# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26715.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF66348.1  [L=339]
Description: sent8 ACF66348.1 GIB00763CH01 "starvation-sensing protein RspB"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.9e-35  122.9   1.6    5.2e-35  122.1   0.3    2.0  1  PF08240  Alcohol dehydrogenase GroES-like domain
    5.8e-16   60.9   0.0    8.9e-16   60.3   0.0    1.3  1  PF00107  Zinc-binding dehydrogenase
  ------ inclusion threshold ------
       0.18   14.6   0.0       0.31   13.8   0.0    1.4  1  PF01488  Shikimate / quinate 5-dehydrogenase
       0.25   14.0   0.1       0.56   12.9   0.0    1.7  1  PF02254  TrkA-N domain
        2.4    9.9   0.1        4.7    8.9   0.1    1.5  1  PF01946  Thi4 family
        3.1    9.6   2.8        7.4    8.4   1.9    1.6  1  PF10589  NADH-ubiquinone oxidoreductase-F iron-sulfur bindin
        5.6    8.3   0.0        8.5    7.7   0.0    1.2  1  PF02423  Ornithine cyclodeaminase/mu-crystallin family
        6.1    8.6   0.0         10    7.8   0.0    1.3  1  PF01745  Isopentenyl transferase
        8.2    9.0   0.0         15    8.2   0.0    1.4  1  PF01113  Dihydrodipicolinate reductase, N-terminus
         11    8.0   0.0         17    7.4   0.0    1.2  1  PF06578  YOP proteins translocation protein K (YscK)
         20    6.2   0.0         29    5.6   0.0    1.1  1  PF10933  Protein of unknown function (DUF2827)
         46    6.5   0.5    1.1e+02    5.4   0.4    1.5  1  PF02008  CXXC zinc finger domain
         51    6.4   0.1      1e+02    5.3   0.1    1.5  1  PF12345  Protein of unknown function (DUF3641)
         56    6.5   0.0    1.8e+02    4.9   0.0    1.8  1  PF02875  Mur ligase family, glutamate ligase domain
         69    5.0   0.0    1.2e+02    4.2   0.0    1.3  1  PF04016  Domain of unknown function (DUF364)
         72    4.9   0.0    1.1e+02    4.3   0.0    1.3  1  PF03435  Saccharopine dehydrogenase
         73    5.5   0.0      2e+02    4.1   0.0    1.7  1  PF04405  Domain of Unknown function (DUF542)
         85    4.5   0.0    1.4e+02    3.8   0.0    1.2  1  PF09571  XcyI restriction endonuclease
         96    5.5   0.1    2.3e+02    4.2   0.0    1.6  1  PF00899  ThiF family
    1.2e+02    5.1   0.1    2.4e+02    4.1   0.0    1.5  1  PF11216  Protein of unknown function (DUF3012)
    1.3e+02    5.1   0.5    3.1e+02    3.8   0.1    1.8  1  PF11213  Protein of unknown function (DUF3006)
    1.5e+02    2.3   0.0    6.8e+02    0.1   0.0    1.6  1  PF05691  Raffinose synthase or seed inhibition protein Sip1
    1.9e+02    3.4   0.0    3.3e+02    2.5   0.0    1.3  1  PF07692  Low iron-inducible periplasmic protein
    2.1e+02    3.4   0.0    3.1e+02    2.9   0.0    1.1  1  PF04687  Microvirus H protein (pilot protein)
    2.3e+02    4.3   0.0    4.2e+02    3.5   0.0    1.4  1  PF08769  Sporulation initiation factor Spo0A C terminal
    2.5e+02    3.6   0.0      4e+02    2.9   0.0    1.2  1  PF02230  Phospholipase/Carboxylesterase
    3.6e+02    3.0   0.0    5.7e+02    2.4   0.0    1.2  1  PF11816  Domain of unknown function (DUF3337)
    3.6e+02    4.2   0.6    9.1e+02    2.9   0.5    1.6  1  PF02068  Plant PEC family metallothionein
    4.2e+02    3.3   0.2    9.5e+02    2.1   0.1    1.5  1  PF12354  Bacterial adhesion/invasion protein N terminal
    2.4e+03    0.9   0.1    6.5e+03   -0.5   0.0    1.5  1  PF11351  Protein of unknown function (DUF3154)


