# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26723.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF69516.1  [L=111]
Description: sent8 ACF69516.1 GIB00763CH01 "inner membrane protein YfbW"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.2e-08   36.2   2.3    5.5e-08   35.8   1.6    1.2  1  PF00893  Small Multidrug Resistance protein
    5.8e-08   35.5  13.0      2e-07   33.7   9.0    1.8  1  PF00892  EamA-like transporter family
     0.0014   21.1   0.5     0.0014   21.1   0.3    1.9  2  PF10639  Uncharacterised protein family UPF0546
  ------ inclusion threshold ------
       0.63   12.3   4.3       0.84   11.9   3.0    1.2  1  PF03151  Triose-phosphate Transporter family
        4.3   10.3   7.3         24    7.9   0.3    2.5  2  PF02656  Domain of unknown function DUF
        6.2    9.2   2.2        7.5    8.9   1.5    1.5  1  PF10099  Anti-sigma-K factor rskA
        6.7    9.0   6.8        8.5    8.6   4.7    1.3  1  PF07695  7TM diverse intracellular signalling
        7.2    9.1   0.2         63    6.1   0.0    2.2  2  PF11837  Domain of unknown function (DUF3357)
         10    8.5   6.7        2.9   10.2   2.1    1.9  1  PF07214  Protein of unknown function (DUF1418)
         34    6.9   0.0         64    6.0   0.0    1.4  1  PF11803  UDP-glucuronate decarboxylase N-terminal
         35    7.3   4.5         15    8.4   0.9    2.2  1  PF10518  TAT (twin-arginine translocation) pathway signal se
         50    5.3   1.0         94    4.4   0.7    1.8  1  PF08449  UAA transporter family
         52    6.4   0.6         77    5.9   0.4    1.3  1  PF07595  Planctomycete extracellular
         69    4.7   0.4         83    4.4   0.3    1.1  1  PF09847  Predicted permease (DUF2074)
         73    4.4   2.5         47    5.1   0.2    1.6  1  PF00421  Photosystem II protein
         93    5.4   0.1    1.6e+02    4.6   0.0    1.4  1  PF10161  Putative mitochondrial precursor protein
      1e+02    5.1   1.2    1.6e+02    4.4   0.9    1.3  1  PF03771  Domain of unknown function (DUF317)
    1.1e+02    4.7   1.6      3e+02    3.3   1.1    1.9  1  PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT
    1.5e+02    3.0   0.1    1.9e+02    2.6   0.1    1.2  1  PF03137  Organic Anion Transporter Polypeptide (OATP) family
    1.6e+02    5.1  13.8        1.2   11.9   3.0    2.2  1  PF11660  Protein of unknown function (DUF3262)
    1.8e+02    4.5   4.7    4.6e+02    3.3   3.3    1.8  1  PF03617  IBV 3A protein
    2.1e+02    3.9  11.7      3e+02    3.4   8.1    1.3  1  PF01925  Sulfite exporter TauE/SafE
      3e+02    3.9   0.1    5.9e+02    2.9   0.1    1.5  1  PF10177  Uncharacterised conserved protein (DUF2371)
      1e+03    1.4   5.3    5.8e+02    2.2   1.3    2.2  1  PF02038  ATP1G1/PLM/MAT8 family
    1.5e+03    1.1   8.8    1.7e+03    0.9   5.7    1.5  1  PF10003  Integral membrane protein (DUF2244)
    1.6e+03    1.4   8.1    1.4e+03    1.6   4.3    1.9  2  PF12270  Cytochrome c oxidase subunit IV
    1.9e+03    1.5   6.5    7.5e+03   -0.4   4.1    2.2  1  PF11317  Protein of unknown function (DUF3119)
    2.4e+03    0.5   2.2    5.3e+03   -0.6   1.5    1.5  1  PF05924  SAMP Motif
    2.8e+03    0.5   6.6    5.2e+03   -0.3   4.6    1.7  1  PF00060  Ligand-gated ion channel
    2.8e+03    0.9   5.2    4.5e+03    0.2   3.6    1.3  1  PF06210  Protein of unknown function (DUF1003)
    3.1e+03    0.6  16.1    1.6e+02    4.7   1.3    3.2  3  PF11381  Protein of unknown function (DUF3185)
    3.2e+03    0.8  11.3    4.2e+02    3.6   4.5    2.1  1  PF05101  Type IV secretory pathway, VirB3-like protein
    4.7e+03    1.0   3.7    9.5e+02    3.3   0.0    1.7  1  PF07790  Protein of unknown function (DUF1628)


