# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26728.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF67239.1  [L=309]
Description: sent8 ACF67239.1 GIB00763CH01 "transcriptional regulator HilD"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.5e-15   59.1   0.9    3.5e-07   32.4   0.1    2.5  2  PF00165  Bacterial regulatory helix-turn-helix proteins, Ara
  ------ inclusion threshold ------
          2   11.4   1.2         13    8.8   0.1    2.5  2  PF05043  Mga helix-turn-helix domain
        2.5   10.6   0.5        7.7    9.0   0.0    1.9  1  PF09312  SurA N-terminal domain
        4.9    8.9   0.7         13    7.4   0.2    1.9  1  PF03117  UL49 family
        5.5    9.4   0.6    1.2e+02    5.2   0.1    2.6  2  PF10975  Protein of unknown function (DUF2802)
        5.6    8.5   0.1        8.6    7.9   0.0    1.4  1  PF04745  VITF-3 subunit protein
        5.9    9.6   0.9         19    8.0   0.0    2.2  1  PF10438  Cyclo-malto-dextrinase C-terminal domain
          8    8.7   0.1         85    5.4   0.0    2.2  2  PF02954  Bacterial regulatory protein, Fis family
        9.1    7.3   1.1         15    6.6   0.3    1.6  1  PF04124  Dor1-like family
        9.5    7.8   0.0         18    6.9   0.0    1.4  1  PF07212  Hyaluronidase protein (HylP)
         15    6.7   0.0         24    6.0   0.0    1.3  1  PF05833  Fibronectin-binding protein A N-terminus (FbpA)
         18    7.6   0.4         38    6.5   0.1    1.7  1  PF08795  Putative papain-like cysteine peptidase (DUF1796)
         18    7.7   0.1         47    6.4   0.1    1.6  1  PF10805  Protein of unknown function (DUF2730)
         20    7.6   0.0         42    6.6   0.0    1.4  1  PF03641  Possible lysine decarboxylase
         20    8.2   0.0         35    7.4   0.0    1.3  1  PF11716  Mycothiol maleylpyruvate isomerase N-terminal domai
         22    7.0   0.1         54    5.7   0.0    1.7  1  PF10899  Protein of unknown function (DUF2743)
         24    6.9   1.1         74    5.3   0.3    1.9  1  PF07795  Protein of unknown function (DUF1635)
         26    7.1   0.1         60    5.9   0.1    1.6  1  PF08923  Mitogen-activated protein kinase kinase 1 interacti
         28    5.7   0.1         47    5.0   0.0    1.3  1  PF04262  Glutamate-cysteine ligase
         41    6.7   0.6         65    6.0   0.4    1.3  1  PF05444  Protein of unknown function (DUF753)
         44    5.8   0.6         81    5.0   0.0    1.8  1  PF06389  Filovirus membrane-associated protein VP24
         47    6.7   0.4         87    5.9   0.3    1.4  1  PF08898  Domain of unknown function (DUF1843)
         74    5.2   0.1    1.9e+02    4.0   0.0    1.6  1  PF04824  Conserved region of Rad21 / Rec8 like protein
         76    6.0   0.2    1.6e+02    5.0   0.2    1.5  1  PF09725  Folate-sensitive fragile site protein Fra10Ac1
         82    6.0   0.2    2.3e+02    4.6   0.2    1.7  1  PF06953  Arsenical resistance operon trans-acting repressor 
         93    5.4   0.2    4.2e+02    3.3   0.1    2.1  1  PF10792  Protein of unknown function (DUF2605)
    1.2e+02    5.1   0.1      3e+02    3.9   0.0    1.6  1  PF01333  Apocytochrome F, C-terminal
    1.3e+02    5.0   0.2    3.2e+02    3.7   0.2    1.7  1  PF02209  Villin headpiece domain
    1.3e+02    4.8   0.1    2.6e+02    3.8   0.1    1.4  1  PF05431  Insecticidal Crystal Toxin, P42
    1.3e+02    5.1   0.8    2.5e+02    4.1   0.6    1.5  1  PF08051  Erythromycin resistance leader peptide
    1.3e+02    4.4   0.0    2.6e+02    3.4   0.0    1.5  1  PF05706  Cyclin-dependent kinase inhibitor 3 (CDKN3)
    1.3e+02    4.5   0.0    2.2e+02    3.9   0.0    1.4  1  PF02682  Allophanate hydrolase subunit 1
    1.4e+02    5.2   0.1    2.8e+02    4.2   0.0    1.5  1  PF06780  Erp protein C-terminus
    1.8e+02    4.4   4.3    1.1e+02    5.1   1.4    1.8  1  PF07282  Putative transposase DNA-binding domain
      2e+02    4.4   0.2    4.1e+02    3.4   0.1    1.4  1  PF06009  Laminin Domain II
    2.9e+02    2.2   0.1    4.2e+02    1.7   0.1    1.1  1  PF09730  Microtubule-associated protein Bicaudal-D
    3.9e+02    2.9   0.0    7.8e+02    1.9   0.0    1.4  1  PF08751  TrwC relaxase
    4.6e+02    3.3   0.0    9.8e+02    2.2   0.0    1.5  1  PF03975  CheD
    4.8e+02    3.0   0.3      1e+03    2.0   0.2    1.4  1  PF10702  Protein of unknown function (DUF2507)
    8.7e+02    1.8   0.1    1.5e+03    1.0   0.1    1.3  1  PF10123  Mu-like prophage I protein
    9.8e+02    2.3   5.1    4.2e+02    3.5   1.3    1.9  1  PF10601  LITAF-like zinc ribbon domain
      1e+03    1.7   1.9      9e+02    1.9   0.0    1.9  1  PF06200  tify domain
    1.4e+03    2.4   0.1    3.1e+03    1.3   0.1    1.5  1  PF08257  Sulfakinin family
    1.4e+03    1.6   4.1    3.1e+03    0.5   2.9    1.6  1  PF04438  HIT zinc finger
    1.9e+03    1.1   2.2    3.5e+03    0.2   1.5    1.4  1  PF10650  Putative zinc-finger domain
    2.5e+03    1.3   0.1    6.6e+03   -0.1   0.0    1.5  1  PF10187  N-terminal domain of NEFA-interacting nuclear prote


