# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26720.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF68527.1  [L=722]
Description: sent8 ACF68527.1 GIB00763CH01 "tetratricopeptide repeat protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-36  121.9  42.1      0.003   19.9   0.3   14.3 12  PF07661  MORN repeat variant
    1.3e-23   85.5  11.2    1.2e-05   28.4   0.0    5.3  4  PF08238  Sel1 repeat
    0.00014   24.3  17.1       0.18   14.1   0.4    3.5  3  PF09318  Domain of unknown function (DUF1975)
  ------ inclusion threshold ------
        3.8    9.6   1.3        8.3    8.6   0.1    2.2  1  PF01464  Transglycosylase SLT domain
         24    7.7   4.9    1.3e+02    5.4   0.1    3.7  2  PF07719  Tetratricopeptide repeat
         25    7.2   0.0         34    6.7   0.0    1.3  1  PF00060  Ligand-gated ion channel
         35    6.9   0.1    1.3e+02    5.2   0.1    1.9  1  PF08067  ROKNT (NUC014) domain
         70    5.8   4.1         68    5.9   0.3    2.9  1  PF00515  Tetratricopeptide repeat
         84    5.0   0.1    1.6e+02    4.1   0.0    1.4  1  PF03391  Nepovirus coat protein, central domain
    1.1e+02    5.6   0.0    2.5e+02    4.5   0.0    1.5  1  PF09523  Protein of unknown function (DUF2390)
    1.7e+02    4.8   0.0    5.4e+02    3.2   0.0    1.9  1  PF05589  Protein of unknown function (DUF768)
    1.9e+02    4.0   0.0    3.7e+02    3.0   0.0    1.4  1  PF11775  Cobalamin biosynthesis protein CobT VWA domain
    2.5e+02    4.0   0.0    6.4e+02    2.7   0.0    1.6  1  PF00278  Pyridoxal-dependent decarboxylase, C-terminal sheet
    2.6e+02    3.5   0.0    8.9e+02    1.8   0.0    1.7  1  PF06684  Protein of unknown function (DUF1185)
    2.7e+02    3.9   0.0    8.9e+02    2.3   0.0    1.8  1  PF10331  Siderophore biosynthesis protein domain
    3.2e+02    4.2   0.0    6.9e+02    3.1   0.0    1.5  1  PF06254  Protein of unknown function (DUF1019)
      4e+02    2.2   0.0    7.8e+02    1.3   0.0    1.4  1  PF00854  POT family
    7.8e+02    1.3   0.1    1.5e+03    0.4   0.1    1.3  1  PF06616  BsuBI/PstI restriction endonuclease C-terminus
    8.6e+02    0.7   0.0    1.4e+03    0.1   0.0    1.2  1  PF03390  2-hydroxycarboxylate transporter family
    1.2e+03    2.8   0.0    3.8e+03    1.3   0.0    1.7  1  PF02420  Insect antifreeze protein repeat


Domain and alignment annotation for each model:
>> PF07661  MORN repeat variant
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   15.4   0.1   1.8e-05     0.088       4      21 ..     211     228 ..     208     229 .. 0.92
   2 ?    3.8   0.0       0.1   5.2e+02       5      22 .]     238     255 ..     233     255 .. 0.70
   3 !   11.3   0.1   0.00037       1.9       2      20 ..     259     277 ..     258     279 .. 0.90
   4 !   13.3   0.1   8.4e-05      0.42       1      22 []     283     304 ..     283     304 .. 0.94
   5 !   15.0   0.2   2.4e-05      0.12       1      20 [.     307     326 ..     307     328 .. 0.93
   6 !   10.1   0.1   0.00093       4.7       2      22 .]     332     352 ..     331     352 .. 0.88
   7 !   19.9   0.3     6e-07     0.003       2      22 .]     357     377 ..     356     377 .. 0.97
   8 !    8.5   0.0     0.003        15       6      21 ..     384     399 ..     382     400 .. 0.89
   9 !   11.3   0.0   0.00037       1.8       1      22 []     404     425 ..     404     425 .. 0.94
  10 !   13.0   0.4    0.0001      0.52       1      22 []     428     449 ..     428     449 .. 0.96
  11 !   11.7   0.3   0.00027       1.4       1      22 []     452     473 ..     452     473 .. 0.96
  12 !    7.0   0.2     0.009        45       1      22 []     526     546 ..     526     547 .. 0.78

