hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_26709.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACF66691.1
Accession:      [none]
Description:    sent8 cydD GIB00763CH01 "ABC transporter, CydDC cysteine exporter (CydDC-.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0042281  ABC transporter transmembrane region           174.1    2.3e-56   1
0042280  P-loop containing nucleoside triphosphate hy   182.7    2.8e-55   1
0048220  P-loop containing nucleoside triphosphate hy   177.0    2.8e-52   1
0036790  P-loop containing nucleoside triphosphate hy   177.3    1.6e-51   1
0037958  P-loop containing nucleoside triphosphate hy   173.1      1e-50   1
0053059  P-loop containing nucleoside triphosphate hy   182.1    1.3e-50   1
0048226  P-loop containing nucleoside triphosphate hy   173.4    6.5e-50   1
0049080  P-loop containing nucleoside triphosphate hy   171.3    1.2e-49   1
0051025  P-loop containing nucleoside triphosphate hy   172.2    1.7e-49   1
0053060  ABC transporter transmembrane region           176.2    8.8e-49   1
0050943  P-loop containing nucleoside triphosphate hy   157.7    2.4e-48   1
0039041  P-loop containing nucleoside triphosphate hy   154.3    2.8e-48   1
0047599  P-loop containing nucleoside triphosphate hy   173.2    7.1e-48   1
0045860  P-loop containing nucleoside triphosphate hy   163.0    9.3e-48   1
0047589  P-loop containing nucleoside triphosphate hy   160.8    1.3e-47   1
0044086  P-loop containing nucleoside triphosphate hy   162.6    1.5e-47   1
0037898  P-loop containing nucleoside triphosphate hy   161.2      2e-47   1
0050274  P-loop containing nucleoside triphosphate hy   164.3    9.2e-47   1
0042070  P-loop containing nucleoside triphosphate hy   163.3      1e-46   1
0040410  P-loop containing nucleoside triphosphate hy   165.8      2e-46   1
0046693  P-loop containing nucleoside triphosphate hy   161.8    3.9e-46   1
0046697  P-loop containing nucleoside triphosphate hy   162.0    7.7e-46   1
0050044  P-loop containing nucleoside triphosphate hy   154.8    5.7e-45   1
0042557  P-loop containing nucleoside triphosphate hy   159.6    1.1e-44   1
0042496  P-loop containing nucleoside triphosphate hy   150.8    9.4e-44   1
0036121  P-loop containing nucleoside triphosphate hy   140.2    1.1e-40   1
0043607  P-loop containing nucleoside triphosphate hy   135.4    2.9e-40   1
0037960  P-loop containing nucleoside triphosphate hy   120.9    3.7e-39   1
0043651  P-loop containing nucleoside triphosphate hy   131.7    5.1e-38   1
0046869  P-loop containing nucleoside triphosphate hy   126.0    5.5e-38   1
0048545  P-loop containing nucleoside triphosphate hy   122.6    3.2e-37   1
0046860  P-loop containing nucleoside triphosphate hy   111.4    3.4e-34   1
0049825  P-loop containing nucleoside triphosphate hy   104.4    5.2e-34   1
0037230  P-loop containing nucleoside triphosphate hy   105.4    1.6e-33   1
0048593  P-loop containing nucleoside triphosphate hy   113.8    4.4e-33   1
0036748  P-loop containing nucleoside triphosphate hy   103.7    7.6e-33   1
0044893  P-loop containing nucleoside triphosphate hy   100.6    1.3e-32   1
0048852  P-loop containing nucleoside triphosphate hy   103.0    2.9e-32   1
0046945  P-loop containing nucleoside triphosphate hy   110.7    3.6e-32   1
0049611  P-loop containing nucleoside triphosphate hy   110.4    4.1e-32   1
0049537  P-loop containing nucleoside triphosphate hy    90.4    5.7e-30   1
0042605  P-loop containing nucleoside triphosphate hy   109.0    6.5e-30   1
0050337  P-loop containing nucleoside triphosphate hy   106.4    1.6e-29   1
0038144  P-loop containing nucleoside triphosphate hy    99.5    4.5e-29   1
0042214  P-loop containing nucleoside triphosphate hy    88.1      3e-28   1
0036850  P-loop containing nucleoside triphosphate hy   100.0    4.9e-28   1
0043798  P-loop containing nucleoside triphosphate hy    96.6    9.9e-28   1
0048047  P-loop containing nucleoside triphosphate hy    95.0    9.8e-27   1
0050061  P-loop containing nucleoside triphosphate hy    84.8    1.4e-26   1
0049503  P-loop containing nucleoside triphosphate hy    74.3    2.4e-24   1
0041412  P-loop containing nucleoside triphosphate hy    83.4    4.3e-24   1
0046479  P-loop containing nucleoside triphosphate hy    85.1    1.3e-23   1
0053253  PEP carboxykinase-like                          79.0      2e-23   1
0045731  P-loop containing nucleoside triphosphate hy    77.5      5e-23   1
0047537  P-loop containing nucleoside triphosphate hy    72.6    5.7e-23   1
0045157  P-loop containing nucleoside triphosphate hy    74.2    6.6e-23   1
0047841  PEP carboxykinase-like                          81.1    1.1e-22   1
0047797  P-loop containing nucleoside triphosphate hy    75.3    1.8e-21   1
0037163  P-loop containing nucleoside triphosphate hy    69.1    1.2e-20   1
0048410  P-loop containing nucleoside triphosphate hy    69.9    2.9e-20   1
0037996  P-loop containing nucleoside triphosphate hy    69.5    3.6e-20   1
0036857  P-loop containing nucleoside triphosphate hy    63.9    5.8e-20   1
0046276  P-loop containing nucleoside triphosphate hy    65.9    2.2e-19   1
0049657  P-loop containing nucleoside triphosphate hy    66.8    5.8e-19   1
0048702  P-loop containing nucleoside triphosphate hy    66.8    1.1e-18   1
0047538  P-loop containing nucleoside triphosphate hy    54.5    1.3e-18   1
0047552  PEP carboxykinase-like                          63.6    1.5e-18   1
0043794  P-loop containing nucleoside triphosphate hy    64.2    2.5e-18   1
0038720  P-loop containing nucleoside triphosphate hy    61.9    3.1e-18   1
0051289  P-loop containing nucleoside triphosphate hy    61.7    3.4e-18   1
0049073  P-loop containing nucleoside triphosphate hy    62.4    4.2e-18   1
0047701  P-loop containing nucleoside triphosphate hy    60.3    6.7e-17   1
0051553  P-loop containing nucleoside triphosphate hy    60.0    7.2e-17   1
0048957  P-loop containing nucleoside triphosphate hy    58.0    1.3e-16   1
0049343  P-loop containing nucleoside triphosphate hy    56.5    2.5e-16   1
0040588  P-loop containing nucleoside triphosphate hy    54.7    2.7e-16   1
0053350  P-loop containing nucleoside triphosphate hy    56.9    3.7e-16   1
0037926  P-loop containing nucleoside triphosphate hy    58.1      9e-16   1
0051551  P-loop containing nucleoside triphosphate hy    55.4    2.6e-15   1
0047073  P-loop containing nucleoside triphosphate hy    50.2    3.9e-15   1
0043440  P-loop containing nucleoside triphosphate hy    50.0    4.7e-15   1
0047844  PEP carboxykinase-like                          49.9    6.2e-15   1
0046895  P-loop containing nucleoside triphosphate hy    41.8    4.4e-14   1
0044438  P-loop containing nucleoside triphosphate hy    47.7    9.4e-14   1
0053247  P-loop containing nucleoside triphosphate hy    49.7    1.1e-13   1
0043218  P-loop containing nucleoside triphosphate hy    47.7    1.2e-13   1
0051056  P-loop containing nucleoside triphosphate hy    41.6    1.4e-13   1
0051325  P-loop containing nucleoside triphosphate hy    46.4    2.6e-13   1
0049853  P-loop containing nucleoside triphosphate hy    40.4    4.1e-13   1
0035641  P-loop containing nucleoside triphosphate hy    46.4    7.8e-13   1
0050374  P-loop containing nucleoside triphosphate hy    44.1    9.4e-13   1
0048963  P-loop containing nucleoside triphosphate hy    46.4    1.4e-12   1
0046441  P-loop containing nucleoside triphosphate hy    45.8    1.5e-12   1
0049881  P-loop containing nucleoside triphosphate hy    44.3    4.8e-12   1
0043986  P-loop containing nucleoside triphosphate hy    40.5    2.5e-11   1
0039270  P-loop containing nucleoside triphosphate hy    39.6    3.1e-11   1
0049919  P-loop containing nucleoside triphosphate hy    39.4    8.6e-11   1
0040678  P-loop containing nucleoside triphosphate hy    38.4    1.3e-10   1
0048044  P-loop containing nucleoside triphosphate hy    40.5    1.9e-10   1
0049577  P-loop containing nucleoside triphosphate hy    36.2      5e-10   1
0040419  P-loop containing nucleoside triphosphate hy    34.4    1.6e-09   1
0051376  P-loop containing nucleoside triphosphate hy    31.1    1.7e-09   1
0042094  P-loop containing nucleoside triphosphate hy    34.0    2.6e-09   1
0049933  P-loop containing nucleoside triphosphate hy    34.5      3e-09   1
0038674  P-loop containing nucleoside triphosphate hy    32.3    1.2e-08   1
0050867  P-loop containing nucleoside triphosphate hy    31.3    1.9e-08   1
0043790  P-loop containing nucleoside triphosphate hy    29.0    3.6e-08   1
0053315  P-loop containing nucleoside triphosphate hy    26.9    4.7e-08   1
0036729  P-loop containing nucleoside triphosphate hy    27.5    7.9e-08   1
0043792  P-loop containing nucleoside triphosphate hy    28.1    1.1e-07   1
0051769  P-loop containing nucleoside triphosphate hy    29.3    1.4e-07   1
0039472  P-loop containing nucleoside triphosphate hy    25.1    1.7e-07   1
0040984  P-loop containing nucleoside triphosphate hy    26.2    1.7e-07   1
0048272  P-loop containing nucleoside triphosphate hy    28.3    3.2e-07   1
0048255  P-loop containing nucleoside triphosphate hy    23.7    4.5e-07   1
0048025  P-loop containing nucleoside triphosphate hy    24.7    7.3e-07   1
0051535  P-loop containing nucleoside triphosphate hy    24.3    1.3e-06   1
0052155  P-loop containing nucleoside triphosphate hy    23.3    2.4e-06   1
0046916  P-loop containing nucleoside triphosphate hy    23.1    6.5e-06   1
0047607  P-loop containing nucleoside triphosphate hy    22.4    7.3e-06   1
0046162  P-loop containing nucleoside triphosphate hy    20.9    7.3e-06   1
0047808  P-loop containing nucleoside triphosphate hy    20.7    2.7e-05   1
0052726  P-loop containing nucleoside triphosphate hy    20.3    3.5e-05   1
0041032  P-loop containing nucleoside triphosphate hy    21.2    4.6e-05   1
0040121  P-loop containing nucleoside triphosphate hy    20.8    6.2e-05   1
0047127  P-loop containing nucleoside triphosphate hy    15.9    0.00012   1
0047756  P-loop containing nucleoside triphosphate hy    17.6    0.00012   1
