# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_26724.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF69765.1  [L=115]
Description: sent8 ACF69765.1 GIB00763CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      5e-50  171.4   0.1    5.8e-50  171.2   0.1    1.0  1  PF07037  Putative transcription regulator (DUF1323)
     0.0011   21.4   0.3      0.002   20.5   0.2    1.4  1  PF02316  Mu DNA-binding domain
     0.0057   19.1   0.0      0.011   18.2   0.0    1.5  1  PF01381  Helix-turn-helix
  ------ inclusion threshold ------
       0.18   14.0   0.0       0.36   13.0   0.0    1.5  1  PF06056  Putative ATPase subunit of terminase (gpP-like)
       0.51   12.3   0.0       0.57   12.1   0.0    1.1  1  PF06466  PCAF (P300/CBP-associated factor) N-terminal domain
       0.96   11.8   0.0        2.1   10.7   0.0    1.6  1  PF10075  COP9 signalosome, subunit CSN8
        1.6   10.4   0.0        2.2    9.9   0.0    1.3  1  PF03668  P-loop ATPase protein family
        2.5   10.8   0.1         19    8.0   0.0    2.0  2  PF03374  Phage antirepressor protein KilAC domain
        2.7   10.5   0.0        4.2    9.8   0.0    1.4  1  PF10668  Phage terminase small subunit
        5.3    9.5   0.0        9.2    8.7   0.0    1.5  1  PF05930  Prophage CP4-57 regulatory protein (AlpA)
        6.4    8.9   0.1         14    7.8   0.0    1.6  1  PF05494  Toluene tolerance, Ttg2
          8    9.2   0.2         25    7.6   0.0    1.9  1  PF11656  Competence regulator Spx (YjbD)
        8.4    6.4   0.1        9.7    6.2   0.1    1.0  1  PF04523  Herpes virus tegument protein U30
         11    8.7   0.2    2.6e+02    4.2   0.0    2.3  2  PF03937  Protein of unknown function (DUF339)
         12    8.2   0.0         24    7.2   0.0    1.6  1  PF06806  Putative excisionase (DUF1233)
         13    8.3   0.0         21    7.7   0.0    1.6  1  PF06844  Protein of unknown function (DUF1244)
         15    7.8   0.0         73    5.6   0.0    2.0  1  PF05344  Domain of Unknown Function (DUF746)
         15    7.9   0.0    2.7e+02    3.8   0.0    2.4  2  PF04967  HTH DNA binding domain
         16    8.1   0.3         32    7.2   0.1    1.5  1  PF10025  Uncharacterized conserved protein (DUF2267)
         16    8.1   0.0         31    7.1   0.0    1.4  1  PF07453  NUMOD1 domain
         19    6.3   0.0         21    6.2   0.0    1.1  1  PF08933  Domain of unknown function (DUF1864)
         19    7.8   0.1         40    6.7   0.0    1.6  1  PF08831  Class II MHC-associated invariant chain trimerisati
         19    7.6   0.0         39    6.6   0.0    1.6  1  PF08279  HTH domain
         25    7.5   0.2         40    6.9   0.1    1.6  1  PF01527  Transposase
         29    6.4   0.0         48    5.7   0.0    1.4  1  PF07894  Protein of unknown function (DUF1669)
         42    6.3   0.0      1e+02    5.0   0.0    1.6  1  PF02260  FATC domain
         43    6.5   0.0         57    6.1   0.0    1.3  1  PF04936  Protein of unknown function (DUF658)
         45    6.9   0.0         47    6.9   0.0    1.1  1  PF03234  Cdc37 N terminal kinase binding
         45    6.6   0.0         65    6.1   0.0    1.2  1  PF01951  Archease protein family (DUF101/UPF0211)
         51    6.3   0.0    1.9e+02    4.4   0.0    1.9  1  PF01978  Sugar-specific transcriptional regulator TrmB
         52    6.7   0.1    2.2e+02    4.7   0.0    2.0  1  PF09550  Conserved hypothetical phage protein (DUF2376)
         53    6.4   0.0         68    6.1   0.0    1.1  1  PF09747  Coiled-coil domain containing protein (DUF2052)
         62    6.0   0.0         96    5.4   0.0    1.4  1  PF00210  Ferritin-like domain
         66    5.3   0.0         74    5.2   0.0    1.1  1  PF11428  Protein of unknown function (DUF3196)
         67    5.8   0.0    1.3e+02    4.8   0.0    1.5  1  PF00376  MerR family regulatory protein
         69    5.7   0.0    1.6e+02    4.6   0.0    1.6  1  PF08220  DeoR-like helix-turn-helix domain
         70    5.5   0.2    1.1e+02    4.9   0.1    1.3  1  PF05235  CHAD domain
         78    5.5   0.0         98    5.2   0.0    1.1  1  PF06335  Protein of unknown function (DUF1054)
         79    5.9   0.0    1.1e+02    5.4   0.0    1.2  1  PF09025  YopR Core
         82    5.8   0.0         94    5.6   0.0    1.3  1  PF08785  Ku C terminal domain like
         84    5.0   0.1    1.2e+02    4.5   0.1    1.4  1  PF12082  Domain of unknown function (DUF3559)
    1.1e+02    4.9   0.0      2e+02    4.1   0.0    1.4  1  PF00325  Bacterial regulatory proteins, crp family
    1.2e+02    5.1   0.0    2.7e+02    4.0   0.0    1.6  1  PF01047  MarR family
    1.3e+02    3.9   0.0    1.5e+02    3.7   0.0    1.1  1  PF01905  CRISPR-associated negative autoregulator DevR/Csa2
    1.4e+02    5.3   0.0    2.6e+02    4.4   0.0    1.4  1  PF02236  Viral DNA-binding protein, all alpha domain
    1.5e+02    5.0   0.0    2.8e+02    4.1   0.0    1.5  1  PF03201  H2-forming N5,N10-methylene-tetrahydromethanopterin
    1.5e+02    5.1   0.0    3.1e+02    4.0   0.0    1.5  1  PF10135  Rod binding protein
    1.6e+02    4.6   0.3    3.2e+02    3.6   0.2    1.4  1  PF03869  Arc-like DNA binding domain
    1.9e+02    3.7   0.1    5.6e+02    2.2   0.0    1.6  1  PF00079  Serpin (serine protease inhibitor)
      2e+02    4.0   0.0    3.2e+02    3.4   0.0    1.2  1  PF01176  Translation initiation factor 1A / IF-1
    2.1e+02    4.1   0.0    4.9e+02    2.9   0.0    1.7  1  PF10304  Domain of unknown function (DUF2411)
    2.2e+02    4.1   0.1    7.9e+02    2.4   0.0    1.9  1  PF06429  Domain of unknown function (DUF1078)
    3.3e+02    3.0   0.0    5.2e+02    2.3   0.0    1.3  1  PF05216  UNC-50 family
    4.2e+02    2.5   0.0    6.8e+02    1.8   0.0    1.2  1  PF01297  Periplasmic solute binding protein family
    6.7e+02    1.8   0.0    8.1e+02    1.6   0.0    1.1  1  PF10250  GDP-fucose protein O-fucosyltransferase
      7e+02    3.5   0.0    9.9e+02    3.0   0.0    1.3  1  PF06458  MucBP domain
    1.1e+03    2.1   0.3    1.8e+03    1.5   0.2    1.3  1  PF04021  Class III signal peptide