  Alignments for each domain:
  == domain 1    score: 15.4 bits;  conditional E-value: 1.8e-05
     PF07661   4 eekeYyenGklkseitYk 21 
                 ++k++ye+G+lks+++Y+
  ACF68527.1 211 VFKSFYESGNLKSIYHYN 228
                 68***************7 PP

  == domain 2    score: 3.8 bits;  conditional E-value: 0.1
     PF07661   5 ekeYyenGklkseitYkn 22 
                 e++++e  k+ + +t+k+
  ACF68527.1 238 ETYFDEKDKIAETLTFKD 255
                 456777777777779996 PP

  == domain 3    score: 11.3 bits;  conditional E-value: 0.00037
     PF07661   2 eGeekeYyenGklkseitY 20 
                 eGe++ Y+enG ++s+ ++
  ACF68527.1 259 EGEYIVYHENGAVESKRYF 277
                 9************999876 PP

  == domain 4    score: 13.3 bits;  conditional E-value: 8.4e-05
     PF07661   1 leGeekeYyenGklkseitYkn 22 
                 ++Ge   +y+nG lk++ +Y n
  ACF68527.1 283 KDGECPHFYDNGVLKQKHSYLN 304
                 79*****************977 PP

  == domain 5    score: 15.0 bits;  conditional E-value: 2.4e-05
     PF07661   1 leGeekeYyenGklkseitY 20 
                 leG ++eY+++Gk+k++++Y
  ACF68527.1 307 LEGPAFEYFPDGKIKGKYSY 326
                 69****************99 PP

  == domain 6    score: 10.1 bits;  conditional E-value: 0.00093
     PF07661   2 eGeekeYyenGklkseitYkn 22 
                  G+++eYy +Gk+++ ++ +n
  ACF68527.1 332 VGTSTEYYSTGKIRGVYHRNN 352
                 599**********99888776 PP

  == domain 7    score: 19.9 bits;  conditional E-value: 6e-07
     PF07661   2 eGeekeYyenGklkseitYkn 22 
                 +G++++Y e+Gkl s++tYkn
  ACF68527.1 357 DGTFEQYSEEGKLLSKATYKN 377
                 8*******************9 PP

  == domain 8    score: 8.5 bits;  conditional E-value: 0.003
     PF07661   6 keYyenGklkseitYk 21 
                 +++yenG  k+e +++
  ACF68527.1 384 QSWYENGHPKEESSFD 399
                 79**********9985 PP

  == domain 9    score: 11.3 bits;  conditional E-value: 0.00037
     PF07661   1 leGeekeYyenGklkseitYkn 22 
                 ++G +ke++ nGk  s   Yk+
  ACF68527.1 404 KHGAVKEWFSNGKPASSKMYKH 425
                 79***************99996 PP

  == domain 10    score: 13.0 bits;  conditional E-value: 0.0001
     PF07661   1 leGeekeYyenGklkseitYkn 22 
                 l+G ++++yenG  +s ++Ykn
  ACF68527.1 428 LDGDFEKWYENGHRESVYPYKN 449
                 69*******************9 PP

  == domain 11    score: 11.7 bits;  conditional E-value: 0.00027
     PF07661   1 leGeekeYyenGklkseitYkn 22 
                 l+G +k ++e Gkl + ++Yk+
  ACF68527.1 452 LNGDAKHWNEQGKLTYTTEYKD 473
                 69*******************7 PP

  == domain 12    score: 7.0 bits;  conditional E-value: 0.009
     PF07661   1 leGeekeYyenGklkseitYkn 22 
                 +eG+e+ Y+e+G +k++ +Y n
  ACF68527.1 526 KEGTEEAYDEDG-IKYIRCYHN 546
                 79**********.555666554 PP

>> PF08238  Sel1 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.3   0.1   1.7e-06    0.0084       2      39 .]     569     599 ..     568     599 .. 0.86
   2 !   15.2   0.8   3.2e-05      0.16       3      38 ..     602     634 ..     600     635 .. 0.93
   3 !   28.4   0.0   2.4e-09   1.2e-05       1      39 []     636     671 ..     636     671 .. 0.97
   4 !   25.9   0.1   1.4e-08     7e-05       1      38 [.     672     706 ..     672     707 .. 0.90