0042008  P-loop containing nucleoside triphosphate hy    16.1    0.00016   1
0052346  P-loop containing nucleoside triphosphate hy    16.5    0.00016   1
0045785  P-loop containing nucleoside triphosphate hy    18.8    0.00019   1
0051604  P-loop containing nucleoside triphosphate hy    15.6    0.00032   1
0040315  P-loop containing nucleoside triphosphate hy    16.5    0.00044   1
0040237  P-loop containing nucleoside triphosphate hy    15.8    0.00046   1
0047547  P-loop containing nucleoside triphosphate hy    15.0    0.00048   1
0037862  P-loop containing nucleoside triphosphate hy    17.9     0.0005   1
0049582  P-loop containing nucleoside triphosphate hy    13.3     0.0005   1
0047839  P-loop containing nucleoside triphosphate hy    15.6    0.00052   1
0047813  P-loop containing nucleoside triphosphate hy    15.8    0.00085   1
0048706  P-loop containing nucleoside triphosphate hy    13.1    0.00086   1
0041830  P-loop containing nucleoside triphosphate hy    14.6    0.00097   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0042281    1/1       5   331 ..     1   311 []   174.1  2.3e-56
0053060    1/1       7   351 ..     1   323 []   176.2  8.8e-49
0037960    1/1     294   573 ..     1   323 []   120.9  3.7e-39
0036857    1/1     323   569 ..     1   433 []    63.9  5.8e-20
0049825    1/1     324   576 ..     1   263 []   104.4  5.2e-34
0046479    1/1     328   565 ..     1   276 []    85.1  1.3e-23
0046869    1/1     328   587 ..     1   280 []   126.0  5.5e-38
0042496    1/1     332   570 ..     1   289 []   150.8  9.4e-44
0040237    1/1     333   548 ..     1   162 [.    15.8  0.00046
0041830    1/1     338   540 ..     1   171 [.    14.6  0.00097
0036121    1/1     339   571 ..     1   277 []   140.2  1.1e-40
0044086    1/1     340   580 ..     1   400 []   162.6  1.5e-47
0048852    1/1     340   570 ..     1   254 []   103.0  2.9e-32
0050061    1/1     340   570 ..     1   258 []    84.8  1.4e-26
0040419    1/1     342   549 ..     1   145 [.    34.4  1.6e-09
0038720    1/1     343   464 ..     1   158 []    61.9  3.1e-18
0039270    1/1     343   561 ..     1   247 []    39.6  3.1e-11
0044438    1/1     343   570 ..     1   364 []    47.7  9.4e-14
0049503    1/1     343   570 ..     1   251 []    74.3  2.4e-24
0038674    1/1     344   547 ..     1   147 [.    32.3  1.2e-08
0043798    1/1     344   575 ..     1   252 []    96.6  9.9e-28
0042214    1/1     347   570 ..     1   401 []    88.1    3e-28
0042070    1/1     348   584 ..     1   242 []   163.3    1e-46
0043607    1/1     348   558 ..     1   200 []   135.4  2.9e-40
0046945    1/1     348   570 ..     1   262 []   110.7  3.6e-32
0036748    1/1     349   571 ..     1   234 []   103.7  7.6e-33
0037898    1/1     349   570 ..     1   240 []   161.2    2e-47
0043651    1/1     349   551 ..     1   274 []   131.7  5.1e-38
0036729    1/1     350   547 ..     1   153 [.    27.5  7.9e-08
0036790    1/1     350   569 ..     1   308 []   177.3  1.6e-51
0037230    1/1     350   570 ..     1   224 []   105.4  1.6e-33
0037958    1/1     350   587 ..     1   254 []   173.1    1e-50
0042280    1/1     350   569 ..     1   244 []   182.7  2.8e-55
0042557    1/1     350   570 ..     1   232 []   159.6  1.1e-44
0049080    1/1     350   590 .]     1   281 []   171.3  1.2e-49
0050374    1/1     350   563 ..     1   287 []    44.1  9.4e-13
0050943    1/1     350   583 ..     1   330 []   157.7  2.4e-48
0051025    1/1     350   590 .]     1   284 []   172.2  1.7e-49
0043986    1/1     351   549 ..     1   242 []    40.5  2.5e-11
0049611    1/1     351   569 ..     1   242 []   110.4  4.1e-32
0040410    1/1     352   582 ..     1   231 []   165.8    2e-46
0035641    1/1     353   543 ..     1   225 []    46.4  7.8e-13
0047599    1/1     353   583 ..     1   251 []   173.2  7.1e-48
0048957    1/1     353   584 ..     1   222 []    58.0  1.3e-16
0043440    1/1     355   556 ..     1   198 []    50.0  4.7e-15
0046697    1/1     356   570 ..     1   232 []   162.0  7.7e-46
0047589    1/1     356   584 ..     1   240 []   160.8  1.3e-47
0048220    1/1     356   587 ..     1   241 []   177.0  2.8e-52
0048226    1/1     356   588 ..     1   242 []   173.4  6.5e-50
0050044    1/1     356   570 ..     1   239 []   154.8  5.7e-45
0050274    1/1     356   588 ..     1   238 []   164.3  9.2e-47
0053059    1/1     356   586 ..     1   255 []   182.1  1.3e-50
0048545    1/1     358   588 ..     1   286 []   122.6  3.2e-37
0036850    1/1     360   570 ..     1   443 []   100.0  4.9e-28
0041032    1/1     360   398 ..     1    39 [.    21.2  4.6e-05
0046276    1/1     360   567 ..     1   203 []    65.9  2.2e-19
0037862    1/1     361   398 ..     1    38 [.    17.9   0.0005
0039041    1/1     361   565 ..     1   370 []   154.3  2.8e-48
0045860    1/1     361   581 ..     1   258 []   163.0  9.3e-48
0046693    1/1     361   569 ..     1   293 []   161.8  3.9e-46
0047841    1/1     362   549 ..     1   177 []    81.1  1.1e-22
0047844    1/1     362   545 ..     1   169 []    49.9  6.2e-15
0047127    1/1     363   398 ..     1    54 [.    15.9  0.00012
0047552    1/1     363   534 ..     1   173 []    63.6  1.5e-18
0050337    1/1     363   572 ..     1   427 []   106.4  1.6e-29
0051325    1/1     363   572 ..     1   172 []    46.4  2.6e-13
0053253    1/1     363   570 ..     1   170 [.    79.0    2e-23
0037163    1/1     364   568 ..     1   311 []    69.1  1.2e-20
0047537    1/1     365   563 ..     1   211 []    72.6  5.7e-23
0044893    1/1     366   580 ..     1   213 []   100.6  1.3e-32
0046860    1/1     368   580 ..     1   211 []   111.4  3.4e-34
0048025    1/1     368   589 ..     1   207 []    24.7  7.3e-07
0049073    1/1     368   586 ..     1   207 []    62.4  4.2e-18
0037926    1/1     369   547 ..    26   313 ..    58.1    9e-16
0037996    1/1     369   547 ..    19   184 ..    69.5  3.6e-20
0039472    1/1     369   545 ..    34   195 .]    25.1  1.7e-07
0040678    1/1     369   559 ..    38   256 .]    38.4  1.3e-10
0040984    1/1     369   531 ..     1    92 [.    26.2  1.7e-07
0042094    1/1     369   547 ..    34   159 ..    34.0  2.6e-09
0043792    1/1     369   545 ..    27   224 .]    28.1  1.1e-07
0043790    1/1     369   545 ..    45   254 .]    29.0  3.6e-08
0043794    1/1     369   576 ..    26   227 .]    64.2  2.5e-18
0049577    1/1     369   477 ..    90   231 .]    36.2    5e-10
0050867    1/1     369   530 ..     1   195 []    31.3  1.9e-08
0051769    1/1     369   512 ..     1    94 [.    29.3  1.4e-07
0052155    1/1     369   547 ..    38   163 ..    23.3  2.4e-06
0052726    1/1     369   553 ..     1   283 []    20.3  3.5e-05
0043218    1/1     370   576 ..     1   172 []    47.7  1.2e-13
0047073    1/1     370   550 ..     1   273 []    50.2  3.9e-15
0048047    1/1     370   517 ..     1   192 []    95.0  9.8e-27
0049537    1/1     370   570 ..     1   258 []    90.4  5.7e-30
0049933    1/1     370   558 ..     1   196 []    34.5    3e-09
0053315    1/1     370   523 ..     1   132 [.    26.9  4.7e-08
0045157    1/1     371   543 ..     1   190 []    74.2  6.6e-23
0048593    1/1     371   579 ..     1   207 []   113.8  4.4e-33
0040121    1/1     372   512 ..     1    86 [.    20.8  6.2e-05
0042008    1/1     372   477 ..     1   118 [.    16.1  0.00016
0047839    1/1     372   445 ..     1    73 [.    15.6  0.00052
0046895    1/1     373   563 ..     1   269 []    41.8  4.4e-14
0048255    1/1     373   565 ..     1   242 []    23.7  4.5e-07
0049853    1/1     373   566 ..     1   217 [.    40.4  4.1e-13
0051056    1/1     373   566 ..     1   268 []    41.6  1.4e-13
0041412    1/1     374   587 ..     1   222 []    83.4  4.3e-24
0042605    1/1     374   561 ..     1   223 []   109.0  6.5e-30
0046162    1/1     374   512 ..     1   129 [.    20.9  7.3e-06
0047797    1/1     374   558 ..     1   178 []    75.3  1.8e-21
0049582    1/1     374   409 ..     1    35 [.    13.3   0.0005
0040315    1/1     375   398 ..     1    24 [.    16.5  0.00044
0047547    1/1     375   398 ..     1    24 [.    15.0  0.00048
0048410    1/1     375   537 ..     1   170 []    69.9  2.9e-20
0048706    1/1     375   550 ..     1   333 []    13.1  0.00086
0049343    1/1     375   569 ..     1   205 []    56.5  2.5e-16
0051551    1/1     375   535 ..     1   197 []    55.4  2.6e-15
0051553    1/1     375   538 ..     1   201 []    60.0  7.2e-17
0053247    1/1     375   560 ..     1   241 []    49.7  1.1e-13
0038144    1/1     376   532 ..     1   186 []    99.5  4.5e-29
0040588    1/1     376   566 ..     1   185 []    54.7  2.7e-16
0045731    1/1     376   570 ..     1   288 []    77.5    5e-23
0045785    1/1     376   582 ..     1   191 []    18.8  0.00019
0046441    1/1     376   558 ..     1   210 []    45.8  1.5e-12
0047538    1/1     376   551 ..     1   147 [.    54.5  1.3e-18
0047607    1/1     376   543 ..     1   205 []    22.4  7.3e-06
0047756    1/1     376   550 ..     1   213 []    17.6  0.00012
0047808    1/1     376   518 ..     1    96 [.    20.7  2.7e-05
0047813    1/1     376   474 ..     1    83 [.    15.8  0.00085
0048272    1/1     376   573 ..     1   204 []    28.3  3.2e-07
0048963    1/1     376   559 ..     1   178 []    46.4  1.4e-12
0049657    1/1     376   564 ..     1   214 []    66.8  5.8e-19
0049881    1/1     376   565 ..     1   191 []    44.3  4.8e-12
0049919    1/1     376   550 ..     1   147 [.    39.4  8.6e-11
0051535    1/1     376   523 ..     1   127 [.    24.3  1.3e-06
0051604    1/1     376   562 ..     1   176 []    15.6  0.00032
0052346    1/1     376   398 ..     1    22 [.    16.5  0.00016
0053350    1/1     376   557 ..     1   210 []    56.9  3.7e-16
0048044    1/1     377   565 ..     1   190 []    40.5  1.9e-10
0048702    1/1     377   569 ..     1   241 []    66.8  1.1e-18
0051289    1/1     377   569 ..     1   178 []    61.7  3.4e-18
0051376    1/1     377   562 ..     1   244 []    31.1  1.7e-09
0047701    1/1     378   542 ..     1   306 []    60.3  6.7e-17
0046916    1/1     380   529 ..     1   152 [.    23.1  6.5e-06