Domain and alignment annotation for each model:
>> PF00165  Bacterial regulatory helix-turn-helix proteins, AraC family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.1   0.1   3.3e-08   7.2e-05       1      40 [.     215     253 ..     215     255 .. 0.92
   2 !   32.4   0.1   1.6e-10   3.5e-07       8      41 ..     270     304 ..     266     305 .. 0.91

  Alignments for each domain:
  == domain 1    score: 25.1 bits;  conditional E-value: 3.3e-08
                 CHCTTS..--HHHHHHHHTS-HHHHHHHHHHH----HHHH CS
     PF00165   1 LeenlstnwsiadiAeevgfSpsyfsrlFkkytGvtPsqy 40 
                 +++++s++w+++d+A+++ +S s+++r++ ++ G ++s +
  ACF67239.1 215 ISSSPSRQWKLTDVADHIFMSTSTLKRKLAEE-GTSFSDI 253
                 68899************************999.9999875 PP

  == domain 2    score: 32.4 bits;  conditional E-value: 1.6e-10
                 .--HHHHHHHHTS.-HHHHHHHHHHH----HHHHH CS
     PF00165   8 nwsiadiAeevgf.SpsyfsrlFkkytGvtPsqyr 41 
                 n +++ +A  +g+ S syf+++Fkky+  tPs ++
  ACF67239.1 270 NHNVNAVALKCGYdSTSYFIQCFKKYFKTTPSTFI 304
                 78999**************************9877 PP

>> PF05043  Mga helix-turn-helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.1         2   4.4e+03      18      42 ..      18      42 ..       5      52 .. 0.72
   2 ?    8.8   0.1    0.0059        13      30      53 ..     222     245 ..     196     257 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 2
     PF05043 18 kyqllkflfeeeevsleelaqelyi 42
                ++q lk l+++ ++++++ +q++ i
  ACF67239.1 18 NLQKLKSLLTNTRQQIKSQTQQVTI 42
                5777788887777777776666554 PP