  Alignments for each domain:
  == domain 1    score: 19.3 bits;  conditional E-value: 1.7e-06
                 -------TTT...---.-----HHHHHHHHHHHHHTT- CS
     PF08238   2 eAqynLGlyymylnGlgGvpkdpekAleWyekAAeqGh 39 
                  Aqy LG+y    + +  +  +++ A++W++++Aeq+h
  ACF68527.1 569 TAQYHLGKY----EFE-CT--NYDAAMKWLTQSAEQNH 599
                 69*****63....554.68..****************9 PP

  == domain 2    score: 15.2 bits;  conditional E-value: 3.2e-05
                 ------TTT...---.-----HHHHHHHHHHHHHTT CS
     PF08238   3 AqynLGlyymylnGlgGvpkdpekAleWyekAAeqG 38 
                 A   L+  y+y +G+ Gv +d +k l ++ kAAe+G
  ACF68527.1 602 ALLFLA--YAYNDGD-GVAQDSKKYLSYLFKAAELG 634
                 8899**..******8.9******************9 PP

  == domain 3    score: 28.4 bits;  conditional E-value: 2.4e-09
                 --------TTT...---.-----HHHHHHHHHHHHHTT- CS
     PF08238   1 aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeqGh 39 
                 ++Aq + G  y+ l G+ G pk++ +A++W +k+A+qG+
  ACF68527.1 636 SDAQLEVG--YLNLIGE-GMPKNLPEAYKWIKKSADQGN 671
                 69******..******9.9*******************8 PP

  == domain 4    score: 25.9 bits;  conditional E-value: 1.4e-08
                 --------TTT...---.-----HHHHHHHHHHHHHTT CS
     PF08238   1 aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeqG 38 
                 a+A ynLG  +my nG+ Gv+kd++kA  +++ A + G
  ACF68527.1 672 AQAHYNLG--LMYRNGD-GVEKDLNKAKLHLTAAVKGG 706
                 78******..999***8.9*********9999987765 PP

>> PF09318  Domain of unknown function (DUF1975)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   3.6     0.015        73      49     171 ..     198     321 ..     193     339 .. 0.68
   2 !   11.1   0.3    0.0003       1.5      93     164 ..     354     423 ..     314     451 .. 0.77
   3 !   14.1   0.4   3.6e-05      0.18     101     180 ..     471     549 ..     447     568 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.015
     PF09318  49 lkelglkdtevinlYdyfqdiisvktkkkidl.ykdlslpkaleveene.kdvriydkggqliarvnyrdetkgrvsyveyfdsngrl...irrdyYds 142
                 ++e ++++ + ++++  f +  + k+  + ++  k+  + +++ +e+++  +   +++g+    ++ y ++  g+v++  yf  +g++   +  ++Yd+
  ACF68527.1 198 TNEENFANRQRVSVFKSFYESGNLKSIYHYNAqNKRDGKAETYFDEKDKiAETLTFKDGQPEGEYIVYHEN--GAVESKRYFA-QGKIkdgECPHFYDN 293
                 67778889999999999999977777666677434444444444444446555666677788899999988..9999999999.777756556678886 PP

     PF09318 143 rgflsltqyfdd.dgkvileeyynpdgsiv 171
                    +    y+++  + +++e  y pdg+i+
  ACF68527.1 294 GVLKQKHSYLNQkLEGPAFE--YFPDGKIK 321
                 66666666666655555555..44566665 PP

  == domain 2    score: 11.1 bits;  conditional E-value: 0.0003
     PF09318  93 eenekdvriydkggqliarvnyrdetkgrvsyveyfdsngrlirrdyYdsrgfls..ltqyfdddgkvileeyy 164
                  en+ +++ y+++g+l+ +++y+++  +++s++ +++ ng+  + + +ds g ++  ++++f+ +gk++  + y
  ACF68527.1 354 GENDGTFEQYSEEGKLLSKATYKNG--KQLSAQSWYE-NGHPKEESSFDSEGRKHgaVKEWFS-NGKPASSKMY 423
                 3455788888888999999999999..8999999999.9999999999999988754678888.6666655555 PP

  == domain 3    score: 14.1 bits;  conditional E-value: 3.6e-05
     PF09318 101 iydkggqliarvnyrdetkgrvsyveyfdsngrlirrdyYdsrgflsltqyfdddgkvileeyynpdgsivleeyykkne 180
                 ++ ++++  a  + ++ t + v++v + ++ ++  +r++ d +g + +   + d  k ++ee y++dg  +++ y++++e
  ACF68527.1 471 YK-DDKKQGADRRWSERTGKLVEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEE 549
                 33.444777788888888899********99999*******9999999999999**********************7554 PP