Alignments of top-scoring domains:
0042281: domain 1 of 1, from 5 to 331: score 174.1, E = 2.3e-56
                   *->ekee..krllrylkpykkllllalllallaallslllplllgrlida
                       +++ +++l++      ++l ++ ll++++++l ++++++++r++ +
  ACF66691.1     5    RQKDltRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQH 51   

                   llpgg.dlslllllallllllallrallsylrsyllarlgqrllarlrsr
                   ++ +++++++lll ++ll+l+++lra + +lr ++ +++gq+++ ++r++
  ACF66691.1    52 MIMENiPREALLLPFILLILVFVLRAWVVWLRERVGFHAGQHIRFEIRRQ 101  

                   lfrkllrlplsffdktstGdllsrltnDveaidellssllltllralltl
                   ++++l+++ +++++ +++G+ ++ + + ++ ++++++++l+++  a+ ++
  ACF66691.1   102 VLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARYLPQMALAVCVP 151  

                   lgalivlfylswrlalvlllllpllllltllfgkrlrklsrlvqealsel
                   l++++++f  +w  al+ll ++pl+ l+++++g  +++++r+   al++l
  ACF66691.1   152 LLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARL 201  

                   nsvlveslsgirtvkafgaeerelerfeealdelrkaslklarlsallsp
                   ++++++ l+g++t+++fg+ e e e +++a++++r+ ++ ++rl++l+s+
  ACF66691.1   202 SGHFLDRLRGMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSG 251  

                   llqllsalalalvlllgallvlng........eltvgdlvafllyalqll
                   +l+++++l++alv+++ ++ +l   +  ++ + +t+++ +++l++a  ++
  ACF66691.1   252 VLEFFTSLSIALVAVYFGFSYLGElnfghygtGVTLAAGFLALILAPEFF 301  

                   gplsqlgsllselqrarvaaeRi....D.Pep..kRllrylkpykkllllalllsllaallslllplllgqlidall
                      ++ +++l++      ++l ++ ll++++++l +++++++++++++++
  ACF66691.1     7    KDltRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMI 53   

                   lgg.dlsdpllllstlllllllllllallrallsylrsyllarlgqrlsa
                    ++++ +       +lll ++ll+l+++lra + +lr ++ +++gq+++ 
  ACF66691.1    54 MENiPRE-------ALLLPFILLILVFVLRAWVVWLRERVGFHAGQHIRF 96   

                   rlrlrlfrkllrlplsffdktstGdllsrltnDveaidellssllltlll
                   ++r++++++l+++ +++++ +++G+ ++ + + ++ ++++++++l+++ l
  ACF66691.1    97 EIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARYLPQMAL 146  

                   alltligalivlfliswklalvlllllpllllltllfgkrlrklsrlaqe
                   a+ +++++++++f  +w  al+ll ++pl+ l++ ++g+ + +++r+ + 
  ACF66691.1   147 AVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFL 196  

                   alselnsllveslsgirtvkafgaeerelerfdealdellkaslklarls
                   al++l++++ + l+g++t+++fg+ e e e +++a++++++ ++ ++rl+
  ACF66691.1   197 ALARLSGHFLDRLRGMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLA 246  

                   allspllellsalalalvlllgaylvlng........eltvgdlvaflly
                   +l+s++le++++l++alv+++ ++ +l   +  ++ + +t+ + +++l++
  ACF66691.1   247 FLSSGVLEFFTSLSIALVAVYFGFSYLGElnfghygtGVTLAAGFLALIL 296  

                   alrllgplrqlgsllselqralaaaerifelld.P...E...........
                   a  +++plr lg++++  ++a++aa+ +  +l++P ++++  +++ ++++
  ACF66691.1   297 APEFFQPLRDLGTFYHAKAQAVGAADSLKTFLEtPlahPargevelaene 346  

                   P...pllllpllllpdeplaaldvalqralvslerllellvdpgasdihinp
                      l+l+p +++p++ l  +++a ++a+ +++ l  +l+ p         
  ACF66691.1   294    LILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPL-------- 332  

                   ggpvrvridgvlelllvvldllsldleellalasriavlagrdiserrlp
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   ldgallpdgsrvrvrlsplptllggeslvirklpkliltledllelenls
                                          +     +++   ++ t    ++  nl 
  ACF66691.1   333 ----------------------AHPARGEVELAENEPVT----IDAVNLI 356  

                   fsygg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppdegi
                   ++ ++ k++   l++++++ge+ ++vG++GsGK++ll+ l+g+l + +g+
  ACF66691.1   357 ITSPEgKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSY-QGS 405  

                   itiegpdel......lrnkigyvfQdpvlfpltvren.............
                   ++i+g+++++   + +r+++++v Q+p l   t+ren+  +  ++ +++ 
  ACF66691.1   406 LRINGVELRdlspesWRQHLSWVGQNPQLPAATLRENvllarpdaseqel 455  

                   ........................................laralrqdPd
                   +++ +++ + +      + +++   +++    + +++ +++aral+   +
  ACF66691.1   456 yaaldaawvseflpllpqgvdtplgnhasrlsvgqaqrvaVARALLNPCQ 505  

                   illlDEptsalda.......ellqalltghtvvlvthhlntaldladrii
                   +lllDEp ++lda+ ++ ++++l+a+ +  t+++vth l++++d  d i+
  ACF66691.1   506 LLLLDEPAASLDAhseqrvmQALKAASKRQTTLMVTHQLEDLAD-WDAIW 554  

                   vlddGriveegtpeellanplasaldlvvaqrlvrdldgrcrrllgvrllpplppklagllplagladgd.glgvllGklldgvpvtldl
                       l   l++pl ++  g  +la++++++++  +l+   ++g+ +  +l
  ACF66691.1   323    SLKTFLETPLAHPARGEVELAENEPVTiDAVNLIITSPEGKTLAGPL 369  

                   gel...grhllivGptGsGKStllrllaglllpd.ggrviviDpkgeyag
                   +   ++g++ ++vG +GsGKS+ll++l g l ++ + r+           
  ACF66691.1   370 NFSlaaGERAVLVGRSGSGKSSLLNVLSGFLSYQgSLRI----------- 408  

                   larglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddf
                                                                 ++  
  ACF66691.1   409 ----------------------------------------------NGVE 412  

                   ftpaarallralilalaeepe.ptldellellselglrdladrleklvag
                   +++     +r+ +  + + p+ p  + + ++l + ++ + ++++++l+a+
  ACF66691.1   413 LRDLSPESWRQHLSWVGQNPQlPAATLRENVLLARPDASEQELYAALDAA 462  

                   glagllegaektaasilellrkllallldlggpafdlrdllslgeglivl
                    + ++l                                 ll   +g+++ 
  ACF66691.1   463 WVSEFL--------------------------------PLLP--QGVDTP 478  

                   illslg....gekqrvalarallsllfeallelggrlkppillllDEpts
                   ++ +     +g+ qrva+arall               p  llllDEp++
  ACF66691.1   479 LGNHASrlsvGQAQRVAVARALLN--------------PCQLLLLDEPAA 514  

                   lldlellerllrel..rklGvtlvlvtqdpsdldkiyGseladailsncn
                    ld    +r+++ l++++++ t ++vt+ ++dl +               
  ACF66691.1   515 SLDAHSEQRVMQALkaASKRQTTLMVTHQLEDLAD--------------- 549  

                   triilrlsafdpedaelilellgltevevksvslstgllgsvslsiseee
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   rpllladelaslpkgealvllpggrppvrvkvpyvsdpevkavvdlvkvekllglalllieklflkvlprllsllelenlskiytgipal..dvs
                      ++ +l++ l +  ++ ++ +      +++ nl  ++ + + l+  ++
  ACF66691.1   324    LKTFLETPLAHPARGEVELAENEPVTIDAVNLIITSPEGKTLagPLN 370  

                   lglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgeesld
                   ++   l +Ge  +l+G+sGsGK+ L l++l g+l   +g+++i+g e++d
  ACF66691.1   371 FS---LAAGERAVLVGRSGSGKSSL-LNVLSGFLS-YQGSLRINGVELRD 415  

                   ll...rarrlgvvlqelllfpeltveenl.....................
                   l+ + ++++l++v q++ l+++ t++en+  +  ++ +++ +++ +++ +
  ACF66691.1   416 LSpesWRQHLSWVGQNPQLPAA-TLRENVllarpdaseqelyaaldaawv 464  

                   ...............drlprllsggqrqrvvidsalalrpkllllDEPts
                    +      + +++  +  ++ ls gq+qrv++++al+   +llllDEP +
  ACF66691.1   465 seflpllpqgvdtplGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAA 514  

                   gldplsarellellrrllrlakelgvtvllvthdldeaealadrvlvlag
                   +ld+ s+++++++l++     ++   t+l+vth+l+++++  d ++v+ +
  ACF66691.1   515 SLDAHSEQRVMQALKA-----ASKRQTTLMVTHQLEDLAD-WDAIWVMQD 558  

                   grilehgadtvlllrrdelyvagfeggglrrilrvvknrggptgeiaefe
                   g i+e+g+ ++l                                      
  ACF66691.1   559 GAIVEQGSYAELSAANGA-------------------------------- 576  

                   iteeGlelsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelen
                      l+ p+ +   G+v  +  ep+                     ++  n
  ACF66691.1   328    LETPLAHPARGEVELAENEPV--------------------TIDAVN 354  

                   ls.krfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagllkpds
                   l + + ++++++  +++++++Ger  lvG++G+GK+ Ll++l+g+l   +
  ACF66691.1   355 LIiTSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQ 403  

                   geivvyg..ligerprevrellglllelgvlfaaellervglvaatadep
                   g+ +++g++l ++ p++ r+ l  + + ++l aa l e v+l  + a+e 
  ACF66691.1   404 GSLRINGveLRDLSPESWRQHLSWVGQNPQLPAATLRENVLLARPDASEQ 453  

                   pge.............................lsggqrqrlaiAraladd
                      ++ +++ + +      + +++   +++  ls gq qr+a+Aral+  
  ACF66691.1   454 ELYaaldaawvseflpllpqgvdtplgnhasrLSVGQAQRVAVARALL-- 501  

                   qgkpvllllDEptsgldalreillllgellseegytvllvshdlsllera
                       +llllDEp + lda++e + +    ++++  t l+v+h l+ l ++
  ACF66691.1   502 -NPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADW 550  

                   adr...eggsitalgtvlveggdlsdpivelllsildgvivldrdlaekg
                   + + ++++g i+++g                                   
  ACF66691.1   551 DAIwvmQDGAIVEQG----------------------------------- 565  

                   iyPaidvllSvsrllsvpvglallgrvldvlgepidglgplllllllpivrlappllelen
                      l+ p+ +   g+v  + +ep+                     ++  n
  ACF66691.1   328    LETPLAHPARGEVELAENEPVT--------------------IDAVN 354  

                   lsksygtg.ialidvsltigrGervglvGpnGaGKttLlkllagllkpds
                   l  + ++g++++  +++++++Ger  lvG++G+GK++Ll++l+g+l   +
  ACF66691.1   355 LIITSPEGkTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQ 403  

                   geilvdGedlrelre..lrrrigyvfqdpalfpeltvlenlalgallag.
                   g+ +++G++lr+l ++ +r+++++v q+p+l   +t++en++l++++a++
  ACF66691.1   404 GSLRINGVELRDLSPesWRQHLSWVGQNPQLP-AATLRENVLLARPDASe 452  