  == domain 2    score: 8.8 bits;  conditional E-value: 0.0059
     PF05043  30 evsleelaqelyiSestlyrkikk 53 
                 + +l++ a+  ++S stl+rk+++
  ACF67239.1 222 QWKLTDVADHIFMSTSTLKRKLAE 245
                 67899****************986 PP

>> PF09312  SurA N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0035       7.7      75     109 ..     224     258 ..     197     267 .. 0.75

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0035
     PF09312  75 aiaeiAkqnklsldqlraalaedGlsyeefreqiR 109
                  ++++A +  +s + l+++lae+G+s++++  + R
  ACF67239.1 224 KLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSAR 258
                 58899**********************99866666 PP

>> PF03117  UL49 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.2     0.006        13     144     180 ..      59      95 ..      56     168 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.006
     PF03117 144 qvivcattgriyCSlCGsqeleverlvevtsaevsgv 180
                 ++++++++++iyC   G   l++e++v+vt +ev+g+
  ACF67239.1  59 KLTISNNHDTIYCDEPGMLVLKKEQVVNVTLEEVNGH 95 
                 5789*************************98888776 PP

>> PF10975  Protein of unknown function (DUF2802)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.055   1.2e+02       5      41 ..      17      53 ..      15      55 .. 0.90
   2 ?    1.4   0.0      0.83   1.8e+03      35      55 ..     260     281 ..     254     282 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.055
     PF10975  5 qrlqeleqklkqleerleeleqqdpesrlYsrAaklv 41
                ++lq+l++ l+++++++++  qq + + lY   + lv
  ACF67239.1 17 DNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLV 53
                689********************99999999888776 PP

  == domain 2    score: 1.4 bits;  conditional E-value: 0.83
     PF10975  35 srAaklvelGa.svdelmeeCg 55 
                 ++Aakl++ G  +v+ ++ +Cg
  ACF67239.1 260 NQAAKLLRIGNhNVNAVALKCG 281
                 89********636788888886 PP

>> PF04745  VITF-3 subunit protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.0    0.0039       8.6     112     161 ..     249     299 ..     199     307 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0039
     PF04745 112 sllelffpelykesskkfrf.nsqiqiiqeklGyesssyyvyefelyystv 161
                 s+ ++++    ++ +k +r  n +++ +  k Gy+s+sy+   f++y+ t 
  ACF67239.1 249 SFSDIYLSARMNQAAKLLRIgNHNVNAVALKCGYDSTSYFIQCFKKYFKTT 299
                 6778888888999999999857789***********************985 PP

>> PF10438  Cyclo-malto-dextrinase C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0    0.0088        19      10      38 ..     252     280 ..     249     285 .. 0.92

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0088
                 TEEEEEEEESSEEEEEEEE-SSS-EEEEG CS
     PF10438  10 gvYvyfRqnddekvmvilNkndkavtldl 38 
                 ++Y+ +R n++ k++ i N n +av l+ 
  ACF67239.1 252 DIYLSARMNQAAKLLRIGNHNVNAVALKC 280
                 89**********************99975 PP

>> PF02954  Bacterial regulatory protein, Fis family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.039        85      18      41 ..     222     245 ..     220     245 .. 0.90
   2 ?    0.6   0.1       1.3   2.7e+03      21      31 ..     259     269 ..     257     270 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.039
                 ---HHHHHHH----HHHH...HHH CS
     PF02954  18 gGnisrAArlLGisRrtLyrKLkk 41 
                 ++  +++A++  +s +tL rKL +
  ACF67239.1 222 QWKLTDVADHIFMSTSTLKRKLAE 245
                 688999999999*********975 PP

  == domain 2    score: 0.6 bits;  conditional E-value: 1.3
                 HHHHHHH---- CS
     PF02954  21 isrAArlLGis 31 
                 + +AA+lL i+
  ACF67239.1 259 MNQAAKLLRIG 269
                 689*****885 PP

>> PF04124  Dor1-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.3    0.0067        15      10      37 ..      17      44 ..       9      48 .. 0.92