Domain and alignment annotation for each model:
>> PF00893  Small Multidrug Resistance protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.8   1.6   1.8e-11   5.5e-08       4      93 .]       4     100 ..       1     100 [. 0.86

  Alignments for each domain:
  == domain 1    score: 35.8 bits;  conditional E-value: 1.8e-11
                 ------HHHHH--------......------..-------HHHHHHHHHHHHHHH-------HHHHH-----HHHHHHH----------------HHH CS
     PF00893   4 vllviAillevigailLkl......segftk..lipsllvivgygisfllLskalkslpvsvaYavwsGiGtvlttlvgillfgeslslkkliglali 93 
                 ++lv+A ll+v g++  k+      + g ++  + +  l+++++g++++l  + l++lpv++aY+++s + +v +tl+++ +++e++   +++g+ali
  ACF69516.1   4 IVLVLASLLSVGGQLCQKQatrpltTGGRRRhlMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLS-LNFVWVTLAAWKIWHEQVPPRHWLGVALI 100
                 789999999999999999999999644443322456778888************************97.89*************************98 PP

>> PF00892  EamA-like transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.7   9.0   6.8e-11     2e-07      49     124 ..      32     107 ..       1     109 [. 0.87

  Alignments for each domain:
  == domain 1    score: 33.7 bits;  conditional E-value: 6.8e-11
     PF00892  49 slkdilallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGvlll 124
                 +++ +   l l+l++++ +++l++  l+ +++++a +++sl  v+++l+++ +++e++ ++++lg++li+ G+++l
  ACF69516.1  32 RRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIIL 107
                 5667777899***************************************************************997 PP

>> PF10639  Uncharacterised protein family UPF0546
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.49   1.5e+03      97     112 ..      37      52 ..      23      53 .. 0.84
   2 !   21.1   0.3   4.5e-07    0.0014      54     112 ..      50     107 ..      40     108 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.49
     PF10639  97 ktvlgmllvlvgialc 112
                   +lg++l+++g a++
  ACF69516.1  37 MLWLGLALICMGAAMV 52 
                 5699********9986 PP

  == domain 2    score: 21.1 bits;  conditional E-value: 4.5e-07
     PF10639  54 gSvlfflllgkaelslavpiaNslafvfTvltelllgekvlkkktvlgmllvlvgialc 112
                 + vl+ l l+  ++ +a p+  sl+fv  +l ++ + ++++  + +lg++l++ gi+++
  ACF69516.1  50 AMVLWLLVLQTLPVGIAYPML-SLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIIL 107
                 669999*************97.9*********************************986 PP

>> PF03151  Triose-phosphate Transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.9   3.0   0.00028      0.84      47     149 ..       3     105 ..       1     107 [. 0.75

  Alignments for each domain:
  == domain 1    score: 11.9 bits;  conditional E-value: 0.00028
     PF03151  47 fivllpvlllvegpklgkssssikssdlssivryvlllllngvlafllnisaflllervSsltlsvagivkr.vlvivlsviifgdkitflnilGllia 144
                  ivl++++ll+ g +l +++ + + +++    r ++l l+ ++++ + +++  ll+ ++ ++ +    +  + v v ++++ i+++++ +  +lG +++
  ACF69516.1   3 GIVLVLASLLSVGGQLCQKQ-ATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNfVWVTLAAWKIWHEQVPPRHWLGVALI 100
                 45666665555554533333.34555566677999999********************999987776655551556778999***************** PP