                   ....................lglaeyldelgkdLSgGqrqrvalAr....
                   ++ +++ +++ + +       g+++ l+ +++ LS Gq qrva+Ar+  +
  ACF66691.1   453 qelyaaldaawvseflpllpQGVDTPLGNHASRLSVGQAQRVAVARalln 502  

                   .pvlLllDEptsgldalre..ilellrellkelgytvllvthdls...la
                     +lLllDEp + lda++e+ ++++l+   k    t l+vth l++ +  
  ACF66691.1   503 pCQLLLLDEPAASLDAHSEqrVMQALKAASK--RQTTLMVTHQLEdlaDW 550  

                   drilvledGsitalgtveellddlgdpitllllsildgqivlsrelaekg
                   d i+v+ dG i+++g+++el +  g+++tll ++  d             
  ACF66691.1   551 DAIWVMQDGAIVEQGSYAELSAANGAFATLLAHRQED------------- 587  

                   iyPaidvllsvsrlldllgepldglgplr.papgllelenvsksygtg.ialidlslpigkGer
                      l +p  g  +l ++ p  +   n+ ++ ++g++++  l++++++Ger
  ACF66691.1   332    LAHPARGEVELAeNEPVTIDAVNLIITSPEGkTLAGPLNFSLAAGER 378  

                   valvGpsGaGKttLlrliaglldpdsgeilldgvdigersrevtelleel
                    +lvG sG+GK++Ll++++g+l+++ g+++++gv+++++s+e      ++
  ACF66691.1   379 AVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRINGVELRDLSPE------SW 421  

                   rrviglvfqdpplfprltvaenialgaeyf....rdegadvllladsllr
                   r+++ +v q+p+l +  t +en++l+++ + +++ + + d++ + ++l  
  ACF66691.1   422 RQHLSWVGQNPQLPAA-TLRENVLLARPDAseqeLYAALDAAWVSEFLPL 470  

                   lagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatv
                   l+++ ++ lg  +  lS Gq qrva arall                   
  ACF66691.1   471 LPQGVDTPLGNHASRLSVGQAQRVAVARALL------------------- 501  

                   lveggsdpdllllDeptsalDgeivlslllalkrlyPaidvllSvsrvld
                           +llllDep + lD+++++++++alk                 
  ACF66691.1   502 -----NPCQLLLLDEPAASLDAHSEQRVMQALKAA--------------- 531  

                   llllkeilqaakgltvilvthdlsea.ladrilvlddgkiveegtpeel<
                             +k+ t+++vth+l+ ++  d i+v++dg ive+g+++el 
  ACF66691.1   532 ----------SKRQTTLMVTHQLEDLaDWDAIWVMQDGAIVEQGSYAEL  570  

                   -*
                     
  ACF66691.1     -    -    

0040237: domain 1 of 1, from 333 to 548: score 15.8, E = 0.00046
                   *->vlektgipltkllrpvlld..dviGqeealeallealrr..rpgrnv
                        +  g     +++pv++d++++i  +++ ++l+  l++    g+  
  ACF66691.1   333    AHPARGEVELAENEPVTIDavNLIITSPEGKTLAGPLNFslAAGERA 379  

                   llvGppGvGKTtlaralagllvrssgpilldgvpfvrldaselle.....
                   +lvG +G+GK++l++ l g+l   +g+ +++gv+++ l+ ++ +++   +
  ACF66691.1   380 VLVGRSGSGKSSLLNVLSGFL-SYQGSLRINGVELRDLSPESWRQhlswv 428  

                   ..................................................
                    ++ +  +++  +++  +  ++ +++ +++ +++ + +      + +++ 
  ACF66691.1   429 gqnpqlpaatlrenvllarpdaseqelyaaldaawvseflpllpqgvdtp 478  

                   fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpev
                   +g   + ++ g+ q+++ ara+ ++  +l+lDE+ + l        d   
  ACF66691.1   479 LGNHASRLSVGQAQRVAVARALlnPCQLLLLDEPAASL--------DAHS 520  

                   qnaLlrlleeg..nvrviaatnrpelvkdrplleklrpvlldd..viGqeeakkallealalplkrlelfeklrg
                       +  l + +pv++d +++i  +++ k l+  l++             
  ACF66691.1   338    GEVELAENEPVTIDAvnLIITSPEGKTLAGPLNF------------S 372  

                   irpgknvlLvGppGtGKTtlaralakll.grpfirvdaselte.......
                   +  g+  +LvG +G+GK++l+  l ++l   + +r+++ el++   +   
  ACF66691.1   373 LAAGERAVLVGRSGSGKSSLLNVLSGFLsYQGSLRINGVELRDlspeswr 422  

                   ...aelvGyesgarlrelf...............................
                   ++ + +vG +  + + + + +++  +  ++ +++ +++ +++ + +    
  ACF66691.1   423 qhlS-WVG-QNPQLPAATLrenvllarpdaseqelyaaldaawvseflpl 470  

                   .....................aragigllaladpgvlflDEidkllparg
                     + +++   +++    + +++r+ +++++l++  +l+lDE+ + l+a++
  ACF66691.1   471 lpqgvdtplgnhasrlsvgqaQRVAVARALLNPCQLLLLDEPAASLDAHS 520  

                   ssggdvsredvlnaLlrlleegeltilgggvdlpnvlviplellgepllelenlsksyg...gitalddvslgirkGeivllvGps
                       +el+++  ++++ ++++ +  +g+t+   +++++ +Ge  +lvG+s
  ACF66691.1   339    EVELAENEPVTIDAVNLIITspeGKTLAGPLNFSLAAGERAVLVGRS 385  

                   GsGKStllrnllagllaptggsvlldgleisalslaerlragigyvfqdl
                   GsGKS+ll+ +l+g+l  ++gs +++g+e++ ls+   +r+++++v q++
  ACF66691.1   386 GSGKSSLLN-VLSGFLS-YQGSLRINGVELRDLSPES-WRQHLSWVGQNP 432  

                   alfpeltvlenlalg................rarellerlglail...dr
                    l    t++en++l+  ++ +++ +++ +++ + e+l +l+ + ++  + 
  ACF66691.1   433 QLPAA-TLRENVLLArpdaseqelyaaldaaWVSEFLPLLPQGVDtplGN 481  

                   lpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvael
                   +++ LS Gq qrva+aral++ ++llllDep + l       d+++ +++
  ACF66691.1   482 HASRLSVGQAQRVAVARALLNPCQLLLLDEPAASL-------DAHSEQRV 524  

                   lellkelakelgvtvilvthdldlldsallrpgkrpllsdlrgsgeieql
                   +++lk+  k    t+++vth l+                        +++
  ACF66691.1   525 MQALKAASK--RQTTLMVTHQLE-----------------------DLAD 549  

                   adrvlvlergriveegtpeeliilknrtngptgevlllflgeaglflvln
                    d ++v+++g ive+g+++el                             
  ACF66691.1   550 WDAIWVMQDGAIVEQGSYAELS---------------------------- 571  

                   psMpllslgepllelenlsksy.ggvvalkdislsipkGeildlldell
                       +l++  ++ + + nl ++   g+++   +++s+ +Ge+        
  ACF66691.1   340    VELAENEPVTIDAVNLIITSpEGKTLAGPLNFSLAAGER-------- 378  

                   ellkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggkgvTr
                                +lvG+sGsGKS+Lln+L+g+l + +g+++++g+++  
  ACF66691.1   379 ------------AVLVGRSGSGKSSLLNVLSGFLSY-QGSLRINGVEL-- 413  

                   divlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddg
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   lteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkel
                                                             ++l  + +
  ACF66691.1   414 ------------------------------------------RDLSPESW 421  

                   rrgigyvfqdpnlfpglvvlisaltgegldeltvrenlalglrlrg....
                   r+++++v q+p+l                   t+ren++l+++ +++++ 
  ACF66691.1   422 RQHLSWVGQNPQLPAA----------------TLRENVLLARPDASeqel 455  

                   ........arerveellegldelldrlpgtlSgGerqrvalAralaldpk
                   +++ +++   e++  l++g d+ l+ +++ lS G++qrva Aral+   +
  ACF66691.1   456 yaaldaawVSEFLPLLPQGVDTPLGNHASRLSVGQAQRVAVARALLNPCQ 505  

                   lllllllleellekllnllrevfdlaDEptsgLDpetraellellkelae
                   llll                      DEp ++LD++++++++++lk+  +
  ACF66691.1   506 LLLL----------------------DEPAASLDAHSEQRVMQALKAASK 533  

                   elgktvilvtHdldvaarliidlglllglledlgladrilvlddGrivee
                       t ++vtH l+ +a                   d i+v+ dG ive+
  ACF66691.1   534 --RQTTLMVTHQLEDLAD-----------------WDAIWVMQDGAIVEQ 564  

                   gtpeellenpesllaqlllllalelllevenlrist.gikeldkllsgglppgeitlivGpsG
                      + l    ++ +++ nl i++  +k+l   l+++l +ge  ++vG+sG
  ACF66691.1   340    VELAENEPVTIDAVNLIITSpEGKTLAGPLNFSLAAGERAVLVGRSG 386  

                   sGKTtLllqlavngllppdsGei..............ggkvlyvdqeesl
                   sGK++Ll+ l+  g l++++  +++ ++  +   +  +++  +v q++ l
  ACF66691.1   387 SGKSSLLNVLS--GFLSYQGSLRingvelrdlspeswRQHLSWVGQNPQL 434  

                   fpltvlenlalg...........gedveellerlgl......dlldrlph
                      t++en++l+  ++ +++ ++ +d++ + e l l  + ++  l ++++
  ACF66691.1   435 PAATLRENVLLArpdaseqelyaALDAAWVSEFLPLlpqgvdTPLGNHAS 484  

                   qlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsl
                    ls gq qrva+aral+  +  +ll+lDe            p ++ld++ 
  ACF66691.1   485 RLSVGQAQRVAVARALL--NPCQLLLLDE------------PAASLDAHS 520  

                   lrellrlLkrlakelgvtvllvthdldevarladrvlvlaggrivehgad
                    ++++++Lk   k    t+l+vth+l+++a+  d ++v+ +g ive+g+ 
  ACF66691.1   521 EQRVMQALKAASK--RQTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSY 567  