>> PF01464  Transglycosylase SLT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.1    0.0017       8.3      70     111 ..     581     623 ..     579     627 .. 0.85

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0017
                 HHHHHHHHHHHH.HHHCCS-HHHHHHHHHHH-----HHHCTTT CS
     PF01464  70 cknisagakyLk.sllksyggnlrealaaYNaGagtvkkanky 111
                 c+n +a+ k L  s+ +  +g+l + ++aYN G+g  ++++ky
  ACF68527.1 581 CTNYDAAMKWLTqSAEQNHPGALLFLAYAYNDGDGVAQDSKKY 623
                 89999***9999455556666**************99998887 PP

>> PF07719  Tetratricopeptide repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1     0.026   1.3e+02       3      31 ..     570     598 ..     568     599 .. 0.90
   2 ?    2.2   0.1      0.27   1.3e+03       1      13 [.     672     684 ..     672     686 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.026
                 HHHHHHHHHHH---HHHHHHHHHHHHHH- CS
     PF07719   3 alynlGlayyklgdyeeAleafekAleld 31 
                 a y lG+  ++  +y+ A +++ ++ e +
  ACF68527.1 570 AQYHLGKYEFECTNYDAAMKWLTQSAEQN 598
                 7899*******************998865 PP

  == domain 2    score: 2.2 bits;  conditional E-value: 0.27
                 HHHHHHHHHHHHH CS
     PF07719   1 aealynlGlayyk 13 
                 a+a+ynlGl y++
  ACF68527.1 672 AQAHYNLGLMYRN 684
                 789******9975 PP

>> PF00060  Ligand-gated ion channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0    0.0068        34      79     130 ..       4      77 ..       2     307 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.0068
                 ----------------------------SHHCHHHHS......................--------------- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......................xxxxxxxxxxxxxxx RF
     PF00060  79 ffvlillssYtAnLaAfltvermqspiesledlakqt......................kaeCstkksekssse 130
                 +f+ i++s Y+An+ A    +   +p++ + + ++ +                      k+ C+t++ +   ++
  ACF68527.1   4 IFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDfnktaissdlkllladryyfkdKTPCNTNTLSARAES 77 
                 6889************9999999999988888877777777888888888888888876445555554444444 PP

>> PF08067  ROKNT (NUC014) domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.025   1.3e+02       9      26 ..     492     510 ..     487     513 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.025
     PF08067   9 EettFsNtesNG.KRpAeD 26 
                 Ee+ F+N e NG KR  +D
  ACF68527.1 492 EEVMFANDERNGlKREFND 510
                 9***********7776555 PP

>> PF00515  Tetratricopeptide repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.3     0.014        68       1      12 [.     672     683 ..     672     684 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.014
                 HHHHHHHHHHHH CS
     PF00515   1 akalynlGnayl 12 
                 a+a+ynlG++y+
  ACF68527.1 672 AQAHYNLGLMYR 683
                 79*********7 PP

>> PF03391  Nepovirus coat protein, central domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.031   1.6e+02     136     164 ..      12      40 ..       4      43 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.031
                 B--EEEE-EE--TT----EEEEEEEEEE- CS
     PF03391 136 leiaslsgPiAPedeeakyefvihieeie 164
                 l+ a +++  +P++e+ +++f+ +ie+i+
  ACF68527.1  12 LYCANICAKQSPSTESKPVNFIAQIENID 40 
                 56677**********************97 PP

>> PF09523  Protein of unknown function (DUF2390)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.05   2.5e+02      30      76 ..      49      95 ..      44     100 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.05
     PF09523 30 nVnllLlalwlaeqgvslsaeelealeaaveewreevvqplRalRra 76
                +  llL+  +  ++++ +++++l+a ++++   +ee+++++R+lR a
  ACF68527.1 49 DLKLLLADRYYFKDKTPCNTNTLSARAESMGLTTEEYINKIRSLRPA 95
                6789999999999********************************76 PP

>> PF05589  Protein of unknown function (DUF768)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.11   5.4e+02      32      62 ..      68      98 ..      67     100 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.11
     PF05589 32 tekliadAkalGikskeideevssvyevild 62
                t+ l a A++ G+  +e  +++ s++ +ild
  ACF68527.1 68 TNTLSARAESMGLTTEEYINKIRSLRPAILD 98
                67899*********************99997 PP