Domain and alignment annotation for each model:
>> PF08240  Alcohol dehydrogenase GroES-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.1   0.3   1.6e-38   5.2e-35       1     108 [.      24     130 ..      24     131 .. 0.98

  Alignments for each domain:
  == domain 1    score: 122.1 bits;  conditional E-value: 1.6e-38
                 TTEEEEEEEEB---HHHHHHH--.CCCT--SSEE----BE-EEEEE----B------EEEE-SEEE-SSSHHHHTT-GGG-TTBBE---B-----BSEE CS
     PF08240   1 pgevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGiveevgegvkklkvGdrvvvepliscgeCeaCkegeenlceeakllgvkldGgfaeyv 99 
                 pgev++kvk aGiCgsD hi++g +++ +k+p ++GhE+ G++++vg++v++ ++G+rv v+p+iscg+C+ C+ g++n+c++  +lgv++dGgf+ey+
  ACF66348.1  24 PGEVRIKVKLAGICGSDSHIYRG-HNPFAKYPRVIGHEFFGVIDAVGDNVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYA 121
                 68*********************.8************************************************************************** PP

                 EESGGGEEE CS
     PF08240 100 vvpekklvk 108
                 v+p++++++
  ACF66348.1 122 VAPARNAHR 130
                 ***999876 PP

>> PF00107  Zinc-binding dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   60.3   0.0   2.7e-19   8.9e-16       1     128 [.     171     296 ..     171     298 .. 0.96

  Alignments for each domain:
  == domain 1    score: 60.3 bits;  conditional E-value: 2.7e-19
                 ----HHHHHHHHH-..-EEEEEESSHHHHHHHHH----EEEETTTSTHHHHHHHHTCC--BSEEEEET-.HHHHHHHHTTS-----EEEE----EEEEE CS
     PF00107   1 GvGlaavqlAkalG..arviavdsseeklelakelGadhvinskdedfvkaireltggkgvdvviecvgagatfeqalkllapgGrvvvvggtsganve 97 
                 ++Gl +vq++k +   ++vi+vd+ ee+l++ak+ Gad ++n  + ++++ +++   +  + ++++++ ++a +++a+ l+ p  r+v++g+ s +++e
  ACF66348.1 171 PMGLTTVQALKGVYqvKTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQQKALK--PTLIVDAACHPAILQEAITLASPAARIVLMGFSS-DPCE 266
                 68*****************************************999988888888887..*********************************9.**** PP

                 ECHHHHHTTT--EEE--SSSHHHHHHHHHHH CS
     PF00107  98 fdlrklllkektiqGsllgnpeeleealqll 128
                 ++ + ++ ke+ i  s l   ++++ ++++l
  ACF66348.1 267 IVQQGITGKELAIYSSRLNA-NKFPVVIDWL 296
                 ****************9999.9999999887 PP

>> PF01488  Shikimate / quinate 5-dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.8   0.0   9.2e-05      0.31      10      50 ..     159     200 ..     151     237 .. 0.88

  Alignments for each domain:
  == domain 1    score: 13.8 bits;  conditional E-value: 9.2e-05
                 -TT-EEEEE-------HHHHHHHH-.---EEEE--SSHHHHH CS
     PF01488  10 lkgkkvlviGAGemarlvakhLlek.gvkkiviaNRtaekak 50 
                  ++  +l+ GAG m+ +++++L+   +vk ++++ R +e+++
  ACF66348.1 159 TEQDVALIYGAGPMGLTTVQALKGVyQVKTVIVVDRIEERLA 200
                 566778999***************99**********999874 PP

>> PF02254  TrkA-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.9   0.0   0.00017      0.56       2      45 ..     165     210 ..     164     263 .. 0.84

  Alignments for each domain:
  == domain 1    score: 12.9 bits;  conditional E-value: 0.00017
                 EEE---HHHHHHHHHHHH.TC.EEEEEEESSHHHHHHHHHCSSEEE CS
     PF02254   2 iiiGlGrvGrslaeeLse.ge.kdvvvidkdeerveelreeglevv 45 
                 +i G+G +G + +++L+  ++ k+v+v+d+ eer++ +++ g+ + 
  ACF66348.1 165 LIYGAGPMGLTTVQALKGvYQvKTVIVVDRIEERLAMAKQSGADWT 210
                 799***************877658**************99997743 PP