                   tvllleplggytrilrvvknrggptgeaefeitdgGlvvpgllsllelllelenltklptgipaLddvlgggipkGeivllvGpsG
                       +l + +++ ++  nl +++ + + L + l+  + +Ge  +lvG+sG
  ACF66691.1   340    VELAENEPVTIDAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSG 386  

                   sGKTtlllqlagllapdsgeillggkvlyisleeslrrrrigmvfqelgl
                   sGK+ ll+ l g+l +++     g +   +s e   +r+++  v q++ l
  ACF66691.1   387 SGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES--WRQHLSWVGQNPQL 434  

                   dpdltv...................arerviellelv..gllelldrlpr
                   +   +++++  +  ++ +++ +++ + ++v e l+l+ +g++  l  +++
  ACF66691.1   435 PAATLRenvllarpdaseqelyaalDAAWVSEFLPLLpqGVDTPLGNHAS 484  

                   elkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrl
                   +l  s gq qrv++ arall   +l  lDEp ++ld+    ++++ Lk  
  ACF66691.1   485 RL--SVGQAQRVAV-ARALLNPCQLllLDEPAASLDAHSEQRVMQALKAA 531  

                   akelgvtvllvthdlreveeladkrdrvvvlrggriveqgadvvlflrrd
                    k    t l+vth+l++++++    d + v+ +g iveqg+ ++l     
  ACF66691.1   532 SK--RQTTLMVTHQLEDLADW----DAIWVMQDGAIVEQGSYAEL----- 570  

                   eggvrelivvknrlgptgevvfeitgeGlvvvldvellpkvtlddl..vgleelkealkealellslgikpgeivllyGpp
                        ++ +vt+d ++ +  + +    k +   l++++ +ge  +l+G +
  ACF66691.1   342    LAENEPVTIDAVnlIITSPEG---KTLAGPLNFSLAAGERAVLVGRS 385  

                   GtGKTtlakalanelkkr.ggrvlyvsa......................
                   G+GK++l++ l + l  + + r+  v + +   +   ++   + ++ +  
  ACF66691.1   386 GSGKSSLLNVLSGFLSYQgSLRINGVELrdlspeswrqhlswvgqnpqlp 435  

                   ............................................delvsk
                   +++  +++  +  ++ +++ +++ +++ + +      + +++  ++  s+
  ACF66691.1   436 aatlrenvllarpdaseqelyaaldaawvseflpllpqgvdtplGNHASR 485  

                   lsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelae
                   ls g q+qrva+a+al++ + llllDE+ a +ld++  + ++++l+   +
  ACF66691.1   486 LSVG-QAQRVAVARALLNPCQLLLLDEPAA-SLDAHSEQRVMQALKAASK 533  

                   rgvtlilttnnrpeeldmssgepllevenlskry.ggklalkdvslsvekgeivlLlGpnGaGK
                       ++ ++ + + nl ++   gk++   +++s+ +ge  +L+G++G+GK
  ACF66691.1   343    AENEPVTIDAVNLIITSpEGKTLAGPLNFSLAAGERAVLVGRSGSGK 389  

                   TtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsleeall
                   ++Ll++l+g+l+++                G+++++g++l++ls+e    
  ACF66691.1   390 SSLLNVLSGFLSYQ----------------GSLRINGVELRDLSPES--- 420  

                   llfldeileidglllvelregigyvfqdpalfpeltvlenlalgllllgr
                                    +r+++++v q+p+l    t +en++l++  + +
  ACF66691.1   421 -----------------WRQHLSWVGQNPQLPAA-TLRENVLLARPDASE 452  

                   erveellervgLeklrpvllddvvgqeeakeallealagarlaledlslgirpgknvlL
                       +++pv++d v         l++    ++++   l++++ +g+  +L
  ACF66691.1   343    AENEPVTIDAV--------NLIITSPEGKTLAGPLNFSLAAGERAVL 381  

                   vGppGvGKTtlaralagll.........gapfgrvdasd...........
                   vG +G+GK++l+  l g+l ++    ++g+++  ++ ++  ++   + ++
  ACF66691.1   382 VGRSGSGKSSLLNVLSGFLsyqgslrinGVELRDLSPESwrqhlswvgqn 431  

                   ..............................................llgk
                    +  +++  +++  +  ++ +++ +++ +++ + +      + +++ lg 
  ACF66691.1   432 pqlpaatlrenvllarpdaseqelyaaldaawvseflpllpqgvdtPLGN 481  

                   yvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrr
                       ls g+ qr+++arall++  +lllDE         p ++ld++ ++
  ACF66691.1   482 HASRLSVGQAQRvaVARALLNPCQLLLLDE---------PAASLDAHSEQ 522  

                   rvlnaLlrlleglrllsgvtviattnrpeeldpallrpgrfdriieldlp
                   rv++aL+ +       ++ t +++t+ +e+l          d i +++ +
  ACF66691.1   523 RVMQALKAAS------KRQTTLMVTHQLEDLA-------DWDAIWVMQDG 559  

                   dleerleilkllleklgleldddalellaeteggsardllnlleraaala
                    +                                                
  ACF66691.1   560 AI------------------------------------------------ 561  

                   llegrevitledleealeasdelekllelrpvlledvigqeeakkalslalelplkrlelfgkld
                      a++e  +++ +                                    
  ACF66691.1   343    AENEPVTIDAV------------------------------------ 353  

                   dligrspairrllell..garpgenvlLvGppGtGKTtlakalakllgv.
                   +li+ sp+ + l   l+  +  ge  +LvG +G+GK++l++ l ++l ++
  ACF66691.1   354 NLIITSPEGKTLAGPLnfSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYq 403  

                   pfiridgselte..........kelvGe......................
                   + +ri+g el++   +   ++ + +vG++ +  +++  +++  +  ++ +
  ACF66691.1   404 GSLRINGVELRDlspeswrqhlS-WVGQnpqlpaatlrenvllarpdase 452  

                   .............................segailsggfkqrvgia.lla
                   ++ +++ +++ + +      + +++   + +++ ls g+ qrv++a +l 
  ACF66691.1   453 qelyaaldaawvseflpllpqgvdtplgnHASR-LSVGQAQRVAVArALL 501  

                   dpg.ilflDEidkllddrgeaegggdvsregvqnaLlrlleegellitgg
                   +p+++l+lDE+ + ld+ +e+          v++aL+ + +++       
  ACF66691.1   502 NPCqLLLLDEPAASLDAHSEQR---------VMQALKAASKRQ------- 535  

                   ggrikvfsnvtviaatnrlfigggaflgleelverllglnligfgadvls
                             t +++t+                                 
  ACF66691.1   536 ----------TTLMVTHQ-------------------------------- 543  

                   rlelslllllllvedllpgeldpallgRfdevielplpdleerleilkll
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   lekllkrlvdllglakltlglsdealealaelaydwpgnaRelrnllera
                                            le la+                   
  ACF66691.1   544 -------------------------LEDLADW------------------ 550  

                   lldkaidliavldlgevvteedveealdklkpslsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGK
                       +   + +++ +l   s + + L + l++++ +Ge  +lvG+sGsGK
  ACF66691.1   343    AENEPVTIDAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGK 389  

                   Ttlllqlagllalglgliplggkvlyiglelt.lsperlrlraqsl....
                   ++ll+ l g+l        ++g+  ++g el +lspe +r+ +  + ++ 
  ACF66691.1   390 SSLLNVLSGFL-------SYQGSLRINGVELRdLSPESWRQHLSWVgqnp 432  

                   ...................gldldellerllvidllelv..gllelldrl
                   +  +++  +++  +  ++ +  l  +l+  +v + l+l+ +g++  l   
  ACF66691.1   433 qlpaatlrenvllarpdasEQELYAALDAAWVSEFLPLLpqGVDTPLGNH 482  

                   prelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrl
                    + ls gq qrv++ a+all   +ll  Dep ++ld+    ++++ Lk+ 
  ACF66691.1   483 ASRLSVGQAQRVAV-ARALLNPCQLLllDEPAASLDAHSEQRVMQALKAA 531  

                   akelgvtvilvthdlrevegrleladrvvvlrggrileqgadvvlflrrd
                    k    t ++vth l+++       d ++v+ +g i+eqg+ ++l     
  ACF66691.1   532 SK--RQTTLMVTHQLEDL----ADWDAIWVMQDGAIVEQGSYAEL----- 570  

                   eggvrelivvknrlgptgevvfeiteeGlvvvklrpvlld..dvvgqeeakeallealkavllgirpgehllLvGppGt
                      +++pv++d+++++  + + + l+  l     ++ +ge  +LvG +G+
  ACF66691.1   344    ENEPVTIDavNLIITSPEGKTLAGPLNF---SLAAGERAVLVGRSGS 387  

                   GKTtlaralagel.........gapfvrlda...................
                   GK++l+++l g+l ++    ++g+++  l+++   ++   + ++ +  ++
  ACF66691.1   388 GKSSLLNVLSGFLsyqgslrinGVELRDLSPeswrqhlswvgqnpqlpaa 437  

                   ..............................................sels
                   +  +++  +  ++ +++ +++ +++ + +      + +++   +++s ls
  ACF66691.1   438 tlrenvllarpdaseqelyaaldaawvseflpllpqgvdtplgnhaSRLS 487  

                   ggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivg
                    g+ +r+++aral ++  +lllDE+ a ld++  + ++++l         
  ACF66691.1   488 VGQAQRVAVARALLnPCQLLLLDEPAAsLDAHSEQRVMQALKA------- 530  

                   ggllteldglllpsgvlviattnrpelllveklrpknldkvi...gqeealkdlslalkpgeiphalllvGppGs
                        e + ++ ++ +i+   ++++   l+++l  ge     +lvG +Gs
  ACF66691.1   344    ENEPVTIDAVNLIItspEGKTLAGPLNFSLAAGER---AVLVGRSGS 387  

                   GKttlaralagllgpdsgkilldgkdi........rrgiglvfqliglfp
                   GK++l+++l+g+l ++ g+++++g+++ +   +  r++++ v q++ l+ 
  ACF66691.1   388 GKSSLLNVLSGFLSYQ-GSLRINGVELrdlspeswRQHLSWVGQNPQLPA 436  

                   hltvlelvalglggilveevrellkel.......................
                     t++e+v l ++  + +e+ ++l+++ + +      + +++   +++  
  ACF66691.1   437 A-TLRENVLLARPDASEQELYAALDAAwvseflpllpqgvdtplgnhasr 485  

                   lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgv
                   ls Gq qrva+aral+++  +lllDEp ++ld  +++ ++++l+  +k+ 
  ACF66691.1   486 LSVGQAQRVAVARALLNPCQLLLLDEPAaSLDAHSEQRVMQALKAASKRQ 535  

                   tvilathdlsellpallsrcqvirfpplseeelleildrilvleggklve
                   t +++th l+ l                      +  d i v+++g +ve
  ACF66691.1   536 TTLMVTHQLEDL----------------------ADWDAIWVMQDGAIVE 563  

                   dgaleelaelsggdprkalnlldraaalarlellslvleidlsleelekllelllrdllglgplvklldplleeavvngasdihiep
                                                                     