Domain and alignment annotation for each model:
>> PF07037  Putative transcription regulator (DUF1323)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  171.2   0.1   3.3e-53   5.8e-50       1     122 []       1     114 [.       1     114 [. 0.96

  Alignments for each domain:
  == domain 1    score: 171.2 bits;  conditional E-value: 3.3e-53
     PF07037   1 mtpeelaellGyarqtinrWvRkegWkteplpGvkGGkarlihideqvrefirnaealrnsaalyrveeepaey.avtedaeleallietleeltpseq 98 
                 mtpeela+l+Gy+rqtin+WvRkegW t+p+pGv+GGkarl+h++eqvre+ir+ae         r  +++a++ + +++a+leall+++++e+t+seq
  ACF69765.1   1 MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAE---------RSVDHHADTfTPASNASLEALLMTLAKEMTSSEQ 90 
                 9*******************************************************.........77777777768999******************** PP

     PF07037  99 kklaelllreGiagllkRLgirde 122
                 k++++ll+reGi+gll+RLgird+
  ACF69765.1  91 KQFTSLLVREGITGLLQRLGIRDS 114
                 **********************96 PP

>> PF02316  Mu DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   20.5   0.2   1.1e-06     0.002       2     112 ..       5     106 ..       4     114 .. 0.77

