# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26709.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF68874.1  [L=286]
Description: sent8 ACF68874.1 GIB00763CH01 "pirin protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.6e-35  122.3   0.1    7.9e-35  121.6   0.1    1.4  1  PF02678  Pirin
      6e-32  112.5   0.1    4.1e-31  109.8   0.0    2.0  2  PF05726  Pirin C-terminal cupin domain
  ------ inclusion threshold ------
        3.6    9.8   0.0        5.1    9.3   0.0    1.3  1  PF11780  Protein of unknown function (DUF3318)
        6.7    9.6   0.0         13    8.6   0.0    1.4  1  PF00917  MATH domain
        8.6    7.9   0.0         11    7.5   0.0    1.1  1  PF09565  NgoFVII restriction endonuclease
         22    8.7   0.0         55    7.4   0.0    1.7  1  PF10937  Protein of unknown function (DUF2638)
         35    6.6   3.8         89    5.3   1.9    2.2  1  PF07883  Cupin domain
         38    6.1   0.0         58    5.6   0.0    1.2  1  PF10176  Protein of unknown function (DUF2370)
         48    6.3   0.1    1.3e+02    5.0   0.1    1.7  1  PF00467  KOW motif
         54    6.5   0.0         87    5.8   0.0    1.3  1  PF04475  Protein of unknown function (DUF555)
         64    6.0   0.1    1.3e+02    5.0   0.0    1.6  1  PF06366  Flagellar protein FlhE
    1.6e+02    5.8   0.4    4.8e+02    4.4   0.3    1.8  1  PF01581  FMRFamide related peptide family
    1.7e+02    4.6   0.1      3e+02    3.9   0.1    1.3  1  PF10940  Protein of unknown function (DUF2618)
    3.3e+02    4.2   0.0    6.2e+02    3.3   0.0    1.4  1  PF07027  Protein of unknown function (DUF1318)
    4.8e+02    2.7   0.1    1.3e+03    1.3   0.1    1.6  1  PF06200  tify domain
    6.4e+02    2.4   0.0      1e+03    1.8   0.0    1.2  1  PF01628  HrcA protein C terminal domain
    1.2e+03    2.9   0.1    3.1e+03    1.5   0.0    1.7  1  PF07723  Leucine Rich Repeat
    1.3e+03    2.1   0.0    2.8e+03    1.1   0.0    1.5  1  PF07708  Tash protein PEST motif
    2.5e+03    0.3   0.0    4.9e+03   -0.7   0.0    1.3  1  PF09764  Uncharacterized conserved protein


Domain and alignment annotation for each model:
>> PF02678  Pirin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.6   0.1   1.5e-38   7.9e-35       2     107 .]      20     127 ..      19     127 .. 0.95

  Alignments for each domain:
  == domain 1    score: 121.6 bits;  conditional E-value: 1.5e-38
                 -EECCG---.TTEEEECTCEECCEEESS...-TTEEE-----CEE-BS-EEEEEEEE--EEEEE----EEEE----EEEEE-----EEEEEE-SS.... CS
     PF02678   2 vrvrralgkaawlqlvdpFlfldhfgpaklsagedelgagfppHpHrgletvtylleGeiehrDslGnkgvirpgdvqwmtAGsGivHsEmpeee.... 96 
                 + vr+ ++ ++++q+++pFl+ld+ gp+++++g++  ++g+ +HpHrg+etvt++++Ge+ehrDs+G+ gvi+pgdvqwmtAG Gi+H+E+++++    
  ACF68874.1  20 FPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNE--KRGVGEHPHRGFETVTIVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAftrr 116
                 567778888999**********************7..69*******************************************************99999 PP

                 SS-EEEEEEEE CS
     PF02678  97 eeslhglQlWv 107
                 +++l+++QlWv
  ACF68874.1 117 GGELEMVQLWV 127
                 **********8 PP

>> PF05726  Pirin C-terminal cupin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0      0.94     5e+03      17      59 ..      63     100 ..      55     105 .. 0.71
   2 !  109.8   0.0   7.8e-35   4.1e-31       2     104 .]     183     284 ..     182     284 .. 0.98

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 0.94
                 ------EEEEEE--EEE--TTEEE-TTEEEE-----EEEEE-- CS
     PF05726  17 pegfeafvyvleGsvevegersaieeeslvvlgdgdslevkae 59 
                  +gfe++  v++G+ve  ++     +++  v+g+gd  +++a+
  ACF68874.1  63 HRGFETVTIVYSGEVEHRDS-----TGRGGVIGPGDVQWMTAG 100
                 67899999999999986665.....466666666666666665 PP