  ACF66691.1     -    ----------------------------------------------- -    

                   gggllrvryridgvlielifldeeellallsrlkslaglpilearlpqgg
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   riqavlppvvvdfrvstlpdigglslvirklreviltledlglsy...gd
                                                     ++t++ ++l  +   +
  ACF66691.1   347 ----------------------------------PVTIDAVNLIItspEG 362  

                   pealkdlslaippgglvlltGptGsGKtTllralagllnpd.egriltie
                   +++   l++++ +g+  +l+G +GsGK++ll+ l g+l  + + ri  +e
  ACF66691.1   363 KTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQgSLRINGVE 412  

                   dp.............ieyvfqspnlfpl......................
                     +   +   ++   ++  +q p  +  +++  +  ++ +++ +++ +++
  ACF66691.1   413 LRdlspeswrqhlswVGQNPQLPAATLRenvllarpdaseqelyaaldaa 462  

                   ......................qlsgGqrqrvalaralrqdPdvillDEp
                    + +      + +++   +++  ls+Gq+qrva+aral+    ++llDEp
  ACF66691.1   463 wvseflpllpqgvdtplgnhasRLSVGQAQRVAVARALLNPCQLLLLDEP 512  

                   rsaldael......llqaadtGhtvlvttHdlsaaraadrllvlgdgrll
                    + lda+ ++ ++++l+aa +  t+l++tH l+ ++  d + v+ dg   
  ACF66691.1   513 AASLDAHSeqrvmqALKAASKRQTTLMVTHQLEDLADWDAIWVMQDG--- 559  

                   lasaldviiaqnlvrrldpalrrpgrldrivevgtpeellanpvsytgag
                                                ive+g+ +el           
  ACF66691.1   560 ----------------------------AIVEQGSYAEL----------- 570  

                   ceaclgtgyrgrvaileillltpalrelidlgelaeltegavgaglrtlv
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   qealllalrglisleevlrvilpllelenlsksyp.gggvlalkdvsltvepgeivalvGpnGsGKST
                         ++++ +++ +  ++g+++   +++++ +ge+ +lvG++GsGKS+
  ACF66691.1   348    ---VTIDAVNLIITsPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSS 391  

                   llkllagllkptsGeilldgldllllslaellalrrgigyvfqdpalfpg
                   ll++l+g+l  ++G+++++g++l++ls++    +r+++++v q+p+l   
  ACF66691.1   392 LLNVLSGFLS-YQGSLRINGVELRDLSPES---WRQHLSWVGQNPQLPAA 437  

                   ltvrenlalglllag...lskaeararalellell..glddlldrlvgeL
                    t+ren++l+++ a++++l +a+++a++ e+l ll +g+d+ l+ +++ L
  ACF66691.1   438 -TLRENVLLARPDASeqeLYAALDAAWVSEFLPLLpqGVDTPLGNHASRL 486  

                   SgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelg
                   S Gq qrva+arall   +llllDEp ++LD++++++++++l+   k   
  ACF66691.1   487 SVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK--R 534  

                   ltvllvthdlsealrladrilvlddGrivelgtpeellenpaslytaall
                    t+l+vth+l+ +++  d i+v++dG ive+g+++el + ++ + t    
  ACF66691.1   535 QTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAELSAANGAFATLLAH 583  

                   gpllelenlsksygg..lalkdvsltvepgeivalvGpnGaGKsTllk
                        +++ nl ++ ++ +++   +++++ +ge+ +lvG++G+GKs+ll+
  ACF66691.1   348    VTIDAVNLIITSPEgkTLAGPLNFSLAAGERAVLVGRSGSGKSSLLN 394  

                   llagllkptsgeilldgldlla.....lrrgigyvfqdpalfpgltvlen
                   +l+g+l  ++g+++++g++l++   + +r+++++v q+p+l    t++en
  ACF66691.1   395 VLSGFLS-YQGSLRINGVELRDlspesWRQHLSWVGQNPQLPAA-TLREN 442  

                   lalgllllgll.....ealaralellellglgdl...drlvseLSgGqrq
                   ++l+++ ++  + ++++++a++ e+l ll+ g ++  + ++s LS Gq q
  ACF66691.1   443 VLLARPDASEQelyaaLDAAWVSEFLPLLPQGVDtplGNHASRLSVGQAQ 492  

                   rvalarallldpdllllDEptsglDpetralllellrelaeelgltvllv
                   rva+arall   +llllDEp ++lD++++++++++l+   +    t+l+v
  ACF66691.1   493 RVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK--RQTTLMV 540  

                   thdldlalaladrivvldallelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllr
                      +++++ nl  ++++ +++   +++++ +Ge  +lvG+sGsGKs+ll+
  ACF66691.1   348    VTIDAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLN 394  

                   llagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqdpalfp
                   +l+g+l    ++G++ +++g+++     + s+e +r++++ v q+p+l  
  ACF66691.1   395 VLSGFLS---YQGSL-RINGVEL----RDLSPESWRQHLSWVGQNPQLPA 436  

                   ........................aeellelvgle.dlldrlpge....l
                   ++  +++  +  ++ +++ +++ +a+ + e++ l    +d++ g+++  l
  ACF66691.1   437 atlrenvllarpdaseqelyaaldAAWVSEFLPLLpQGVDTPLGNhasrL 486  

                   SgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkel
                   S+Gq q +a+ara ++  +llllDep + l     D+ + ++++++Lk+ 
  ACF66691.1   487 SVGQAQrvAVARAlLNPCQLLLLDEPAASL-----DAHSEQRVMQALKAA 531  

                   akelgvtvilvtH.....As.drvlvlrdgrivevgtpdelllkpllllv
                    k    t ++vtH+ ++ A+ d ++v+ dg ive+g+++el         
  ACF66691.1   532 SK--RQTTLMVTHqledlADwDAIWVMQDGAIVEQGSYAEL--------- 570  

                   llllllllllllllllllllllllllllllllllllllelllllllllll
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   kleyvrPelldepllelengrhPllsksyg.gkvvlndislsip.gellv
                                 + + n     l ++ ++gk++  ++++s+ +ge+ v
  ACF66691.1   349    ----------TIDAVN-----LIITSPeGKTLAGPLNFSLAaGERAV 380  

                   itGPngsGKSTllralaglllpasggilvpgedalll.............
                   ++G +gsGKS+ll++l g+l  ++g+++++g ++++l  +   ++   + 
  ACF66691.1   381 LVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVELRDLspeswrqhlswvg 429  

                   .................................rvdeiltrvglsdl..l
                   ++ +  +++  +++  +  ++ +++ +++ ++++v e+l ++  + ++ l
  ACF66691.1   430 qnpqlpaatlrenvllarpdaseqelyaaldaaWVSEFLPLLPQGVDtpL 479  

                   drgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeall
                   ++ +s ls g+ qrva aral+ + +lllLDEp ++ld+++ +++++al+
  ACF66691.1   480 GNHASrLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALK 529  

                   ellaellgatvlvvtHdlelaalaadrivvlngrvvadgtpeellflykl
                   + + +  + t+l+vtH le +a ++ + v+ +g +v++g+++el      
  ACF66691.1   530 A-ASK--RQTTLMVTHQLEDLADWDAIWVMQDGAIVEQGSYAELS----- 571  

                   llgvagrsyglevaklaglpelvierakellkeleslllpllelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTll
                         +++ nl ++  +g+++   +++++ +ge+ +lvG++G+GKS+ll
  ACF66691.1   349    --TIDAVNLIITSpEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLL 393  

                   kllagllkptsGeilldgldllllslaelllllrrgigyvfqdpalfpgl
                   ++l+g+l  ++G+++++g++l++ls++     +r+++++v q+p+l    
  ACF66691.1   394 NVLSGFLS-YQGSLRINGVELRDLSPES----WRQHLSWVGQNPQLPAA- 437  

                   tvrenlalglllaglskaeaaaraaellell.....glddlldrlvgeLS
                   t+ren++l+++ a+  + +aa  aa++ e+l    +g+d+ l+ +++ LS
  ACF66691.1   438 TLRENVLLARPDASEQELYAALDAAWVSEFLpllpqGVDTPLGNHASRLS 487  

                   gGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgl
                    Gq qrva+arall   +llllDEp ++LD++++++++++l+   k    
  ACF66691.1   488 VGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK--RQ 535  

                   tvllvthdlsealrladrilvlddGrivelgtpeellenpaslytaell<
                   t+l+vth+l+ +++  d i+v++dG ive+g+++el              
  ACF66691.1   536 TTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAEL-------------  570  

                   -*
                     
  ACF66691.1     -    -    

0043651: domain 1 of 1, from 349 to 551: score 131.7, E = 5.1e-38
                   *->ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrk
                                                       +++ nl ++ ++ k
  ACF66691.1   349    --------------------------------TIDAVNLIITSPEGK 363  

                   lvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpds
                   +         ++  +++++ +Ger +lvG+sG+GK++Ll++l+g+l  + 
  ACF66691.1   364 T---------LAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ- 403  

                   Geilvdgligerlrevlelirelelaelrrrigyvfqdpalpallrllal
                   G+ +++g+           +r+l ++++r+++++v q+p l         
  ACF66691.1   404 GSLRINGV----------ELRDLSPESWRQHLSWVGQNPQL--------- 434  

                   fpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpg
                    pa t++en++++++ a   +l+ a+++a + +++ +l++++ + +g   
  ACF66691.1   435 -PAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLG--- 480  

                   dlftllsrlderagnlSgGqrqrvaiaralasdpdllilDEptsglDpet
                               a++lS Gq qrva+aral++  +ll+lDEp + lD+++
  ACF66691.1   481 ----------NHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHS 520  

                   v..llralae...ggtvllishdlsvvrladrvtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGpp
                       +  +++  +++ ++l+  l   l            +g+  +l+G +
  ACF66691.1   350    IDAVNLIITSPEGKTLAGPLNFSL-----------AAGERAVLVGRS 385  

                   GtGKTtlaralanel.gapfirvdasellek...................
                   G+GK++l+  l ++l   + +r+++ el+++  +   ++   + ++ +  
  ACF66691.1   386 GSGKSSLLNVLSGFLsYQGSLRINGVELRDLspeswrqhlswvgqnpqlp 435  