  Alignments for each domain:
  == domain 1    score: 20.5 bits;  conditional E-value: 1.1e-06
                 CHTT-----SS----CCHHCC----EEEE-------EEEEECCCS-HHHHHHHHHC----SS-----------TTS-SS-HHHHHHHHHCS-HHHHHHH CS
     PF02316   2 elaglPGlPktaagvtkkAkkegWkkrkreGvkGGkavEYdvnslPketraallkrlGlietgaalsekarktelvetldeelitakeelapDeqrkal 100
                 ela+l G     + + k  +kegW    + Gv+GGka   +vn   ++ r+ +      ++  a  +  a        l++ l+t  +e+++ eq++  
  ACF69765.1   5 ELANLTGY--SRQTINKWVRKEGWATSPKPGVQGGKARLVHVN---EQVREYIRSAERSVDHHADTFTPAS----NASLEALLMTLAKEMTSSEQKQFT 94 
                 78899998..778899*************************99...5666433332222444444443333....3457788899999999******** PP

                 HHH....H.... CS
     PF02316 101 ellskaGlkalm 112
                  ll + G+ +l+
  ACF69765.1  95 SLLVREGITGLL 106
                 ***999999997 PP

>> PF01381  Helix-turn-helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   18.2   0.0   6.2e-06     0.011      10      35 ..       1      26 [.       1      31 [. 0.88

  Alignments for each domain:
  == domain 1    score: 18.2 bits;  conditional E-value: 6.2e-06
                -THHHHHHHHTS-HHHHHHHHTTSSG CS
     PF01381 10 lsqeeLAeklGvsrstisriEnGern 35
                ++ eeLA ++G sr+ti+++ + e +
  ACF69765.1  1 MTPEELANLTGYSRQTINKWVRKEGW 26
                6889*****************98765 PP

>> PF06056  Putative ATPase subunit of terminase (gpP-like)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.0   0.0   0.00021      0.36      15      40 ..       2      27 ..       1      32 [. 0.92

  Alignments for each domain:
  == domain 1    score: 13.0 bits;  conditional E-value: 0.00021
     PF06056 15 rpaeIAeelglkertvysWkdrdkwd 40
                +p e A   g +++t+  W+++++w+
  ACF69765.1  2 TPEELANLTGYSRQTINKWVRKEGWA 27
                68999999*****************8 PP

>> PF06466  PCAF (P300/CBP-associated factor) N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.0   0.00032      0.57      15      89 ..       3      79 ..       1      95 [. 0.86

  Alignments for each domain:
  == domain 1    score: 12.1 bits;  conditional E-value: 0.00032
     PF06466 15 akkleklgvysackaeesckcnGwkn.pkesta.rrrdleqsiaelseecrscehalashvshlenvseeelnrllG 89
                ++ l+ l+ ys    ++  + +Gw + pk+     +  l ++  ++ e  rs e ++ +h   +   s+ +l+ ll 
  ACF69765.1  3 PEELANLTGYSRQTINKWVRKEGWATsPKPGVQgGKARLVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLM 79
                678999******************86377765557778888899999************************999985 PP

>> PF10075  COP9 signalosome, subunit CSN8
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.7   0.0    0.0012       2.1      99     134 ..       2      43 ..       1      52 [. 0.79

  Alignments for each domain:
  == domain 1    score: 10.7 bits;  conditional E-value: 0.0012
     PF10075  99 saevlaelLglssdeelekfvvekgWeld.......sdtvllp 134
                 ++e+la+l g s ++++ k+v + gW  +       ++ +l++
  ACF69765.1   2 TPEELANLTGYS-RQTINKWVRKEGWATSpkpgvqgGKARLVH 43 
                 789*********.*************99866666655555555 PP

>> PF03668  P-loop ATPase protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.0    0.0013       2.2     248     278 ..      33      62 ..      12      67 .. 0.90

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.0013
     PF03668 248 GctGGkhrsvaiaeqladyfrsdgktvvarh 278
                 G  GGk r v + eq+ +y+rs ++ v  +h
  ACF69765.1  33 GVQGGKARLVHVNEQVREYIRSAERSVD-HH 62 
                 789*******************998877.55 PP

>> PF03374  Phage antirepressor protein KilAC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0     0.011        19      28      53 ..       4      29 ..       1      69 [. 0.79
   2 ?    1.1   0.0       1.5   2.6e+03      25      50 ..      76     102 ..      61     104 .. 0.69

