaitkvae 38
                +++ +l+kel + k+ ++++k+ +++v++
  ACF65952.1 57 DEVRDLRKELYQVKKSMKHIKAGVNNVVN 85
                56778888888888888888888888887 PP

>> PF05701  Plant protein of unknown function (DUF827)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.014        30     255     277 ..      56      78 ..      28      85 .. 0.72

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.014
     PF05701 255 lesvasvlkELeeakanlekate 277
                 ++ v+ ++kEL ++k++++ +++
  ACF65952.1  56 TDEVRDLRKELYQVKKSMKHIKA 78 
                 45566666666666666666554 PP

>> PF04246  Positive regulator of sigma(E), RseC/MucC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.1      0.02        45      45      69 ..      28      52 ..       3      55 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.02
     PF04246 45 evenelglkvGdeVevglpesallk 69
                ++++e+g+++G  V+v+++e+ l+ 
  ACF65952.1 28 DCQEEAGFETGASVVVKISERGLIL 52
                568899**************99975 PP

>> PF11286  Protein of unknown function (DUF3087)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.018        41      82     105 ..      59      82 ..      38      85 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.018
     PF11286  82 vwrLkqllnkiyrklkkikaaakq 105
                 v +L++ l ++ + +k+ika +++
  ACF65952.1  59 VRDLRKELYQVKKSMKHIKAGVNN 82 
                 789****************99875 PP

>> PF10704  Protein of unknown function (DUF2508)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.021        47      16      39 ..      61      84 ..      52      87 .] 0.87

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.021
     PF10704 16 eLleliektkeeweeakkleensv 39
                 L ++++++k+++++ k  ++n+v
  ACF65952.1 61 DLRKELYQVKKSMKHIKAGVNNVV 84
                6889*************9999987 PP

>> PF03380  Caenorhabditis protein of unknown function, DUF282
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.015        33      48      81 ..      15      47 ..       1      79 [. 0.77

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.015
     PF03380 48 tcPlgtvssfdygaateerGanigadqvtitcae 81
                tc ++  s++  g+  ee G ++ga +v     e
  ACF65952.1 15 TCMTTCYSQIPSGDCQEEAGFETGASVVVKI-SE 47
                8999999999999999999999999877543.44 PP

>> PF02256  Iron hydrogenase small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.028        63       2      32 ..      55      84 ..      54      86 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.028
                -HHHHHHHHH------GGGSSS-SGGG-HHH CS
     PF02256  2 akkeilqkRaeaLYkiDkekklrksheNpqv 32
                +++e++  R e LY++ k++k  k   N  v
  ACF65952.1 55 ETDEVRDLRKE-LYQVKKSMKHIKAGVNNVV 84
                57899999988.********98887777665 PP

>> PF06156  Protein of unknown function (DUF972)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.033        73       8      38 ..      57      87 .]      53      87 .] 0.88

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.033
     PF06156  8 dklseleeqleelleeleelkkelaelleen 38
                d++ +l ++l ++ ++++++k+ ++++++ n
  ACF65952.1 57 DEVRDLRKELYQVKKSMKHIKAGVNNVVNGN 87
                789999999************9999998765 PP

>> PF06596  Photosystem II reaction centre X protein (PsbX)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0      0.03        68      14      37 ..      37      60 ..      33      61 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.03
                ---.-----HHHHHHHHHCCS--- CS
     PF06596 14 aGaviVvipiaaaLifvSqkDkvk 37
                 Ga +Vv     +Li++  +D v+
  ACF65952.1 37 TGASVVVKISERGLILIAETDEVR 60
                588788888889*********996 PP

>> PF08826  DMPK coiled coil domain like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.033        74      42      60 ..      60      78 ..      54      79 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.033
     PF08826 42 reLeeeleqLkkemEelra 60
                r+L +el q kk m  ++a
  ACF65952.1 60 RDLRKELYQVKKSMKHIKA 78
                899*********9987775 PP

>> PF08702  Fibrinogen alpha/beta chain family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.026        57      36      62 ..      57      83 ..      54      86 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.026
                HHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     PF08702 36 kkieklenlLeqlanktkeieelvksi 62
                 ++++l+++L q++++ k+i+  v+++
  ACF65952.1 57 DEVRDLRKELYQVKKSMKHIKAGVNNV 83
                5799****************9999987 PP

>> PF11610  Scaffold protein Ste5-Fus5 binding region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.049   1.1e+02       7      14 ..      19      26 ..      17      28 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.049
     PF11610  7 TIYSQAPS 14
                T YSQ PS
  ACF65952.1 19 TCYSQIPS 26
                89*****9 PP

>> PF11622  Protein of unknown function (DUF3251)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.043        95       2      30 ..      54      82 ..      53      87 .] 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.043
     PF11622  2 aqqsevrklkqsvsklnqelttleqetvk 30
                a++ evr l+++  ++++ ++++++ +  
  ACF65952.1 54 AETDEVRDLRKELYQVKKSMKHIKAGVNN 82
                8899*******************987665 PP