>> PF11775  Cobalamin biosynthesis protein CobT VWA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0     0.074   3.7e+02      82     111 ..     656     685 ..     646     697 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.074
     PF11775  82 lldlrkiiykkadaPerrarknlGlvmref 111
                 l +  k i+k+ad  + +a  nlGl+ r++
  ACF68527.1 656 LPEAYKWIKKSADQGNAQAHYNLGLMYRNG 685
                 556678999*****************9987 PP

>> PF00278  Pyridoxal-dependent decarboxylase, C-terminal sheet domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.13   6.4e+02      68      96 ..     242     270 ..     208     273 .. 0.94

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.13
                 -TT--SEEEEEEE.------EEEES---- CS
     PF00278  68 dsdDviakestlplelkegdllvffdvGA 96 
                 d+ D+ia++ t++    eg+++v++  GA
  ACF68527.1 242 DEKDKIAETLTFKDGQPEGEYIVYHENGA 270
                 899**********999*********9999 PP

>> PF06684  Protein of unknown function (DUF1185)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.18   8.9e+02      74      87 ..     325     338 ..     301     345 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.18
                 EEEEEEEE-----T CS
     PF06684  74 ayGKaaivGaagel 87 
                 +y+K++ivG++ e+
  ACF68527.1 325 SYSKGTIVGTSTEY 338
                 7*********9986 PP

>> PF10331  Siderophore biosynthesis protein domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.18   8.9e+02      22      37 ..     456     471 ..     453     474 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.18
                 HHHH-----HHHHHHH CS
     PF10331  22 aafWgmagpleehrey 37 
                 a++W+++g l    ey
  ACF68527.1 456 AKHWNEQGKLTYTTEY 471
                 89******98766655 PP

>> PF06254  Protein of unknown function (DUF1019)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.14   6.9e+02      21      36 ..      82      97 ..      78      99 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.14
                SHHHHHHHHHHHHHHH CS
     PF06254 21 tkaarekvqaLiPAil 36
                t+++ +k++ L PAil
  ACF68527.1 82 TEEYINKIRSLRPAIL 97
                899************7 PP

>> PF00854  POT family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.16   7.8e+02     112     156 ..       4      48 ..       3      65 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.16
     PF00854 112 milallvFllGsrvykkkappknsvftvvialiitalgkkrksql 156
                 +++ ++v l++ ++  k++p+ +s+++++ia+i  + ++k  +++
  ACF68527.1   4 IFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISS 48 
                 5899***************************99887777766655 PP

>> PF06616  BsuBI/PstI restriction endonuclease C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.1       0.3   1.5e+03      34      69 ..     409     444 ..     404     470 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 0.3
                 -BGGG-----B--HHHHHH----SS-------HHHH CS
     PF06616  34 ksWkeaerpalgvtsimkkkreeygkeyaentreti 69 
                 k+W  + +pa  ++   +  + +++k+y++  re++
  ACF68527.1 409 KEWFSNGKPASSKMYKHDVLDGDFEKWYENGHRESV 444
                 7899999***************************97 PP

>> PF03390  2-hydroxycarboxylate transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0      0.27   1.4e+03     180     218 ..     616     654 ..     601     677 .. 0.85

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.27
     PF03390 180 lglsqeellsqlipalilgnvlaillagllkklgkkkpk 218
                 + ++++++ls l+ a+ lg+  a l  g+l+ +g+ +pk
  ACF68527.1 616 VAQDSKKYLSYLFKAAELGESDAQLEVGYLNLIGEGMPK 654
                 558999*****************************9987 PP

>> PF02420  Insect antifreeze protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.76   3.8e+03       3      11 ..     118     126 ..     118     127 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.76
     PF02420   3 TgsknCteA 11 
                 Tg ++CteA
  ACF68527.1 118 TGIELCTEA 126
                 77799***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (722 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       334  (0.028039); expected 238.2 (0.02)
Passed bias filter:                      182  (0.0152787); expected 238.2 (0.02)
Passed Vit filter:                        20  (0.00167898); expected 11.9 (0.001)
Passed Fwd filter:                        20  (0.00167898); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              20  [number of targets reported over threshold]
# CPU time: 0.39u 0.04s 00:00:00.43 Elapsed: 00:00:01
# Mc/sec: 3996.74
//