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.011
     PF03374 28 gdlAkllgigenrlfklLrengilyk 53
                ++lA l g ++++++k+ r++g+  +
  ACF69765.1  4 EELANLTGYSRQTINKWVRKEGWATS 29
                6899999****************876 PP

  == domain 2    score: 1.1 bits;  conditional E-value: 1.5
     PF03374  25 vlvgdlAkllgig.enrlfklLrengi 50 
                  l+ +lAk++  + ++++  lL ++gi
  ACF69765.1  76 ALLMTLAKEMTSSeQKQFTSLLVREGI 102
                 567789999966526666677766665 PP

>> PF10668  Phage terminase small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.0    0.0024       4.2      26      51 ..       4      29 ..       1      49 [. 0.85

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0024
     PF10668 26 kdIAnkLnvsesqirkWKskdkWdek 51
                 ++An  + s ++i kW  k+ W   
  ACF69765.1  4 EELANLTGYSRQTINKWVRKEGWATS 29
                6899*******************875 PP

>> PF05930  Prophage CP4-57 regulatory protein (AlpA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.0    0.0053       9.2       8      27 ..       5      24 ..       2      52 .. 0.85

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0053
     PF05930  8 eviqltGlsrstiYrlikdg 27
                e+  ltG+sr+ti +++++ 
  ACF69765.1  5 ELANLTGYSRQTINKWVRKE 24
                8899***********99865 PP

>> PF05494  Toluene tolerance, Ttg2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0     0.008        14     142     166 ..      85     109 ..      78     113 .. 0.91

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.008
     PF05494 142 lvqtyrsqfssilrknGidgliakL 166
                 + +++++qf+s+l ++Gi gl+++L
  ACF69765.1  85 MTSSEQKQFTSLLVREGITGLLQRL 109
                 67899*****************998 PP

>> PF11656  Competence regulator Spx (YjbD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0     0.014        25       6      23 ..      82      99 ..      78     104 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.014
     PF11656  6 lkdltEsEqrelktlLdk 23
                 k++t sEq++ + lL +
  ACF69765.1 82 AKEMTSSEQKQFTSLLVR 99
                59***********99966 PP

>> PF04523  Herpes virus tegument protein U30
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.1    0.0055       9.7     200     248 ..      46      94 ..      37     101 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.0055
     PF04523 200 aanaelkelaqklvtnhkelfaplsssdetliqlplakrradeiykifs 248
                 ++++e    a++ v++h ++f+p s+ + +++ + lak++     k+f+
  ACF69765.1  46 EQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFT 94 
                 56677778999***************************99876666665 PP

>> PF03937  Protein of unknown function (DUF339)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.67   1.2e+03      19      38 ..      59      78 ..      56      81 .. 0.91
   2 ?    4.2   0.0      0.15   2.6e+02      24      38 ..      83      97 ..      79     100 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.67
                HHHHHHH--HHHHHHHHHHH CS
     PF03937 19 adkhletlseeeldaferLL 38
                +d+h +t++ +  + +e+LL
  ACF69765.1 59 VDHHADTFTPASNASLEALL 78
                699**************998 PP

  == domain 2    score: 4.2 bits;  conditional E-value: 0.15
                HH--HHHHHHHHHHH CS
     PF03937 24 etlseeeldaferLL 38
                ++++ +e+++f +LL
  ACF69765.1 83 KEMTSSEQKQFTSLL 97
                689***********9 PP

>> PF06806  Putative excisionase (DUF1233)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0     0.014        24      55      68 ..      10      23 ..       1      28 [. 0.71

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.014
     PF06806 55 ilYnleeInkwier 68
                + Y +++Inkw+++
  ACF69765.1 10 TGYSRQTINKWVRK 23
                45999999999986 PP

>> PF06844  Protein of unknown function (DUF1244)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.012        21       5      25 ..       5      25 ..       4      76 .. 0.91

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.012
                HHHHHHS--HHHHHHHHHHHH CS
     PF06844  5 dLmnlagFCRNCLskWykeaa 25
                +L nl+g+ R  + kW+++++
  ACF69765.1  5 ELANLTGYSRQTINKWVRKEG 25
                689**************9986 PP