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0067
     PF04124 10 eelekepelLaeeaeeilaqiqdLarkn 37
                ++l+k + lL++++++i+ q+q++ +kn
  ACF67239.1 17 DNLQKLKSLLTNTRQQIKSQTQQVTIKN 44
                7899*********************999 PP

>> PF07212  Hyaluronidase protein (HylP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0    0.0081        18     191     226 ..     241     276 ..     214     288 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.0081
     PF07212 191 kksngkgtaaqgiyinstsgttgkllrirnknddkf 226
                 +k + +gt+   iy+ +    + kllri n+n +  
  ACF67239.1 241 RKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAV 276
                 457889************************997755 PP

>> PF05833  Fibronectin-binding protein A N-terminus (FbpA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.011        24     329     361 ..      15      47 ..       7      89 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.011
     PF05833 329 kaenyrlkgelLtanlyaikkgmsevelenyyt 361
                  a+n+++   lLt  +++ik + ++v+++n y 
  ACF67239.1  15 AADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYV 47 
                 479***************************985 PP

>> PF08795  Putative papain-like cysteine peptidase (DUF1796)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.1     0.018        38     119     156 ..       2      39 ..       1      46 [. 0.86

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.018
     PF08795 119 kpvlfirtviaengaeeleelpellqalsertkglpfl 156
                 ++v+f++   ++ +a++l++l+ ll++++++ k++++ 
  ACF67239.1   2 ENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQ 39 
                 589***************************99995443 PP

>> PF10805  Protein of unknown function (DUF2730)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.1     0.022        47      61      88 ..      13      40 ..       7      45 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.022
     PF10805 61 lPtakdvhaLkieltelrGelkelsaqi 88
                 P a+++++Lk +lt++r ++k  ++q+
  ACF67239.1 13 RPAADNLQKLKSLLTNTRQQIKSQTQQV 40
                599*******************999998 PP

>> PF03641  Possible lysine decarboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.019        42      16      57 ..     112     153 ..     101     155 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.019
                 E--EECCGHH.CC-TTCTBSS--EESSHHHHHHHHHHH-SEE CS
     PF03641  16 iGiipkillaaeeasneevtelvivedmheRkealvrladaf 57 
                  ++ip+  + +  +++e++++++ ++d+  R+e++ +l++af
  ACF67239.1 112 YALIPNEQQTKMAVPTEKAQKIIYTPDFPARREVFEHLKTAF 153
                 567888888888899**********************99998 PP

>> PF11716  Mycothiol maleylpyruvate isomerase N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0     0.016        35      24      56 ..     218     250 ..     216     280 .. 0.78

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.016
                 -S----BHHHHHHHHHHHHHHHHHHHHH..HH- CS
     PF11716  24 spcpgWtvadlvaHlarsaralaaalageaaes 56 
                 sp   W + d++ H+ +s + l + la+e+++ 
  ACF67239.1 218 SPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSF 250
                 78889********************99875543 PP

>> PF10899  Protein of unknown function (DUF2743)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.025        54      82     137 ..      18      72 ..       4     110 .. 0.74

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.025
     PF10899  82 lrellkklddvneqefkeetqskleenlelilayiktfdgseyknkkyvkksfyde 137
                   + lk+l+    q++k +tq++  +nl  + + + +f + + +  +  ++++y++
  ACF67239.1  18 NLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKLT-ISNNHDTIYCD 72 
                 34455666666678899999999999999999999999998833.33336777776 PP

>> PF07795  Protein of unknown function (DUF1635)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.3     0.034        74      18      63 ..       2      44 ..       1     103 [. 0.67

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.034
     PF07795 18 eqvklvaneelrkrdeeviqLkdlLkktlkerDeakeklqklllds 63
                e+v+ v+n + r   +++++Lk lL+ t++     k + q++ +++
  ACF67239.1  2 ENVTFVSNSHQRPAADNLQKLKSLLTNTRQQ---IKSQTQQVTIKN 44
                788889999999999***********99886...444555554444 PP