                   ................................................lv
                   +++  +++  +  ++ +++ +++ +++ + +      + +++   +++ +
  ACF66691.1   436 aatlrenvllarpdaseqelyaaldaawvseflpllpqgvdtplgnhaSR 485  

                   gegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLl
                    + ++ +r+a+a+al +   +l+lDE+             ld+   + ++
  ACF66691.1   486 LSVGQAQRVAVARALLNPCQLLLLDEP----------AASLDAHSEQRVM 525  

                   rlleelrvlsgvlviattnrpeellelknlslsyg..ksilkdvsleip.geltalvGpnGsGKStllkal
                      +   nl ++ ++ k++   +++++ +ge+ +lvG++GsGKS+ll++l
  ACF66691.1   350    IDAVNLIITSPegKTLAGPLNFSLAaGERAVLVGRSGSGKSSLLNVL 396  

                   agllgpdvsallrlsglidlilkgllllprstvatvelifdllgllliir
                   +g+l +                                            
  ACF66691.1   397 SGFLSY-------------------------------------------- 402  

                   rlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltvlenll
                          +g+++i+g+++++l+++++r+++++v q+p+l    t++en+l
  ACF66691.1   403 -------QGSLRINGVELRDLSPESWRQHLSWVGQNPQLP-AATLRENVL 444  

                   lglelrrklldellgllellalleellklleellkelevleaalaallke
                   l+++++                             e e++ a+ aa+  e
  ACF66691.1   445 LARPDAS----------------------------EQELYAALDAAWVSE 466  

                   eieeraeellellglgglldrpvstLSgGekqrvalaralallelldppl
                   ++  +++++ + lg         s LS G+ qrva+aral+    ++++l
  ACF66691.1   467 FLPLLPQGVDTPLGNHA------SRLSVGQAQRVAVARALL----NPCQL 506  

                   llLDEptsgLDpetreallellrelakgrtvivvtHdlellaladriivl
                   llLDEp ++LD++++++++++l+  +k+ t+++vtH+le la  d i+v+
  ACF66691.1   507 LLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVM 556  

                   gedGriveegtpeeyvlPllsdgmpllelenlrkpy.ggllvlndvsl...pgeivaltGp
                                  +++ nl  +  +g+++   +++  ++ge+ +l+G 
  ACF66691.1   350    ------------IDAVNLIITSpEGKTLAGPLNFslaAGERAVLVGR 384  

                   nGaGKSTllrllaglllpasggilvdgedlr..........igyvfq...
                   +G+GKS+ll++l g+l  ++g+++++g++lr+   +   +++++v q+ +
  ACF66691.1   385 SGSGKSSLLNVLSGFL-SYQGSLRINGVELRdlspeswrqhLSWVGQnpq 433  

                   ...................................llervgledlldrlp
                     +++  +++  +  ++ +++ +++ +++ + +   l   g++  l+ ++
  ACF66691.1   434 lpaatlrenvllarpdaseqelyaaldaawvseflPLLPQGVDTPLGNHA 483  

                   stlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallella
                   s ls+Gq qrva++ral+++ +llLlDEp ++ld+++ +++++al+   +
  ACF66691.1   484 SRLSVGQAQRVAVaRALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK 533  

                   elgatvlfvtHdlelaalladrvvvlndgrivavgtpeelyklpaglldr
                     ++t+l+vtH le +a+  d ++v+ dg iv++g+++el          
  ACF66691.1   534 --RQTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAEL---------- 570  

                   slallvaelaglpklvierallllkeleenlepllevenlsksy.ggvlalkdvsltvkpgeivalvGpnGsGKSTl
                          +++ nl ++  +g+++   +++++ +ge+ +lvG++GsGKS+l
  ACF66691.1   350    ----IDAVNLIITSpEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSL 392  

                   lkllagllkptsGeilldglditalslaelrrrgigyvfqdpalfpgltv
                   l++l+g+l  ++G+++++g+++++ls++ +r++ +++v q+p+l    t+
  ACF66691.1   393 LNVLSGFLS-YQGSLRINGVELRDLSPESWRQH-LSWVGQNPQLPAA-TL 439  

                   renlalglllllllllllllllllalskaearervlellelvgldtlldr
                   ren++l+++ +      ++++l++al++a++ e++  l++  g+dt l+ 
  ACF66691.1   440 RENVLLARPDA------SEQELYAALDAAWVSEFLPLLPQ--GVDTPLGN 481  

                   lvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrel
                   +++ LS Gq qrva+arall   +llllDEp ++LD++++++++++l+  
  ACF66691.1   482 HASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAA 531  

                   akegltvllvthdldealrladrilvlddGrivelgtpeellenpgllgl
                    k   t+l+vth+l+ +++  d i+v++dG ive+g+++el +  g +++
  ACF66691.1   532 SK-RQTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAELSAANGAFAT 579  

                   llgeelglllllllallllllllllldpllelenlsksyggrlvlalkdvsltvk
                                           + + nl ++ ++++ ++   +++++ 
  ACF66691.1   350    ---------------------IDAVNLIITSPEGK-TLAGPLNFSLA 374  

                   pgeivalvGpnGsGKSTllkllagllkptsGeilldgldilalslaelrr
                   +ge+ +lvG++GsGKS+ll++l+g+l  ++G+++++g+++++ls++ +r+
  ACF66691.1   375 AGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVELRDLSPESWRQ 423  

                   rigyvfqdpalfpltvrenlalglllallllglskaeararalellellp
                   ++++v q+p+l   t+ren++l+++ a + ++l++a+++a++ e+l llp
  ACF66691.1   424 HLSWVGQNPQLPAATLRENVLLARPDA-SEQELYAALDAAWVSEFLPLLP 472  

                   lgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetra
                   +g+dt l+ +++ LS Gq qrva+Arall + +llllDEp ++LD+++++
  ACF66691.1   473 QGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQ 522  

                   ellellrelakgltvllvthdlslaaladrilvlddGrivelgtpeelelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkll
                      +++ nl ++  +g+++   +++++ +ge+ +lvG++G+GKS+ll++l
  ACF66691.1   350    IDAVNLIITSpEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVL 396  

                   agllkptsGeilldgldllalsl..lrrrigyvfqdpalfpgltvrenla
                   +g+l  ++G+++++g++l++ls++ +r+++++v q+p+l    t+ren++
  ACF66691.1   397 SGFLS-YQGSLRINGVELRDLSPesWRQHLSWVGQNPQLPAA-TLRENVL 444  

                   lgllll...glskaeaaaralellell..glddlldrlvgeLSgGqrqrv
                   l+++ + +++l +a++aa++ e+l ll +g+d+ l+ +++ LS Gq qrv
  ACF66691.1   445 LARPDAseqELYAALDAAWVSEFLPLLpqGVDTPLGNHASRLSVGQAQRV 494  

                   alarallldpdllllDEptsgLDpetraellellrelakelgltvllvth
                   a+arall   +llllDEp ++LD++++++++++l+   k    t+l+vth
  ACF66691.1   495 AVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK--RQTTLMVTH 542  

                   dlsealaladrilvlddGrivelgtpeellenpaslytaellgllllllllalllelleeeeellllllalllllgdpllelenlsksy.
                                                          +++ nl ++  
  ACF66691.1   350    ------------------------------------IDAVNLIITSp 360  

                   ggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilid
                   +g+++   +++++ +Ge+ +lvG++GsGKS+Ll++l+g+l  ++G+++i+
  ACF66691.1   361 EGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRIN 409  

                   gkditglspqelrrlgglvlqdvllffltll..............lllaa
                   g+++++lsp+ +r+++ +v q ++l+  tl++++  +  ++ +++l++a+
  ACF66691.1   410 GVELRDLSPESWRQHLSWVGQNPQLPAATLRenvllarpdaseqeLYAAL 459  

                   keaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllL
                   ++a++ ++l ll+ g +t l+  +s LS Gq qRva+Arall+  +lllL
  ACF66691.1   460 DAAWVSEFLPLLPQGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLL 509  

                   DEPtsgLDpetraellellrelakegktvllvtHdlsealladrilvldd
                   DEP ++LD++++++++++l+   k   t+l+vtH+l+ ++  d i+v+ d
  ACF66691.1   510 DEPAASLDAHSEQRVMQALKAASK-RQTTLMVTHQLEDLADWDAIWVMQD 558  

                   Griveegtpeellanpgllytllllgalpllllelekleellegaagll<
                   G ive+g+++el a  g ++tll +++ ++                    
  ACF66691.1   559 GAIVEQGSYAELSAANGAFATLLAHRQEDIXX-----------------  590  

                   -*
                     
  ACF66691.1     -    -    

0050374: domain 1 of 1, from 350 to 563: score 44.1, E = 9.4e-13
                   *->fifldlrplallplpdrlvgrdeeiealskalgg.....aldgvsls
                                              i+a+  ++ + + +++   +++s
  ACF66691.1   350    ------------------------IDAVNLIITSpegktLAGPLNFS 372  

                   iepggivllvGppGvGKTtLakllagllkpkfgeillfgkvvyvnvsell
                   +  g++ +lvG++G+GK++L++ l g l+++          +++n  el+
  ACF66691.1   373 LAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ--------GSLRINGVELR 414  

                   dl................................................
                   dl  +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ +
  ACF66691.1   415 DLspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawv 464  

                   kellrlllealglpppyq...lsggerlrvalaeallalgkpdllilDEi
                    e+l ll + ++ p ++++  ls g+ +rva+a+al  l+   ll+lDE+
  ACF66691.1   465 SEFLPLLPQGVDTPLGNHasrLSVGQAQRVAVARAL--LNPCQLLLLDEP 512  

                   tnlldpetlspdvlelLlrlleegkltdkllgltliltthdldllerlad
                      ld+++  + v+++L+ + ++ +        tl++t  ++dl++   d
  ACF66691.1   513 AASLDAHS-EQRVMQALKAASKRQT--------TLMVTHQLEDLADW--D 551  

                   rllsrfngkgivielpplseeelleilkkrlfeagvelvfddealellae
                   +++++ +  g ++e                                    
  ACF66691.1   552 AIWVMQD--GAIVE------------------------------------ 563  

                   lsarivkkcgglrlaldllrralelaelegwekileelvrealeelMlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlld
                       +   nl ++ +  + l ++ +++++ +g++ ++vG++GsGKS+ll+
  ACF66691.1   350    -IDAVNLIITSPEgkTLAGP-LNFSLAAGeRAVLVGRSGSGKSSLLN 394  

                   alagllggrslrllragglsdliflgslirsgadrasvelvfdlsdglyl
                   +l+g+l                                            
  ACF66691.1   395 VLSGFL-------------------------------------------- 400  

                   lerselilrrlilkpgsgeilingkdislldlrelrrligyvpqdpnllf
                                  ++g+++ing+++++l+++++r+++++v q+p +l+
  ACF66691.1   401 --------------SYQGSLRINGVELRDLSPESWRQHLSWVGQNP-QLP 435  

                   qltvlenlllgpeerrelldellglellsleealaraeealeelnallke
                     t++en+ll+++++            ++   a   a+ + e+       
  ACF66691.1   436 AATLRENVLLARPDAS-----------EQELYAALDAAWVSEF------- 467  

                   leeeleligplldglellvglnglldrplselSgGekqrlalaralalae
                          +  l++g+++ +g +  +      lS G+ qr+a+aral+   
  ACF66691.1   468 -------LPLLPQGVDTPLGNHASR------LSVGQAQRVAVARALL--- 501  

                   lkdppllllDEptagLDpetrerllellkelaegrqvivvtHdlelaala
                    ++++llllDEp a+LD+++++r++++lk  +++ + ++vtH le +a  
  ACF66691.1   502 -NPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADW 550  

                   driivltkeedGriveegtpeelleelarylggelllllllllllaeellelleeeelllllllllllllgdpllelenlsks
                                                            + + nl ++
  ACF66691.1   350    --------------------------------------IDAVNLIIT 358  

                   y.ggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeil
                     +g+++   +++++ +Ge+ +lvG++GsGKS+Ll++l+g+l  ++G+++
  ACF66691.1   359 SpEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLR 407  

                   idgkditglspqelrrlgglvlqdvllffltll..............lll
                   i+g+++++lsp+ +r+++ +v q ++l+  tl++++  +  ++ +++l++
  ACF66691.1   408 INGVELRDLSPESWRQHLSWVGQNPQLPAATLRenvllarpdaseqeLYA 457  

                   aakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdll
                   a+++a++ ++l ll+ g +t l+  +s LS Gq qRva+Arall+  +ll
  ACF66691.1   458 ALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLL 507  