>> PF05344  Domain of Unknown Function (DUF746)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.042        73      17      36 ..       4      23 ..       2      25 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.042
     PF05344 17 aeaadqlgtdegiiakwvre 36
                +e+a++ g + ++i+kwvr+
  ACF69765.1  4 EELANLTGYSRQTINKWVRK 23
                5899**************96 PP

>> PF04967  HTH DNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.16   2.7e+02      27      46 ..       4      23 ..       1      24 [. 0.90
   2 ?    1.2   0.0         1   1.8e+03      39      51 ..      47      59 ..      44      59 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.16
     PF04967 27 keLAkelGiskstlsehLrk 46
                +eLA+  G s++t+ + +rk
  ACF69765.1  4 EELANLTGYSRQTINKWVRK 23
                79************999987 PP

  == domain 2    score: 1.2 bits;  conditional E-value: 1
     PF04967 39 tlsehLrkAeskl 51
                 + e++r+Ae+ +
  ACF69765.1 47 QVREYIRSAERSV 59
                5789******975 PP

>> PF10025  Uncharacterized conserved protein (DUF2267)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.1     0.018        32      24      52 ..      72     100 ..      57     110 .. 0.80

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.018
     PF10025  24 ralravLetLadrlsgeeaadLaaqLPee 52 
                   l+a L tLa+ ++++e++++ + L +e
  ACF69765.1  72 ASLEALLMTLAKEMTSSEQKQFTSLLVRE 100
                 4589****************999887655 PP

>> PF07453  NUMOD1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.018        31      21      35 ..       5      19 ..       4      20 .. 0.94

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.018
     PF07453 21 eAAkaLgishktInk 35
                e+A+  g+s+ tInk
  ACF69765.1  5 ELANLTGYSRQTINK 19
                89************8 PP

>> PF08933  Domain of unknown function (DUF1864)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.012        21     314     360 ..      37      83 ..      17      98 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.012
     PF08933 314 GetAlqhheqlvekfiakpskqleqqhlskvtasGpplevllesLek 360
                 G+  l h+++ v  +i +  ++++++  + + as   le+ll  L k
  ACF69765.1  37 GKARLVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAK 83 
                 667799***********999999998888899**********99987 PP

>> PF08831  Class II MHC-associated invariant chain trimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.023        40      18      48 ..      65      95 ..      43      99 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.023
                ---------HHHHHHHHHHHS-HHHHHHHHH CS
     PF08831 18 kvfPqlketlleNLksLKktmdevdWksfEs 48
                   P+ +++l + L +L k+m++++ k+f s
  ACF69765.1 65 TFTPASNASLEALLMTLAKEMTSSEQKQFTS 95
                34699999*********************88 PP

>> PF08279  HTH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.022        39      17      34 ..       2      19 ..       1      23 [. 0.88

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.022
     PF08279 17 sgeeLAeeLnVSrrtirr 34
                + eeLA  ++ Sr+ti +
  ACF69765.1  2 TPEELANLTGYSRQTINK 19
                679*************98 PP

>> PF01527  Transposase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.1     0.023        40      28      54 ..       5      29 ..       2      86 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.023
     PF01527 28 evArehGvsaaqLykWrkqaregllal 54
                e+A   G s++++ kW+++       +
  ACF69765.1  5 ELANLTGYSRQTINKWVRKEG--WATS 29
                78888999**********953..3333 PP

>> PF07894  Protein of unknown function (DUF1669)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.027        48     126     158 ..      35      67 ..      18      72 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.027
     PF07894 126 qppkekapsikevvRrliqeaqkviavvmDvft 158
                 q  k +  ++ e+vR+ i++a++ +    D+ft
  ACF69765.1  35 QGGKARLVHVNEQVREYIRSAERSVDHHADTFT 67 
                 556677899*************99998888888 PP

>> PF02260  FATC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.058     1e+02       5      16 ..      44      55 ..      41      56 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.058
     PF02260  5 veqQVdrLIseA 16
                v++QV++ I++A
  ACF69765.1 44 VNEQVREYIRSA 55
                9********998 PP

>> PF04936  Protein of unknown function (DUF658)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.032        57      16      44 ..       2      31 ..       1      70 [. 0.76

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.032
     PF04936 16 tideladyldlsrnsislwi.knGkdpkka 44
                t +ela++   sr++i  w+ k+G + +++
  ACF69765.1  2 TPEELANLTGYSRQTINKWVrKEGWATSPK 31
                6689****************5678887765 PP