>> PF08923  Mitogen-activated protein kinase kinase 1 interacting
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.1     0.028        60      36      71 ..      35      70 ..      28      92 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.028
     PF08923 36 dssadqalrpslistfvlatdQasKLdlgknksiis 71
                 ++++  +++  +s+f+l +  + KL +++n+ +i 
  ACF67239.1 35 SQTQQVTIKNLYVSSFTLVCFRSGKLTISNNHDTIY 70
                456788899999*******************98885 PP

>> PF04262  Glutamate-cysteine ligase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.021        47     224     273 ..     257     306 ..     228     308 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.021
                 -TT-SBGGGS-----SGBTTT----SS-HHHHH---HHHHTSB-HHHHH- CS
     PF04262 224 lpyatsLRlsdlGYsnkaekkltvsfndleeYveslkkalktpsekyakl 273
                  +  ++ +l ++G +n +   l+  +++ + +++ +kk  kt  + + k+
  ACF67239.1 257 ARMNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIKM 306
                 445556667789******************************99999886 PP

>> PF05444  Protein of unknown function (DUF753)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.4      0.03        65      42      73 ..     142     171 ..     117     180 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.03
     PF05444  42 eRgClsdleeeeqaecaeeesesckaCsgegC 73 
                 +R+ +++l+  +  +c++++s+ c+ C++++C
  ACF67239.1 142 RREVFEHLK--TAFSCTKDTSKGCSNCNNKSC 171
                 566666664..478999999999999999999 PP

>> PF06389  Filovirus membrane-associated protein VP24
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.037        81     124     148 ..     222     246 ..     198     286 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.037
     PF06389 124 dwlllevtsainlrtrlvkdqlslr 148
                 +w l++v+ +i ++t ++k +l+ +
  ACF67239.1 222 QWKLTDVADHIFMSTSTLKRKLAEE 246
                 7*******************99876 PP

>> PF08898  Domain of unknown function (DUF1843)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.3      0.04        87      15      34 ..      18      37 ..      11      42 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.04
     PF08898 15 DLaqMKaLlaqaeqqlaead 34
                 L+++K+Ll+  +qq +++ 
  ACF67239.1 18 NLQKLKSLLTNTRQQIKSQT 37
                59************998875 PP

>> PF04824  Conserved region of Rad21 / Rec8 like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.086   1.9e+02      27      39 ..      76      88 ..      75      91 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.086
                HHHHHH------E CS
     PF04824 27 lLvLkteqaIkvk 39
                +LvLk+eq++ v+
  ACF67239.1 76 MLVLKKEQVVNVT 88
                59********996 PP

>> PF09725  Folate-sensitive fragile site protein Fra10Ac1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.2     0.075   1.6e+02      67      91 ..     160     184 ..     152     189 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.075
     PF09725  67 GkGqliCaskkCketeelktfevnf 91 
                  kG   C +k+C e+eel  + + f
  ACF67239.1 160 SKGCSNCNNKSCIENEELIPYFLLF 184
                 58999*************9998877 PP

>> PF06953  Arsenical resistance operon trans-acting repressor ArsD
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.2      0.11   2.3e+02      81     123 .]     132     171 ..     120     172 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.11
     PF06953  81 evvltgryptreelarlagiklekaeeekkaksgccsgksgcc 123
                 +++ t ++p r+e+ ++++++++ ++++   ++gc++ ++++c
  ACF67239.1 132 KIIYTPDFPARREVFEHLKTAFSCTKDT---SKGCSNCNNKSC 171
                 789999***************9999888...667755555545 PP

>> PF10792  Protein of unknown function (DUF2605)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.1      0.19   4.2e+02      35      75 ..       3      43 ..       1      54 [. 0.88

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.19
     PF10792 35 klsvlseeeqeallervkeaqkevkatkalvkAsdqqvgve 75
                + +++s+++q+  ++ +++ ++ ++ t+  +k ++qqv+++
  ACF67239.1  3 NVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIK 43
                6789999999999************************9997 PP

>> PF01333  Apocytochrome F, C-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.14     3e+02     100     117 ..      76      93 ..      73      94 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.14
                 HHHHHHHHHHHHHHHCCS CS
     PF01333 100 llvlkkkqfEkvqlaemn 117
                 +lvlkk q+  v l e+n
  ACF67239.1  76 MLVLKKEQVVNVTLEEVN 93 
                 89**********999987 PP