>> PF01946  Thi4 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.1    0.0014       4.7      13      48 ..     156     193 ..     147     210 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0014
                 HHCTEECEE.EE-------HHHHHHHCC.TS-EEEEES CS
     PF01946  13 lkyaesDvv.ivGaGssGltaayylakk.dlkvailer 48 
                 ++  e+Dv+ i GaG+ Glt+ + l    ++k++i+  
  ACF66348.1 156 VNPTEQDVAlIYGAGPMGLTTVQALKGVyQVKTVIVVD 193
                 567899996478**********9998777999888533 PP

>> PF10589  NADH-ubiquinone oxidoreductase-F iron-sulfur binding region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   1.9    0.0022       7.4      15      27 ..      88     100 ..      87     107 .. 0.88

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0022
                 -----HHHH---- CS
     PF10589  15 SCGkCtPCRiGtt 27 
                 SCG C PC +G +
  ACF66348.1  88 SCGHCYPCSVGKP 100
                 9*******99965 PP

>> PF02423  Ornithine cyclodeaminase/mu-crystallin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0    0.0025       8.5     131     167 ..     163     199 ..     155     208 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0025
                 EEEEE----HHHHHHHHHCCCS--SEEEE--SSHHHH CS
     PF02423 131 tlaiiGaGvqaetqlealsavlpieeiriydideeaa 167
                 ++ i GaG ++ t ++al+ v +++++ ++d+ ee  
  ACF66348.1 163 VALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERL 199
                 55577**************************988765 PP

>> PF01745  Isopentenyl transferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0031        10       2      97 ..     162     259 ..     161     265 .. 0.75

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0031
     PF01745   2 evylifGatttGKtaeaiklaketgapvivlDRvqcyselavgsGrple.eelegtrRiylddrslseGvi.daeeanerLikevesykdeeglilEG 97 
                 +v li+Ga  +G t +       +   viv+DR+     +a  sG+  + ++ +     +l+++ l+   i da+    +L ++++  +    ++l G
  ACF66348.1 162 DVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWTlNNGQHSLAEFLQQKALKPTLIvDAACHPAILQEAITLASPAARIVLMG 259
                 689*********999887778888999******************97542566777788999999987765144444455555566555566666665 PP

>> PF01113  Dihydrodipicolinate reductase, N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0045        15       5      85 ..     166     247 ..     163     275 .. 0.70

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0045
                 EB--------HHHHHHHH----EE-EEB-----TT.---B------------BEBS-HHHHCCS-SEEEB-S.-GGGHHHHHH CS
     PF01113   5 vvGasGrmGkevikaieeaedlelvaavdrkesel.egkdagellglgklgvavtddleevlekadvliDFT.tpeavlenlk 85 
                 ++Ga G mG + ++a++   +++ v +vdr e+ l  +k+ g    l++ +  + + l++   k   ++D   +p+ + e + 
  ACF66348.1 166 IYGA-GPMGLTTVQALKGVYQVKTVIVVDRIEERLaMAKQSGADWTLNNGQHSLAEFLQQKALKPTLIVDAAcHPAILQEAIT 247
                 8899.*************************98544145555555555555555555555555557788888745555544444 PP

>> PF06578  YOP proteins translocation protein K (YscK)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0    0.0052        17     161     195 ..     193     228 ..     183     238 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0052
     PF06578 161 krLelrLseaees.asWklaeeqrdLaraLckkiak 195
                  r+e rL  a++s a+W+l++ q +La+ L +k  k
  ACF66348.1 193 DRIEERLAMAKQSgADWTLNNGQHSLAEFLQQKALK 228
                 6889999987764399**************999876 PP

>> PF10933  Protein of unknown function (DUF2827)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0    0.0088        29     116     172 ..     191     247 ..     169     266 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.0088
     PF10933 116 lFerrsgllfsgarydevWiipkvekssapylqallRapvtvvpfiWdplflekrta 172
                 + +r  + l  +++  + W++ + ++s a++lq     p  +v    +p++l+++++
  ACF66348.1 191 VVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAIT 247
                 445555888889999999**********************************99876 PP