>> PF03234  Cdc37 N terminal kinase binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.027        47      82     134 ..      43      95 ..      13     108 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.027
     PF03234  82 kvlkklneeadkedkasveeeeeeqpkynemledLldqvkdevdekkaaklie 134
                 +v +++ e   + ++++++++++ +p  n  le+Ll ++ +e+ +++++++++
  ACF69765.1  43 HVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTS 95 
                 56778888888999999**********************88888877776665 PP

>> PF01951  Archease protein family (DUF101/UPF0211)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.037        65       3      31 ..      58      86 ..      57      92 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.037
                ----SSEEEEEE----CHHHHHHHHHHHH CS
     PF01951  3 yldhtADvileaqGksleealesaaialf 31
                 +dh+AD +  a  +sle +l  +a+ ++
  ACF69765.1 58 SVDHHADTFTPASNASLEALLMTLAKEMT 86
                58********************9999887 PP

>> PF01978  Sugar-specific transcriptional regulator TrmB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0      0.11   1.9e+02      23      45 ..       1      23 [.       1      23 [. 0.92

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.11
     PF01978 23 atadeiaeelgvprskvyevLrs 45
                +t +e+a+ +g +r+++++ +r+
  ACF69765.1  1 MTPEELANLTGYSRQTINKWVRK 23
                7999**************99875 PP

>> PF09550  Conserved hypothetical phage protein (DUF2376)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0      0.13   2.2e+02      11      22 ..       1      12 [.       1      19 [. 0.84

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.13
     PF09550 11 lTPaELaallga 22
                +TP+ELa l+g 
  ACF69765.1  1 MTPEELANLTGY 12
                8*****988875 PP

>> PF09747  Coiled-coil domain containing protein (DUF2052)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.039        68      32      77 ..      46      91 ..      41     102 .. 0.71

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.039
     PF09747 32 elvgrflteeereargraerkseslsavLvsklereeakleleeeq 77
                e v+ +++++er+ +++a++   + +a L++ l+   ++++ +e++
  ACF69765.1 46 EQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQK 91
                679************9999776655555555555555555544433 PP

>> PF00210  Ferritin-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.054        96      92     116 ..      41      65 ..       5      70 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.054
                 HHHHHHHHHHHHHHHHHTT-HHHHH CS
     PF00210  92 ekevtkslreliklaeeekDpatad 116
                  ++v++++re i++ae+  D++   
  ACF69765.1  41 LVHVNEQVREYIRSAERSVDHHADT 65 
                 579***************9*99765 PP

>> PF11428  Protein of unknown function (DUF3196)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.042        74     119     156 ..      68     105 ..      40     112 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.042
                 TTTGGGGGGSTTS-TTSS-GGGGGGTHHHHT-TTS-HH CS
     PF11428 119 peklalleyllekeknfvnvsdlkfldsvltdkellel 156
                 p + a le ll+  ++++  s+ k ++s+l+ + + +l
  ACF69765.1  68 PASNASLEALLMTLAKEMTSSEQKQFTSLLVREGITGL 105
                 4477889***********************99888765 PP

>> PF00376  MerR family regulatory protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.076   1.3e+02       2      22 ..       3      23 ..       2      25 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.076
                HHHHHHHHT--HHHHHHHHHT CS
     PF00376  2 IgevAeltGvsprtLRyYere 22
                  e+A ltG s +t+  + r+
  ACF69765.1  3 PEELANLTGYSRQTINKWVRK 23
                679************888776 PP

>> PF08220  DeoR-like helix-turn-helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.089   1.6e+02      18      31 ..       4      17 ..       1      22 [. 0.91

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.089
     PF08220 18 eelvellgvSeaTi 31
                eel++l g+S +Ti
  ACF69765.1  4 EELANLTGYSRQTI 17
                89***********9 PP

>> PF05235  CHAD domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.062   1.1e+02      69     122 ..      56     109 ..      39     113 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.062
                 HHHHHHHHHTHH-TTTCGGGHHHHHHHHHHH.HHHHHHHHHHH--------HHHH CS
     PF05235  69 aRDldVllerlepaleqealkallerlearr.rrahkrllaaldserytallqal 122
                  R  d  ++++ pa++++ l+all  l+++   +++k+  + l  e +t llq+l
  ACF69765.1  56 ERSVDHHADTFTPASNAS-LEALLMTLAKEMtSSEQKQFTSLLVREGITGLLQRL 109
                 566677777788777775.6666666666664899****************9998 PP