     PF03151 145 llGvv 149
                 + G++
  ACF69516.1 101 ISGII 105
                 ***86 PP

>> PF02656  Domain of unknown function DUF
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.3    0.0079        24      41      65 ..      22      54 ..       1      58 [. 0.69
   2 ?    5.7   1.1     0.037   1.1e+02      48      66 ..      92     110 ..      58     111 .] 0.84

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0079
     PF02656 41 t........lrlrslgkplgltfiglailvlly 65
                +         r r+l  +lgl++i++++++ l+
  ACF69516.1 22 QatrplttgGRRRHLMLWLGLALICMGAAMVLW 54
                1334445567899***********999988775 PP

  == domain 2    score: 5.7 bits;  conditional E-value: 0.037
     PF02656  48 gkplgltfiglailvllyg 66 
                 +++lg+++i+ +i++l+ +
  ACF69516.1  92 RHWLGVALIISGIIILGSA 110
                 689************9866 PP

>> PF10099  Anti-sigma-K factor rskA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   1.5    0.0025       7.5      23      56 ..      27      60 ..       8     110 .. 0.79

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0025
     PF10099 23 arsarlwrrlrrWrglalaaaAaaavlalalllv 56
                 ++  ++r l +W glal ++ aa+vl+l++l +
  ACF69516.1 27 LTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT 60
                233334445666******9999999999999876 PP

>> PF07695  7TM diverse intracellular signalling
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   4.7    0.0028       8.5      96     164 ..      33     104 ..       2     110 .. 0.71

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0028
     PF07695  96 llklllllavllsllllllpll...pyteslslaqllallvilfllligikawrkgnkparyfllawlllli 164
                   +l+l+l ++l+++ +++ l+   ++t  + +a+ ++ l +++++l++ k+w ++ +p  ++ +a+++  i
  ACF69516.1  33 RRHLMLWLGLALICMGAAMVLWllvLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGI 104
                 33444444444444444444443369999999999******************9999999998777776555 PP

>> PF11837  Domain of unknown function (DUF3357)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.021        63      11      48 ..      18      58 ..      12      66 .. 0.73
   2 ?    0.8   0.0      0.94   2.9e+03      23      44 ..      91     109 ..      79     111 .] 0.78

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.021
     PF11837 11 Lpdgdesagepsarrrrpl...kvllavlsslllllllval 48
                L +++++++ ++  rrr l   ++l+++ ++++++l l +l
  ACF69516.1 18 LCQKQATRPLTTGGRRRHLmlwLGLALICMGAAMVLWLLVL 58
                66677777777888999776677777777777777766655 PP

  == domain 2    score: 0.8 bits;  conditional E-value: 0.94
     PF11837  23 arrrrplkvllavlssllllll 44 
                 +r++   +++++++s++++l +
  ACF69516.1  91 PRHW---LGVALIISGIIILGS 109
                 4555...899*******99987 PP

>> PF07214  Protein of unknown function (DUF1418)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.2   2.1   0.00095       2.9      17      71 ..       2      60 ..       1      71 [. 0.73

  Alignments for each domain:
  == domain 1    score: 10.2 bits;  conditional E-value: 0.00095
     PF07214 17 lGllllvvaylslndyl...slPaelasp.taailmiflGvvlmlPaavvlvwrvaqll 71
                +G++l+  ++ls+   l   +   +l++  +   lm++lG++l+   a++++w ++ + 
  ACF69516.1  2 IGIVLVLASLLSVGGQLcqkQATRPLTTGgRRRHLMLWLGLALICMGAAMVLWLLVLQT 60
                89999999999998877222233344443145689**********99999999877554 PP

>> PF11803  UDP-glucuronate decarboxylase N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.021        64       6      28 ..      24      46 ..      19      55 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.021
     PF11803  6 lerlvvgiNRrmmklllalalia 28
                 + l++g  Rr + l l+lali 
  ACF69516.1 24 TRPLTTGGRRRHLMLWLGLALIC 46
                55689999*************97 PP