>> PF02008  CXXC zinc finger domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.4     0.032   1.1e+02       8      19 ..      88      99 ..      82     107 .. 0.75

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.032
     PF02008  8 rCgeCeaCqrte 19
                +Cg C +C++ +
  ACF66348.1 88 SCGHCYPCSVGK 99
                699999998766 PP

>> PF12345  Protein of unknown function (DUF3641)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.1     0.031     1e+02     109     132 ..      81     104 ..      67     106 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.031
     PF12345 109 leereiavaehCygCtaGaGssCg 132
                 ++ +++    hCy C+ G+   C+
  ACF66348.1  81 VSVDPVISCGHCYPCSVGKPNVCT 104
                 4556778889********999996 PP

>> PF02875  Mur ligase family, glutamate ligase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.053   1.8e+02       9      42 ..     224     254 ..     220     263 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.053
                 ECETTTEEEE-T--SCCCHHHHHHHHHHC-S.S- CS
     PF02875   9 geangvtvidDyahnpdslsaalkalreiapdkr 42 
                 ++a ++t+i+D a +p+ l++a++++    p+ r
  ACF66348.1 224 QKALKPTLIVDAACHPAILQEAITLAS---PAAR 254
                 567799****************99983...4334 PP

>> PF04016  Domain of unknown function (DUF364)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.037   1.2e+02     181     203 ..     244     266 ..     241     275 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.037
     PF04016 181 rllelakkaaevvlvGPsapllp 203
                 + ++la++aa++vl+G s+  ++
  ACF66348.1 244 EAITLASPAARIVLMGFSSDPCE 266
                 66899*************87665 PP

>> PF03435  Saccharopine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.032   1.1e+02       2      41 ..     165     204 ..     164     246 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.032
                 EEE----THHHHHHHHHTTTC..EEEEEESSHHHHHHHHT CS
     PF03435   2 lvlGaGsvGqavaellarhgdvdeitvadrtlekaqalaa 41 
                 l+ GaG +G  +++ l+   +v++++v+dr +e+++ +++
  ACF66348.1 165 LIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQ 204
                 899*******************************766654 PP

>> PF04405  Domain of Unknown function (DUF542)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.059     2e+02      29      50 ..     213     234 ..     211     235 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.059
     PF04405  29 gGkvsLaeAckekgldleevla 50 
                  G++sLae +++k l +  +++
  ACF66348.1 213 NGQHSLAEFLQQKALKPTLIVD 234
                 7****************99986 PP

>> PF09571  XcyI restriction endonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.041   1.4e+02     193     223 ..     243     273 ..     229     280 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.041
     PF09571 193 eskivlsnaaGrevtiefaadPdiiirekle 223
                 +++i l++ a r v++ f++dP  i+++ + 
  ACF66348.1 243 QEAITLASPAARIVLMGFSSDPCEIVQQGIT 273
                 679*******************988887665 PP

>> PF00899  ThiF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0      0.07   2.3e+02       5      34 ..     164     194 ..     160     196 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.07
     PF00899   5 vlvvGaGglGseaaeaLara.GvgkltlvDk 34 
                  l+ GaG +G ++++aL ++  v+++++vD+
  ACF66348.1 164 ALIYGAGPMGLTTVQALKGVyQVKTVIVVDR 194
                 689***************99788****9995 PP

>> PF11216  Protein of unknown function (DUF3012)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.073   2.4e+02      10      22 ..     201     213 ..     199     216 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.073
     PF11216  10 mkekpkgdWtane 22 
                 m+ +  +dWt n+
  ACF66348.1 201 MAKQSGADWTLNN 213
                 889999*****98 PP

>> PF11213  Protein of unknown function (DUF3006)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1     0.093   3.1e+02       2      12 ..     190     200 ..     189     204 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.093
     PF11213   2 aviDRfEgdlA 12 
                 +v+DR+E++lA
  ACF66348.1 190 IVVDRIEERLA 200
                 69******998 PP

>> PF05691  Raffinose synthase or seed inhibition protein Sip1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0       0.2   6.8e+02     464     504 ..     181     221 ..     175     227 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.2
     PF05691 464 ngvfwlqgvhivhvaynslflGeliqPdWdmfqsdhpaaef 504
                 +gv+ +++v +v    + l + +    dW + + +h  aef
  ACF66348.1 181 KGVYQVKTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEF 221
                 799************************************99 PP