  == domain 2    score: 109.8 bits;  conditional E-value: 7.8e-35
                 EEEEE----EEEEE-------EEEEEE--EEE--TTEEE-TTEEEE--.---EEEEE--SS-EEEEEEE-----S--EE---BEESSHHHHHHHHHHHH CS
     PF05726   2 ldvtleagakfelplpegfeafvyvleGsvevegersaieeeslvvlg.dgdslevkaeekgarvlllaGePigepvviyGpfVmntkeeieqAfedyr 99 
                 +d++l+ + +++l+ peg+ ++++vl+G+++v+g++ +++e++lvvl+ +g++l+++a+ ++a vlll+GeP++ep+v yGpfVmntk+ei++A++d++
  ACF68874.1 183 WDMRLQRNRQLTLAQPEGWSTALVVLKGNITVNGTT-PVNEAQLVVLSqQGKTLHLEAS-SDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFN 279
                 89*********************************6.***********9*********9.*************************************** PP

                 TT--- CS
     PF05726 100 egrfg 104
                 +grfg
  ACF68874.1 280 SGRFG 284
                 ****6 PP

>> PF11780  Protein of unknown function (DUF3318)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0   0.00097       5.1      34      76 ..     169     210 ..     159     250 .. 0.80

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.00097
     PF11780  34 elpWgevrilinlklwlpllkdqRdllllrevgwlknlgLlkr 76 
                 e + g ++ ++ l+ w+ +l+ +R+l l+++ gw ++l +lk 
  ACF68874.1 169 ETK-GPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG 210
                 455.789999*************************99666655 PP

>> PF00917  MATH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.0    0.0025        13      26      78 ..     183     239 ..     173     245 .. 0.89

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0025
                 EEEEEE-----.....-EEEEEEEEE---TTTTS-SS--.--EEEEEE----.EEE-- CS
     PF00917  26 Wrlriyrngge.....nflglylhcekgendaeleWpvetefvlklvldqgksvkkkv 78 
                 W +r++rn +      +  + +l++ kg+   +   pv+ e++l ++++qgk ++ + 
  ACF68874.1 183 WDMRLQRNRQLtlaqpEGWSTALVVLKGNITVNGTTPVN-EAQLVVLSQQGKTLHLEA 239
                 999999998879999999********************9.************976554 PP

>> PF09565  NgoFVII restriction endonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0021        11     196     259 ..     178     244 ..     160     260 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0021
     PF09565 196 SnlNv.sygeaR..kngkrkarnwyeaeirvskeitreegyPekkkpftvitDDGtileaklegenn 259
                 S lNv  +   R  +    ++++w  a + +  +it + + P ++ ++ v+   G++l+++ +++ +
  ACF68874.1 178 SPLNVwDMRLQRnrQLTLAQPEGWSTALVVLKGNITVNGTTPVNEAQLVVLSQQGKTLHLEASSDAS 244
                 667763222233214455699**************************************99999865 PP

>> PF10937  Protein of unknown function (DUF2638)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0      0.01        55      21      64 ..      10      52 ..       4      79 .. 0.79

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.01
     PF10937 21 kphPaapsgllPgsesfssyrekaqqhgPlrvvssknsassseg 64
                +p+P  + +  P   s  sy+++aqq++P+    ++ ++ ++ g
  ACF68874.1 10 APRPHWVGDGFP-VRSLFSYQSHAQQLSPFLLLDYAGPHTFTPG 52
                578888888888.59999************98777777666655 PP

>> PF07883  Cupin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   1.9     0.017        89      11      52 ..      58     100 ..      47     110 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.017
                 E-EBC-TT-EEEEEEEE--EEEE.E-TEEEEE-TT-EEEE-TT CS
     PF07883  11 apshrHpgedeffyVleGegelt.vdgeeveleaGdsvyfpag 52 
                  ++h H+g + + +V +Ge+e +   g+  ++++Gd+    ag
  ACF68874.1  58 VGEHPHRGFETVTIVYSGEVEHRdSTGRGGVIGPGDVQWMTAG 100
                 459******9***********9977799999999999887776 PP

>> PF10176  Protein of unknown function (DUF2370)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.011        58      43      62 ..     132     151 ..     117     162 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.011
     PF10176  43 eeeekPPsYeeaaadavPpy 62 
                 +++++PP Y++++ d +P+ 
  ACF68874.1 132 KDKMTPPGYQSITHDVIPTV 151
                 6899*************985 PP