>> PF10518  TAT (twin-arginine translocation) pathway signal sequence
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.9    0.0051        15       4      25 ..      33      54 ..      32      55 .. 0.93

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0051
     PF10518  4 RRqfLkggaaaaAaaalggala 25
                RR+++ +++ a  +++++++l+
  ACF69516.1 33 RRHLMLWLGLALICMGAAMVLW 54
                ******************9886 PP

>> PF08449  UAA transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.7     0.031        94     272     294 ..      84     106 ..       2     109 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.031
     PF08449 272 lFgnpltlqqwlGtllVflgill 294
                 +++ ++ +++wlG++l+++gi++
  ACF69516.1  84 IWHEQVPPRHWLGVALIISGIII 106
                 56677889999999999999975 PP

>> PF07595  Planctomycete extracellular
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.4     0.026        77       2      18 ..      22      38 ..      21      38 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.026
     PF07595  2 rrrrrrrrrsrRRRLrl 18
                +++r+ +   rRR+L+l
  ACF69516.1 22 QATRPLTTGGRRRHLML 38
                7889999999*****96 PP

>> PF09847  Predicted permease (DUF2074)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.3     0.027        83     360     418 ..      49     107 ..      35     111 .] 0.73

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.027
     PF09847 360 ykgtnalyllilllspllvvlisllivlnrlgaetinlpslgvlafivlfilsliivgi 418
                  +    l++l  l++ +++ ++sl +v   l a +i  +++ +  ++ + +++  i+++
  ACF69516.1  49 AAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIIL 107
                 3334456677789999*************9***********999999776555555544 PP

>> PF00421  Photosystem II protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.2     0.016        47     212     238 ..      83     109 ..      72     111 .] 0.83

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.016
     PF00421 212 GifHllvrPlerlkkalvgsieavLsy 238
                  i+H  v+P ++l  al+ s+  +L +
  ACF69516.1  83 KIWHEQVPPRHWLGVALIISGIIILGS 109
                 59*****************99988876 PP

>> PF10161  Putative mitochondrial precursor protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.054   1.6e+02      41      62 ..       2      23 ..       1      25 [. 0.90

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.054
     PF10161 41 lkiilvvipgLyiGalisknvA 62
                ++i+lv ++ L +G+++ ++ A
  ACF69516.1  2 IGIVLVLASLLSVGGQLCQKQA 23
                789**************99988 PP

>> PF03771  Domain of unknown function (DUF317)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.9     0.054   1.6e+02      20      35 ..      80      94 ..      77      95 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.054
     PF03771 20 aaWtiaattssgrpaW 35
                aaW+i+++   ++++W
  ACF69516.1 80 AAWKIWHE-QVPPRHW 94
                79***555.5666777 PP

>> PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   1.1       0.1     3e+02      25      37 ..      47      59 ..      28      62 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.1
                ------HHHHHHH CS
     PF10399 25 VGaaaaawPlIdq 37
                 Gaa+++w l+ q
  ACF69516.1 47 MGAAMVLWLLVLQ 59
                69******98876 PP

>> PF03137  Organic Anion Transporter Polypeptide (OATP) family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1     0.064   1.9e+02      62      86 ..      31      55 ..      11      63 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.064
                xxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF03137 62 gsrvhrprligiGlllmalgsllla 86
                g r h   ++g+ l++m+++++l  
  ACF69516.1 31 GRRRHLMLWLGLALICMGAAMVLWL 55
                7899999************999865 PP

>> PF11660  Protein of unknown function (DUF3262)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.9   3.0   0.00038       1.2      19      67 ..      57     106 ..      49     109 .. 0.77