>> PF06335  Protein of unknown function (DUF1054)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.056        98     110     153 ..      39      82 ..      29      96 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.056
     PF06335 110 kklekklealkelpedfvvskdHtkkealslseldlekalerlk 153
                  +l +  e+++e  ++ + s dH  +  +++s+++le++l+ l+
  ACF69765.1  39 ARLVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLA 82 
                 677888899999999999*****************999887665 PP

>> PF09025  YopR Core
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.063   1.1e+02      91     128 ..      74     111 ..      61     114 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.063
     PF09025  91 rekvLlevlaelkslpdleylsdlvrrELstliplNgm 128
                  e++L+ + +e+ s  +++++s lvr+ +  l+++ g+
  ACF69765.1  74 LEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGI 111
                 477888888999999**************999998776 PP

>> PF08785  Ku C terminal domain like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.053        94      68      95 ..      76     103 ..      39     115 .] 0.80

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.053
                 HHHHHHHHHHHCTSTCHHHHHHHH---- CS
     PF08785  68 eflkelkelvqekqlkdfwellvqkkit 95 
                   l +l + ++++++k+f  llv ++it
  ACF69765.1  76 ALLMTLAKEMTSSEQKQFTSLLVREGIT 103
                 5678899999999***********9998 PP

>> PF12082  Domain of unknown function (DUF3559)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.069   1.2e+02      42      78 ..      67     103 ..      22     110 .. 0.70

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.069
     PF12082  42 dedvleqlaarLarlkkkleeearaeleellggktlk 78 
                    +  +l a L+ l+k+++++++++++ ll  + + 
  ACF69765.1  67 TPASNASLEALLMTLAKEMTSSEQKQFTSLLVREGIT 103
                 4455567888888888888888888888876555555 PP

>> PF00325  Bacterial regulatory proteins, crp family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.12     2e+02       3      20 ..       1      18 [.       1      19 [. 0.90

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.12
     PF00325  3 msRqeIAdylGlTrETVs 20
                m+ +e+A++ G +r T++
  ACF69765.1  1 MTPEELANLTGYSRQTIN 18
                7789**********9986 PP

>> PF01047  MarR family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.15   2.7e+02      18      40 ..       1      23 [.       1      23 [. 0.92

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.15
                EEHHHHHHHHTS-HHHHHHHHHH CS
     PF01047 18 lsvseLakklgvsrstvtrvldr 40
                ++  eLa+  g sr t+ +++++
  ACF69765.1  1 MTPEELANLTGYSRQTINKWVRK 23
                6788****************997 PP

>> PF01905  CRISPR-associated negative autoregulator DevR/Csa2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.083   1.5e+02     220     251 ..      71     102 ..      44     105 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.083
     PF01905 220 eaalkAllrllsglfGAkrsrflPvveieelv 251
                 +a+l+All +l++ + + + +++  + + e++
  ACF69765.1  71 NASLEALLMTLAKEMTSSEQKQFTSLLVREGI 102
                 79************888888888888888877 PP

>> PF02236  Viral DNA-binding protein, all alpha domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0      0.15   2.6e+02      21      58 ..      58      95 ..      51     104 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.15
                T--HHH--S-TT--HHHHHHHHHHHHHHH-----SS-- CS
     PF02236 21 kvdtdklkllPdqgevykkicqtylneekrglqltFss 58
                 vd+++ ++ P  ++ ++ +  t  +e+    q  F+s
  ACF69765.1 58 SVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTS 95
                6999999***************9999999888888887 PP

>> PF03201  H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.16   2.8e+02      39      67 ..      81     109 ..      66     112 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.16
                 HHHHHHHHHHHHHHHHHHH---TTGGGTS CS
     PF03201  39 miekqiletLqtlasLveesGidgleeal 67 
                 +++++     ++ +sL+ ++Gi gl++ l
  ACF69765.1  81 LAKEMTSSEQKQFTSLLVREGITGLLQRL 109
                 5667777788999***********99876 PP

>> PF10135  Rod binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.18   3.1e+02      13      29 ..      85     100 ..      77     100 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.18
     PF10135  13 fgggfgedmfrdMldqq 29 
                 + ++  +++f+++l+++
  ACF69765.1  85 MTSS-EQKQFTSLLVRE 100
                 5667.89*****99875 PP