>> PF00467  KOW motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.024   1.3e+02       3      13 ..     158     168 ..     158     172 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.024
                 BEEEE-----T CS
     PF00467   3 dyVrvisGpfk 13 
                 ++Vrvi+G++ 
  ACF68874.1 158 GVVRVIAGRYE 168
                 58*******95 PP

>> PF04475  Protein of unknown function (DUF555)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.017        87       4      36 ..     205     237 ..     202     243 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.017
     PF04475   4 lvvleaawivrdvesvddaievaiseagkrlnk 36 
                 lvvl++ ++v+    v++a  v +s+ gk+l+ 
  ACF68874.1 205 LVVLKGNITVNGTTPVNEAQLVVLSQQGKTLHL 237
                 79****************************985 PP

>> PF06366  Flagellar protein FlhE
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.025   1.3e+02      25      65 ..     131     171 ..     122     215 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.025
     PF06366  25 vGitlesrgesassspllppsalpqaegvitsvsWryelas 65 
                 +  +++ +g +  ++ ++p+++lp + gv+ +++ rye ++
  ACF68874.1 131 MKDKMTPPGYQSITHDVIPTVTLPDNAGVVRVIAGRYEETK 171
                 5567888999999************************8544 PP

>> PF01581  FMRFamide related peptide family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.3     0.091   4.8e+02       2      10 ..     276     284 ..     275     284 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.091
     PF01581   2 rdkrfmRFG 10 
                 rd++ +RFG
  ACF68874.1 276 RDFNSGRFG 284
                 799*****9 PP

>> PF10940  Protein of unknown function (DUF2618)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1     0.058     3e+02      21      35 ..      23      37 ..      21      39 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.058
     PF10940 21 RscFsYSlFasqiss 35
                Rs FsY   a+q s+
  ACF68874.1 23 RSLFSYQSHAQQLSP 37
                9***********987 PP

>> PF07027  Protein of unknown function (DUF1318)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.12   6.2e+02      22      49 ..     255     282 ..     248     285 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.12
     PF07027  22 EqldGYlgvvkgasaevralveeiNakR 49 
                 E + GY  +v ++++e+ ++v++ N+ R
  ACF68874.1 255 EPIVGYGPFVMNTKQEIAEAVRDFNSGR 282
                 66779999*****************988 PP

>> PF06200  tify domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1      0.25   1.3e+03       9      16 ..      70      77 ..      68      77 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.25
     PF06200  9 TIFYgGqV 16
                TI Y G+V
  ACF68874.1 70 TIVYSGEV 77
                9*****98 PP

>> PF01628  HrcA protein C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.19     1e+03     184     217 ..      60      93 ..      56      99 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.19
     PF01628 184 EnplesledcSvvtatYgvgeepvgsvgviGPtr 217
                 E+p++++e +++v ++   +++  g+ gviGP  
  ACF68874.1  60 EHPHRGFETVTIVYSGEVEHRDSTGRGGVIGPGD 93 
                 999*************99999999********65 PP

>> PF07723  Leucine Rich Repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.59   3.1e+03       3       8 ..     233     238 ..     233     250 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.59
     PF07723   3 KtLhLd 8  
                 KtLhL+
  ACF68874.1 233 KTLHLE 238
                 9****8 PP

>> PF07708  Tash protein PEST motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.53   2.8e+03       7      15 ..     234     242 ..     234     243 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.53
     PF07708   7 TItvElsSD 15 
                 T ++E sSD
  ACF68874.1 234 TLHLEASSD 242
                 78******9 PP

>> PF09764  Uncharacterized conserved protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   0.0      0.93   4.9e+03     129     143 ..       1      15 [.       1      24 [. 0.95

  Alignments for each domain:
  == domain 1    score: -0.7 bits;  conditional E-value: 0.93
     PF09764 129 mkkedgsyikppPey 143
                 mk+  g+y++p P++
  ACF68874.1   1 MKQITGVYTAPRPHW 15 
                 9999**********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (286 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       135  (0.0113331); expected 238.2 (0.02)
Passed bias filter:                      133  (0.0111652); expected 238.2 (0.02)
Passed Vit filter:                        19  (0.00159503); expected 11.9 (0.001)
Passed Fwd filter:                        19  (0.00159503); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              19  [number of targets reported over threshold]
# CPU time: 0.19u 0.04s 00:00:00.23 Elapsed: 00:00:00
# Mc/sec: 3249.72
//