>> PF02115  RHO protein GDP dissociation inhibitor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.034        75      70     109 ..      42      81 ..      21      85 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.034
                 SEEE---EEEETT---EB------GGGGGGSEEEEE---E CS
     PF02115  70 nVkvtkltllveeapdieldLtgdlkklkkklfvlkEgse 109
                  Vk+++  l+   ++d + dL ++l ++kk++ ++k g++
  ACF65952.1  42 VVKISERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVN 81 
                 4667777888888999999*****************9987 PP

>> PF06951  Group XII secretory phospholipase A2 precursor (PLA2G12)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.039        87      21      51 ..      55      85 ..      33      87 .] 0.80

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.039
     PF06951 21 reeetsdwrktlktirkglekvdeyldaale 51
                + +e+ d+rk+l +++k++++++  ++ +++
  ACF65952.1 55 ETDEVRDLRKELYQVKKSMKHIKAGVNNVVN 85
                4678889999999999999999988887765 PP

>> PF07258  HCaRG protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0      0.05   1.1e+02     158     176 ..      56      74 ..      39      76 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.05
     PF07258 158 eeklqellnelkeiqkele 176
                  +++++l++el +++k+++
  ACF65952.1  56 TDEVRDLRKELYQVKKSMK 74 
                 589***************7 PP

>> PF03233  Aphid transmission protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.1      0.05   1.1e+02     142     161 ..      57      76 ..      36      85 .. 0.71

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.05
     PF03233 142 eevkdlderlseirdslkai 161
                 +ev+dl ++l ++++s+k+i
  ACF65952.1  57 DEVRDLRKELYQVKKSMKHI 76 
                 56777777777777777765 PP

>> PF11437  Vanadium-binding protein 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.068   1.5e+02      16      35 ..      13      32 ..       2      48 .. 0.64

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.068
                HHHHHHHTTT-TTHHHHHHH CS
     PF11437 16 kkkCkekCeasrekkaCkkn 35
                 ++C+++C ++  +  C+++
  ACF65952.1 13 SETCMTTCYSQIPSGDCQEE 32
                34555555555555555544 PP

>> PF09440  eIF3 subunit 6 N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.082   1.8e+02      47      76 ..      56      85 ..      51      87 .] 0.90

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.082
     PF09440 47 vDyvadlekeleneeeipaelaekreevlk 76
                +D v dl+kel++ ++ ++++++  ++v++
  ACF65952.1 56 TDEVRDLRKELYQVKKSMKHIKAGVNNVVN 85
                68899****************999999885 PP

>> PF12023  Domain of unknown function (DUF3511)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0      0.12   2.6e+02      30      47 .]      69      86 ..      67      86 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.12
     PF12023 30 lrksfkWikgklsdiveg 47
                ++ks+k ik+ + ++v+g
  ACF65952.1 69 VKKSMKHIKAGVNNVVNG 86
                79********99999986 PP

>> PF07851  TMPIT-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.082   1.8e+02      23      63 ..      41      81 ..      30      86 .. 0.72

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.082
     PF07851 23 ykqkleeleklqekcasaikkqkkrlkelkkslkklkkklt 63
                +  k++e   +  + +++++  +k+l ++kks+k++k+ ++
  ACF65952.1 41 VVVKISERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVN 81
                55566666666667778888888888888888888887655 PP

>> PF09942  Uncharacterized conserved protein (DUF2174)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.16   3.5e+02       3      22 ..      58      77 ..      56      84 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.16
     PF09942  3 dykkeekelYspkkkpeivd 22
                + +  +kelY++kk+++ ++
  ACF65952.1 58 EVRDLRKELYQVKKSMKHIK 77
                56788999*****9998886 PP

>> PF03622  IBV 3B protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1      0.17   3.8e+02       5      19 ..      32      46 ..      30      59 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.17
     PF03622  5 ekiietGeqviqqis 19
                e+  etG  v+ +is
  ACF65952.1 32 EAGFETGASVVVKIS 46
                5668**********9 PP

>> PF04108  Autophagy protein Apg17
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.099   2.2e+02     249     278 ..      55      84 ..      35      87 .] 0.69

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.099
     PF04108 249 DaaeledVvkelqevideiennlkrvkkll 278
                    e+ d  kel +v +++++  + v++++
  ACF65952.1  55 ETDEVRDLRKELYQVKKSMKHIKAGVNNVV 84 
                 455666666666666666666666655554 PP

>> PF06273  Plant specific eukaryotic initiation factor 4B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.18     4e+02     367     390 ..      55      78 ..      46      85 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.18
     PF06273 367 eteeekllkeeieelkkelkkeea 390
                 et+e + l++e+ + kk +k+ +a
  ACF65952.1  55 ETDEVRDLRKELYQVKKSMKHIKA 78 
                 8****************9998776 PP

>> PF10426  Recombination-activating protein 1 zinc-finger domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.41   9.1e+02       9      13 ..      28      32 ..      25      35 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.41
     PF10426  9 dCdEE 13
                dC+EE
  ACF65952.1 28 DCQEE 32
                9***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (87 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       499  (0.0418905); expected 238.2 (0.02)
Passed bias filter:                      417  (0.0350067); expected 238.2 (0.02)
Passed Vit filter:                        45  (0.0037777); expected 11.9 (0.001)
Passed Fwd filter:                        45  (0.0037777); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.14u 0.04s 00:00:00.18 Elapsed: 00:00:00
# Mc/sec: 1341.60
//