>> PF03869  Arc-like DNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.2      0.19   3.2e+02      15      30 ..      44      59 ..      42      61 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.19
                HHHHHHHCCCC----C CS
     PF03869 15 vrekvkevAeengRSm 30
                v e+v+e  ++  RS+
  ACF69765.1 44 VNEQVREYIRSAERSV 59
                889************8 PP

>> PF00079  Serpin (serine protease inhibitor)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.32   5.6e+02     126     137 ..      13      24 ..       3      28 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.32
                 HHHHHHHHHHHH CS
     PF00079 126 arkeINswvekk 137
                 +r++IN+wv+k+
  ACF69765.1  13 SRQTINKWVRKE 24 
                 89*******985 PP

>> PF01176  Translation initiation factor 1A / IF-1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.18   3.2e+02      25      41 ..      37      53 ..      34      56 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.18
                --EEE-------HHHH- CS
     PF01176 25 GeerlahipgKfrkkiw 41
                G+ rl+h+  + r++i+
  ACF69765.1 37 GKARLVHVNEQVREYIR 53
                999************98 PP

>> PF10304  Domain of unknown function (DUF2411)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.28   4.9e+02      21      29 ..      47      55 ..      46      61 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.28
     PF10304 21 lVrehardv 29
                +Vre++r++
  ACF69765.1 47 QVREYIRSA 55
                8******97 PP

>> PF06429  Domain of unknown function (DUF1078)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.45   7.9e+02       7      18 ..       4      15 ..       2      16 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.45
     PF06429  7 eEmvnlieaqRa 18
                eE++nl  ++R+
  ACF69765.1  4 EELANLTGYSRQ 15
                9*********98 PP

>> PF05216  UNC-50 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0       0.3   5.2e+02      32      53 ..       2      23 ..       1      25 [. 0.85

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.3
     PF05216 32 kPkkvyrsikyrkqtknqyaRd 53
                 P+++   + y +qt n++ R 
  ACF69765.1  2 TPEELANLTGYSRQTINKWVRK 23
                5777788899**********96 PP

>> PF01297  Periplasmic solute binding protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.39   6.8e+02      86     125 ..      24      63 ..       2      71 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.39
                 -TTHHHHHHH-T..TSEEEETT------BSSS-------- CS
     PF01297  86 Epwleklleslanngvkvvelsegieldtaeeededdeeg 125
                 E+w+++++  ++  ++++v + e++   + ++e   d++ 
  ACF69765.1  24 EGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHA 63 
                 8899999999999999999999999999997744444443 PP

>> PF10250  GDP-fucose protein O-fucosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.46   8.1e+02     276     342 ..      34     100 ..      26     104 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.46
     PF10250 276 iyggeeeleelkaelpnlltketlaskeeleklkdsqlaaldqiicaeadvFigtygstfskrvkge 342
                 ++gg+ +l +  +   + +++ ++ ++++   ++  ++a l+ + ++ a+    +   +f++++ +e
  ACF69765.1  34 VQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTSLLVRE 100
                 5789999999999999999999999999999999999999999999988887777788888887765 PP

>> PF06458  MucBP domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.56   9.9e+02      42      72 ..      15      46 ..       3      73 .. 0.68

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.56
     PF06458 42 vvysaWtlsqtfeavtspdikGY.adkqkvsa 72
                +++++W+ ++ +++  +p ++G  a  ++v++
  ACF69765.1 15 QTINKWVRKEGWATSPKPGVQGGkARLVHVNE 46
                34599999999999999999887544444444 PP

>> PF04021  Class III signal peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.2         1   1.8e+03       6      15 ..      73      82 ..      72      82 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 1
     PF04021  6 SlEfllLila 15
                SlE ll+ la
  ACF69765.1 73 SLEALLMTLA 82
                9******987 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (115 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       523  (0.0439053); expected 238.2 (0.02)
Passed bias filter:                      476  (0.0399597); expected 238.2 (0.02)
Passed Vit filter:                        57  (0.00478509); expected 11.9 (0.001)
Passed Fwd filter:                        57  (0.00478509); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              57  [number of targets reported over threshold]
# CPU time: 0.18u 0.05s 00:00:00.23 Elapsed: 00:00:00
# Mc/sec: 1379.30
//