>> PF07692  Low iron-inducible periplasmic protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0     0.099   3.3e+02      19      41 ..     137     159 ..     131     185 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.099
     PF07692  19 dttgaalggfkyagnvigyvnit 41 
                 d   +++++f  a+nv g vn t
  ACF66348.1 137 DHHAVMVEPFTIAANVTGQVNPT 159
                 5667899************9966 PP

>> PF04687  Microvirus H protein (pilot protein)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.093   3.1e+02      24      95 ..     137     208 ..     130     224 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.093
     PF04687  24 dnnvvgmddaGiksaiqGsnvpnsdeaaesavsGvladaGksllegtiqaGsdkvkdklldkvglggksakd 95 
                 d  +v ++   i + + G   p  +++a    +G +  +  ++l+g+ q  +  v d++ +++ ++ +s +d
  ACF66348.1 137 DHHAVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGAD 208
                 667888888899999************************************************999888887 PP

>> PF08769  Sporulation initiation factor Spo0A C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.12   4.2e+02      17      38 ..     312     333 ..     306     337 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.12
     PF08769  17 GytYlrdaielvvedpelldgv 38 
                  y+++ daiel+ +d++   +v
  ACF66348.1 312 DYQHVTDAIELFEKDQRQCCKV 333
                 69************99877665 PP

>> PF02230  Phospholipase/Carboxylesterase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.12     4e+02      93     113 ..     241     261 ..     201     262 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.12
     PF02230  93 lidaelktgipssriilgGFS 113
                 +++++++   p+ ri+l+GFS
  ACF66348.1 241 ILQEAITLASPAARIVLMGFS 261
                 56667777799*********9 PP

>> PF11816  Domain of unknown function (DUF3337)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.17   5.7e+02     263     306 ..     191     250 ..     188     255 .. 0.70

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.17
     PF11816 263 Vverlekdpesktaemkdkk....................lkpeewLellCndqvLdpdmtLat 306
                 Vv+r+e+  ++ +++                         lkp+  ++  C+  +L   +tLa+
  ACF66348.1 191 VVDRIEERLAMAKQS----GadwtlnngqhslaeflqqkaLKPTLIVDAACHPAILQEAITLAS 250
                 677774333333311....122446666666666667677**********************96 PP

>> PF02068  Plant PEC family metallothionein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.5      0.27   9.1e+02       5      22 ..      88     105 ..      84     124 .. 0.76

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.27
                 ------------------ CS
     PF02068   5 kcGcaspcpGGkacrcts 22 
                 +cG   pc  Gk   cts
  ACF66348.1  88 SCGHCYPCSVGKPNVCTS 105
                 577777777777777776 PP

>> PF12354  Bacterial adhesion/invasion protein N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.1      0.28   9.5e+02      20      41 ..       3      24 ..       1      24 [. 0.94

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.28
     PF12354 20 slcigtslgtkvqaasitqPtP 41
                s++i ++++  +++  ++qP+P
  ACF66348.1  3 SIVIEKPNTLTIETRALPQPAP 24
                7899*****************9 PP

>> PF11351  Protein of unknown function (DUF3154)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.5   0.0       1.9   6.5e+03      76     113 ..     140     177 ..     138     186 .. 0.87

  Alignments for each domain:
  == domain 1    score: -0.5 bits;  conditional E-value: 1.9
     PF11351  76 almvdpllfaarmvalalgvpepLwwllgagvlgyfga 113
                 a+mv+p+ +aa  +++  +  +   ++ gag  g++++
  ACF66348.1 140 AVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTV 177
                 789*******9999999988899999999999999886 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (339 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       380  (0.0319006); expected 238.2 (0.02)
Passed bias filter:                      334  (0.028039); expected 238.2 (0.02)
Passed Vit filter:                        31  (0.00260242); expected 11.9 (0.001)
Passed Fwd filter:                        31  (0.00260242); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              30  [number of targets reported over threshold]
# CPU time: 0.26u 0.04s 00:00:00.30 Elapsed: 00:00:00
# Mc/sec: 2814.88
//