>> PF02209  Villin headpiece domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.2      0.15   3.2e+02       7      22 ..     292     307 ..     290     308 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.15
                 HHHHTSS-HHHHTTS- CS
     PF02209   7 FeevFgMtkeeFykLP 22 
                 F++ F+ t + F k++
  ACF67239.1 292 FKKYFKTTPSTFIKMA 307
                 9***********9997 PP

>> PF05431  Insecticidal Crystal Toxin, P42
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1      0.12   2.6e+02     129     164 ..      20      55 ..       5      64 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.12
     PF05431 129 eelkvelsteskelkkrtesieydNtedeqvrlvgf 164
                 ++lk +l+++ +++k++t++++++N    +  lv f
  ACF67239.1  20 QKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCF 55 
                 5789999******************87666666555 PP

>> PF08051  Erythromycin resistance leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.6      0.12   2.5e+02       6      11 ..     187     192 ..     187     192 .. 0.96

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.12
     PF08051   6 tAfLRL 11 
                 tAfLRL
  ACF67239.1 187 TAFLRL 192
                 9****9 PP

>> PF05706  Cyclin-dependent kinase inhibitor 3 (CDKN3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.12   2.6e+02     113     157 ..     136     180 ..     120     215 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.12
                 ---HHHHHHHHHHHHHHHHTT--EEEE-------HHHHHHHHHHH CS
     PF05706 113 tpdiascceimeelatclknyrktliqyvlglgrsclvaacllly 157
                 tpd  +  e++e l t +   + t   +     +sc+    l++y
  ACF67239.1 136 TPDFPARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPY 180
                 9*****************999999999999999***999999988 PP

>> PF02682  Allophanate hydrolase subunit 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.099   2.2e+02      51     101 ..       3      67 ..       1     114 [. 0.68

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.099
                 EEEEEE-TTTS-HHHHHHHHHHH..HHHHHHHH---EEEEEEE-------..............- CS
     PF02682  51 sllvefdpaaldaeeleaalkalleeaeeeeaeesriveipvvYdgevgp..............D 101
                 ++++  ++++ +a++  ++lk+ll+++ ++ ++++++v+i  +Y  +++               D
  ACF67239.1   3 NVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLvcfrsgkltisnnhD 67 
                 55666666666777778899******99999999999*****99988876555555555555550 PP

>> PF06780  Erp protein C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0      0.13   2.8e+02     109     136 ..      17      44 ..      11      49 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.13
     PF06780 109 eDLeklkskLeevkeYlkdkdnfeeike 136
                 ++L+klks L + ++ +k++ +  +ik+
  ACF67239.1  17 DNLQKLKSLLTNTRQQIKSQTQQVTIKN 44 
                 679***************9999999987 PP

>> PF07282  Putative transposase DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   1.4     0.052   1.1e+02      24      38 ..     156     170 ..     147     177 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.052
     PF07282  24 payTSktCsvCgskn 38 
                 ++ TSk Cs+C +k+
  ACF67239.1 156 TKDTSKGCSNCNNKS 170
                 677********9876 PP

>> PF06009  Laminin Domain II
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.19   4.1e+02      87     107 ..      12      32 ..       5      45 .. 0.75

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.19
     PF06009  87 srvlsrniseikelIaqARka 107
                  r  ++n++++k l + +R++
  ACF67239.1  12 QRPAADNLQKLKSLLTNTRQQ 32 
                 444788888888888888887 PP

>> PF09730  Microtubule-associated protein Bicaudal-D
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.1      0.19   4.2e+02     590     607 ..      17      34 ..       4      44 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.19
     PF09730 590 EeilKLksLLStKReQia 607
                 +++ KLksLL   R+Qi 
  ACF67239.1  17 DNLQKLKSLLTNTRQQIK 34 
                 5667999**999999995 PP