  Alignments for each domain:
  == domain 1    score: 11.9 bits;  conditional E-value: 0.00038
     PF11660  19 alstlilgivlavllLwaaWallsaYrGwanekldeaall..klairlvll 67 
                 +l+tl +gi+  +l L ++W++l a++ w+++ +  ++ l  +l+i ++++
  ACF69516.1  57 VLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQ-VPPRHWLgvALIISGIII 106
                 689999************************95.555554400455555554 PP

>> PF03617  IBV 3A protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   3.3      0.15   4.6e+02      14      34 ..      37      57 ..      35      80 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.15
     PF03617 14 lLWfkLvlsCfrecviaLqqL 34
                +LW+ L+l+C+   ++    +
  ACF69516.1 37 MLWLGLALICMGAAMVLWLLV 57
                8*********98777654444 PP

>> PF01925  Sulfite exporter TauE/SafE
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   8.1     0.097     3e+02      61     135 ..      31     106 ..       1     111 [] 0.40

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.097
     PF01925  61 vdwr.lllplllg.allGallGalllsllpsellkllfgvlllllallmllrkkraaekgrlrrpslilllllgglv 135
                 ++ r l+l+l+l+ + +Ga+   +ll  l +  + +++++l l +++  l ++k  +e+  +r++ +++l++ g+++
  ACF69516.1  31 GRRRhLMLWLGLAlICMGAAMVLWLLV-LQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIII 106
                 233424455544413334444333333.3333356666666666666665555554443233333333333334443 PP

>> PF10177  Uncharacterised conserved protein (DUF2371)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1       0.2   5.9e+02      41      57 ..      36      52 ..      23      55 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.2
     PF10177 41 lvlilGvlvllvGiama 57
                l+l lG+ ++++G+am 
  ACF69516.1 36 LMLWLGLALICMGAAMV 52
                57899**********96 PP

>> PF02038  ATP1G1/PLM/MAT8 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   1.3      0.19   5.8e+02      23      35 ..      97     109 ..      94     111 .] 0.81

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.19
                 CCCTT---CCCCC CS
     PF02038  23 gvLfivGiliilS 35 
                 + L i Gi+i+ S
  ACF69516.1  97 VALIISGIIILGS 109
                 668899****998 PP

>> PF10003  Integral membrane protein (DUF2244)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   5.7      0.56   1.7e+03       9      38 ..      32      63 ..      25      89 .. 0.68

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.56
     PF10003  9 prgfllfllalallsllialaflllga..wpv 38
                +r  l+++l+lal+++++a++++ll +   pv
  ACF69516.1 32 RRRHLMLWLGLALICMGAAMVLWLLVLqtLPV 63
                67778889999999999999999887733333 PP

>> PF12270  Cytochrome c oxidase subunit IV
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   4.3      0.47   1.4e+03      93     130 ..      37      74 ..      34      81 .. 0.79
   2 ?    0.0   0.1       1.4   4.2e+03      14      46 ..      74     104 ..      66     108 .. 0.52

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.47
     PF12270  93 vlalavavlalglalglWlvligvvlvilavvglvfeY 130
                 +l l +a++++g a++lWl+++  + v +a  +l +++
  ACF69516.1  37 MLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNF 74 
                 6667899*************998887777766666655 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 1.4
     PF12270  14 FfvvvavvYlfltslvedevewvGtvalvlaal 46 
                 F+ v+ + + +++++v     w G val+++++
  ACF69516.1  74 FVWVTLAAWKIWHEQV-PPRHWLG-VALIISGI 104
                 3344444445555533.3337777.45665554 PP

>> PF11317  Protein of unknown function (DUF3119)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   4.1       2.5   7.5e+03      67      84 ..      73      90 ..      33      95 .. 0.70

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 2.5
     PF11317 67 rfpysewlnWrlfwpklP 84
                +f + +  +W+++ +++P
  ACF69516.1 73 NFVWVTLAAWKIWHEQVP 90
                677888888999999988 PP

>> PF05924  SAMP Motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   1.5       1.7   5.3e+03       9      14 ..      46      51 ..      46      51 .. 0.97

  Alignments for each domain:
  == domain 1    score: -0.6 bits;  conditional E-value: 1.7
     PF05924  9 CIssAM 14
                C ++AM
  ACF69516.1 46 CMGAAM 51
                9***** PP

>> PF00060  Ligand-gated ion channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.3   4.6       1.7   5.2e+03       3      31 ..      37      66 ..      35     107 .. 0.72

  Alignments for each domain:
  == domain 1    score: -0.3 bits;  conditional E-value: 1.7
                ----------------------.------- CS
                xxxxxxxxxxxxxxxxxxxxxx.xxxxxxx RF
     PF00060  3 evWlsvlaayllvsivlflver.fspyewr 31
                 +Wl +++++++ ++vl+l+     p  + 
  ACF69516.1 37 MLWLGLALICMGAAMVLWLLVLqTLPVGIA 66
                68****************875435555555 PP

>> PF06210  Protein of unknown function (DUF1003)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   3.6       1.5   4.5e+03       7      48 ..      44      82 ..      42      85 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.5
     PF06210  7 vvlftavvilWialNllvlirlaFDpypFilLnLvlSlqAay 48
                ++++ a ++lW+++  +++++     yp   Ln+v  ++Aa 
  ACF69516.1 44 LICMGAAMVLWLLVLQTLPVGI---AYPMLSLNFVWVTLAAW 82
                588999*******999999998...79999999999998885 PP

>> PF11381  Protein of unknown function (DUF3185)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.3      0.47   1.4e+03       2      31 ..       1      25 [.       1      40 [. 0.67
   2 ?    3.2   0.9      0.16     5e+02       3      17 ..      40      54 ..      39      59 .. 0.90
   3 ?    4.7   1.3     0.054   1.6e+02       3      15 ..      95     107 ..      93     110 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.47
     PF11381  2 iiGivLlvvGivLlifGyqasdslesqvtr 31
                +iGivL+   + Ll  G q+ +    q+tr
  ACF69516.1  1 MIGIVLVL--ASLLSVGGQLCQK---QATR 25
                58888877..4677777777665...5555 PP

  == domain 2    score: 3.2 bits;  conditional E-value: 0.16
     PF11381  3 iGivLlvvGivLlif 17
                +G++L+ +G++++++
  ACF69516.1 40 LGLALICMGAAMVLW 54
                79********99988 PP

  == domain 3    score: 4.7 bits;  conditional E-value: 0.054
     PF11381   3 iGivLlvvGivLl 15 
                 +G++L++ Gi+ l
  ACF69516.1  95 LGVALIISGIIIL 107
                 7999999999876 PP

>> PF05101  Type IV secretory pathway, VirB3-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   4.5      0.14   4.2e+02      13      54 ..      23      70 ..      19      82 .. 0.57

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.14
     PF05101 13 ltRpalllGvprel......vlfsgllavlliliissllaaligvllw 54
                +tRp ++ G  r l      +l+++++a++l l++ + l + i+ +++
  ACF69516.1 23 ATRPLTTGGRRRHLmlwlglALICMGAAMVLWLLVLQTLPVGIAYPML 70
                456666666555550000005566666666666666666666666665 PP

>> PF07790  Protein of unknown function (DUF1628)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.31   9.5e+02      12      28 ..       1      15 [.       1      29 [. 0.72

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.31
     PF07790 12 mvaitvIlaAviaafvf 28
                m+ i+++la+ +++  +
  ACF69516.1  1 MIGIVLVLASLLSV--G 15
                999******99875..4 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (111 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       490  (0.041135); expected 238.2 (0.02)
Passed bias filter:                      269  (0.0225823); expected 238.2 (0.02)
Passed Vit filter:                        42  (0.00352586); expected 11.9 (0.001)
Passed Fwd filter:                        42  (0.00352586); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              33  [number of targets reported over threshold]
# CPU time: 0.20u 0.03s 00:00:00.23 Elapsed: 00:00:00
# Mc/sec: 1198.19
//