>> PF08751  TrwC relaxase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.36   7.8e+02     109     152 ..       8      51 ..       2      57 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.36
                 HHHHHHHHHHHHHHHHC.T-EEEEE----EEEEE----EEEEEE CS
     PF08751 109 ieahqqAvkealeyiekeaaytrrgkegkkevvktggLvaaafr 152
                  + hq+  ++ l+++   ++ tr++ + ++++v  ++L + +f+
  ACF67239.1   8 SNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFT 51 
                 5789999**********************9999999**999985 PP

>> PF03975  CheD
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.45   9.8e+02      47      66 ..     257     276 ..     238     280 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.45
     PF03975  47 aqmlkkssllniGerNvefv 66 
                 a+m ++ +ll+iG+ Nv++v
  ACF67239.1 257 ARMNQAAKLLRIGNHNVNAV 276
                 77888889*********998 PP

>> PF10702  Protein of unknown function (DUF2507)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.2      0.46     1e+03      95     121 ..      16      42 ..      15      45 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.46
     PF10702  95 Aeqlqqqkgvvaeaeeeikkkkkkvti 121
                 A++lq+ k +++++ ++ik+++++vti
  ACF67239.1  16 ADNLQKLKSLLTNTRQQIKSQTQQVTI 42 
                 889**********************98 PP

>> PF10123  Mu-like prophage I protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.1      0.71   1.5e+03     124     150 ..      13      39 ..      10      48 .. 0.61

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.71
     PF10123 124 rPaldgleelaAlaaseqsqqeeeeen 150
                 rPa d+l++l++l +++ +q +++ ++
  ACF67239.1  13 RPAADNLQKLKSLLTNTRQQIKSQTQQ 39 
                 788999999999888333333333333 PP

>> PF10601  LITAF-like zinc ribbon domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   1.3      0.19   4.2e+02      51      67 ..     153     169 ..     149     173 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.19
     PF10601  51 vdsckDveHkCpnCgal 67 
                 +++ kD+   C+nC+++
  ACF67239.1 153 FSCTKDTSKGCSNCNNK 169
                 6899**********986 PP

>> PF06200  tify domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.41     9e+02      22      31 ..     125     134 ..     124     135 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.41
     PF06200  22 vppeKaqeim 31 
                 vp eKaq i+
  ACF67239.1 125 VPTEKAQKII 134
                 99*****997 PP

>> PF08257  Sulfakinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1       1.4   3.1e+03       5       9 .]      94      98 ..      92      98 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 1.4
     PF08257  5 GHMRF 9 
                GHM F
  ACF67239.1 94 GHMDF 98
                9**87 PP

>> PF04438  HIT zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   2.9       1.4   3.1e+03      16      24 ..     163     171 ..     153     171 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 1.4
                 -TTT--EES CS
     PF04438  16 CpkCntryC 24 
                 C++Cn + C
  ACF67239.1 163 CSNCNNKSC 171
                 ******999 PP

>> PF10650  Putative zinc-finger domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   1.5       1.6   3.5e+03      12      17 ..     166     171 ..     164     172 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.6
     PF10650  12 CNDddC 17 
                 CN+++C
  ACF67239.1 166 CNNKSC 171
                 ****** PP

>> PF10187  N-terminal domain of NEFA-interacting nuclear protein NIP30
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   0.0       3.1   6.6e+03       1      41 [.       6      46 ..       6      48 .. 0.76

  Alignments for each domain:
  == domain 1    score: -0.1 bits;  conditional E-value: 3.1
     PF10187  1 FvseseleearkrrqeelekareererkaeeeeeydgksLy 41
                Fvs+s+   a  + q+ +    ++r++ ++++++ + k Ly
  ACF67239.1  6 FVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLY 46
                78887777777777777777777888888889998888888 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (309 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       824  (0.0691739); expected 238.2 (0.02)
Passed bias filter:                      492  (0.0413029); expected 238.2 (0.02)
Passed Vit filter:                        47  (0.0039456); expected 11.9 (0.001)
Passed Fwd filter:                        47  (0.0039456); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              46  [number of targets reported over threshold]
# CPU time: 0.26u 0.05s 00:00:00.31 Elapsed: 00:00:00
# Mc/sec: 2565.77
//