                   llDEPtsgLDpetraellellrelakegktvllvtHdlsealladrilvl
                   llDEP ++LD++++++++++l+   k   t+l+vtH+l+ ++  d i+v+
  ACF66691.1   508 LLDEPAASLDAHSEQRVMQALKAASK-RQTTLMVTHQLEDLADWDAIWVM 556  

                   ddGriveegtpeellenpgllytllllgalpllllellteeeeeeleagl
                    dG ive+g+++el +  g ++tll +++ ++                  
  ACF66691.1   557 QDGAIVEQGSYAELSAANGAFATLLAHRQEDIXX---------------- 590  

                   llkleeveristgipeldellgGglpkgslilitGppGsGKTtlalqla
                         ++++ s + + l   l+  l  g+  +++G++GsGK++l++ l 
  ACF66691.1   351    DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLS 397  

                   anlaknggkvlyisle...esreqlleraerlgldleell..llgllsil
                   + l  + g+  + ++e  + s+e  +++++ +g +++ + ++l++++ ++
  ACF66691.1   398 GFLSYQ-GSLRINGVElrdLSPESWRQHLSWVGQNPQLPAatLRENVLLA 446  

                   iad.................................plglsgeellrvll
                   + d+ +++ +++ +++ + +      + +++   ++ ++ls+++ +rv++
  ACF66691.1   447 RPDaseqelyaaldaawvseflpllpqgvdtplgnhASRLSVGQAQRVAV 496  

                   alalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvs
                   a+al ++  ll++De+ a lda +++ ++++l a     ++++ t+++v+
  ACF66691.1   497 ARALLNPCQLLLLDEPAASLDAHSEQRVMQALKA-----ASKRQTTLMVT 541  

                   qltelildalagggaleqladgvillkrdetakggrriliivknrggptg
                   +  e++ d                                          
  ACF66691.1   542 HQLEDLAD------------------------------------------ 549  

                   evplvfiitgegiedlppfsalflvlgllgvsgelenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrll
                      ++ nl +++++ k L + l++++ +Ge+ +lvG+sGsGK++l l++l
  ACF66691.1   351    DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSL-LNVL 396  

                   agllkptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenla
                    g+l   +g+ +i+g+el+  ++  +r+++++v q+p l    t +en++
  ACF66691.1   397 SGFLSY-QGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAA-TLRENVL 444  

                   lgll...............................drlpgeldlSgglqr
                   l++ ++ +++ +++ +++ + +      + +++     ++   lS+g q 
  ACF66691.1   445 LARPdaseqelyaaldaawvseflpllpqgvdtplGNHASR--LSVG-QA 491  

                   qrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgv
                   qrva+a + ++  +llllDep + l     d+++ ++++++lk   ++++
  ACF66691.1   492 QRVAVAralLNPCQLLLLDEPAASL-----DAHSEQRVMQALKAASKRQT 536  

                   tvilvthdleeaedladsgriavladgrivlegdlaelglrralivlksr
                   t+++++++    edlad ++i+v+ dg iv++g++ae             
  ACF66691.1   537 TLMVTHQL----EDLADWDAIWVMQDGAIVEQGSYAE------------- 569  

                   lgplgtvilvfeitdggivvldlllllllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllag
                       ++ +  s +g+++   +++++ +ge+ +lvG++G+GKS+ll++l+g
  ACF66691.1   352    AVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSG 398  

                   llptsGeilldgldltalslaelrrgigyvfqdpalfpgltvrenlalgl
                   +l ++G+++++g++l++ls++ +r+++++v q+p+l    t+ren++l++
  ACF66691.1   399 FLSYQGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAA-TLRENVLLAR 447  

                   l........kaeararalellell..gldelldrlvgeLSgGqrqrvala
                   +++ +++ ++a+++a++ e+l ll +g+d+ l+ +++ LS Gq qrva+a
  ACF66691.1   448 PdaseqelyAALDAAWVSEFLPLLpqGVDTPLGNHASRLSVGQAQRVAVA 497  

                   rallllleelsldpdllllDEPtsglDpetraellellrelakegltvll
                   rall          +llllDEP ++lD++++++++++l+   k   t+l+
  ACF66691.1   498 RALLN-------PCQLLLLDEPAASLDAHSEQRVMQALKAASK-RQTTLM 539  

                   vthdldealrladrilvlddGrivelgtpeellenpllllvlgllknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgl
                      ++ +  s + +++   ++++l  g++ +l+G+sgsGKS+lln l g 
  ACF66691.1   353    VNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGF 399  

                   eygpTiginegtieidgvkltlwDtgGqesfrklwilyfegadaiifvvd
                             g+++i+gv+l+                             
  ACF66691.1   400 L------SYQGSLRINGVELR----------------------------- 414  

                   asdrdsflnldkwrnrlgevlqllelilnltvlenvpiilvlNKiDllee
                       +s +  ++ ++ +g+  ql    l+  vl   p       +  l++
  ACF66691.1   415 ---DLSPESWRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDA 461  

                   kiveellellgleykgd..rdpeelsggqkqrvalaralakdpdilll..
                    +v+e+l ll ++  ++  ++ + ls gq qrva aral++  ++lll++
  ACF66691.1   462 AWVSEFLPLLPQGVDTPlgNHASRLSVGQAQRVAVARALLNPCQLLLLde 511  

                   ptsaldgegvdelfdallelilelnlrivtthlllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvG
                                      v+ +  s +g+++   +++++ +ge+ +lvG
  ACF66691.1   353    ----------------VNLIITSPEGKTLAGPLNFSLAAGERAVLVG 383  

                   pnGsGKSTllkllagllkptsGeilldgkdildlslaelrgigyvfqqda
                   ++GsGKS+ll++l+g+l  ++G+++++g++++dls++ +r++  ++ q +
  ACF66691.1   384 RSGSGKSSLLNVLSGFLS-YQGSLRINGVELRDLSPESWRQHLSWVGQNP 432  

                   llpsltvlenlllglllagellllllaakeaalralllllllgletlldr
                   +lp  t++en+ll+++ a  + +l+ a+++a++ ++l ll+ g +t l+ 
  ACF66691.1   433 QLPAATLRENVLLARPDAS-EQELYAALDAAWVSEFLPLLPQGVDTPLGN 481  

                   lpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrel
                    +s LS Gq qrva+Arall+  +llllDEP ++LD++++++++++l+  
  ACF66691.1   482 HASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAA 531  

                   akegltvllvtHdlsealrladrilvlddGriveegtpeellenpgllaa
                    k   t+l+vtH+l+ +++  d i+v++dG ive+g+++el + +g +a+
  ACF66691.1   532 SK-RQTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAELSAANGAFAT 579  

                   llglrvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaG
                       v  +  s  gkt+   +++s+++G++ +L+G++G+GKS+ll++l+G
  ACF66691.1   353    -VNLIITSPEGKTLAGPLNFSLAAGeRAVLVGRSGSGKSSLLNVLSG 398  

                   llkpt.............................................
                   +l  +   ++  ++ ++   +  +++   + +  +  ++  ++ +  ++ 
  ACF66691.1   399 FLSYQgslringvelrdlspeswrqhlswvgqnpqlpaatlrenvllarp 448  

                   .........................................lallelrnt
                   ++ +++ +++ +++ + +      + ++     ++ +  + +a      +
  ACF66691.1   449 daseqelyaaldaawvseflpllpqgvdtplgnhasrlsvgQAQRVAVAR 498  

                   teagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeae
                   +  ++ +    ++  + l++++ ++++++l+ + +++t l+vth+l+ ++
  ACF66691.1   499 ALLNPCQLLLLDEPAASLDAHSEQRVMQALKAasKRQTTLMVTHqLEDLA 548  

                   raDrvavldd......Gtpeellarpanpyvrellgavpgllllalllll
                     D ++v++d +++++G+++el a  an+  + ll++             
  ACF66691.1   549 DWDAIWVMQDgaiveqGSYAELSA--ANGAFATLLAHR------------ 584  

                   elllllllllllelrelvdehallfelgvlpkklrdsadrskllklleas
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   llgglssaltkslrdlllpenMlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellr
                       +  s +g+++  ++++s+ +g++ +++G sGsGK++l++ L+++l 
  ACF66691.1   355    LIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS 401  

                   erggsvavidlddfyrpaaell.lreglgidfqlpdal............
                    +g s  + ++++  ++++  +++   +g ++qlp a   +++  +  ++
  ACF66691.1   402 YQG-SLRINGVELRDLSPESWRqHLSWVGQNPQLPAATlrenvllarpda 450  

                   .........drellreevlellgl..gevvivdvydlsggerqr...ara
                    +++ +++ d++++  e+l+ll + ++  +   ++ ls g+ qr+++ara
  ACF66691.1   451 seqelyaalDAAWVS-EFLPLLPQgvDTPLGNHASRLSVGQAQRvavARA 499  

                   lasgpdvlilDgptlgldv...........lldlpdlvifvdhdlevale
                   l++++++l+lD+p + ld + ++ ++++ + +++  ++++v+h le ++ 
  ACF66691.1   500 LLNPCQLLLLDEPAASLDAhseqrvmqalkAASKRQTTLMVTHQLEDLAD 549  

                   rrlkrlgrsleeiiefllevdeayekliaplkdadlvldllalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTl
                                + +s +g+++   +++++ +ge+ +lvG++GsGKS+l
  ACF66691.1   356    ----------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSL 392  

                   lkllagllkptsGeilldgkdilglslaelllllrrgigyvfqdpalfpg
                   l++l+g+l  ++G+++++g+++++ls++ +    r+++++v q+p l   
  ACF66691.1   393 LNVLSGFLS-YQGSLRINGVELRDLSPESW----RQHLSWVGQNPQLPAA 437  

                   ltvlenlllgllllglllllaakeaalrlellllllgletlldrlvseLS
                   + ++++ll  + ++  +l++a+++a++ ++l ll+ g +t l+ ++s LS
  ACF66691.1   438 TLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLS 487  

                   gGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakeglt
                    Gq qrva+arall+  +llllDEP ++LD++++++++++l+   k   t
  ACF66691.1   488 VGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK-RQT 536  

                   vllvthdldealrladrilvlddGrivelgtpeellllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKST
                                 + +s +g+++   +++++ +ge+ +lvG++GsGKS+
  ACF66691.1   356    -----------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSS 391  

                   llkllagllkptsGeilldgkdilglsllellrrgigyvfqdpalfpglt
                   ll++l+g+l + +G+++++g+++++ls++  +r+++++v q+p l   ++
  ACF66691.1   392 LLNVLSGFLSY-QGSLRINGVELRDLSPES-WRQHLSWVGQNPQLPAATL 439  

                   vlenlllgllllglalkeaalra....lllllllgletlldrlvseLSgG
                   ++++ll  + +   +l++a  +a + ++l ll+ g +t l+ ++s LS G
  ACF66691.1   440 RENVLLARPDASEQELYAALDAAwvseFLPLLPQGVDTPLGNHASRLSVG 489  

                   qrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvl
                   q qrva+arall+  +llllDEP ++LD++++++++++l+   k   t+l
  ACF66691.1   490 QAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK-RQTTL 538  

                   lvthdldealrladrilvlddGrivelgtpeellenpgllaallgeallllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllk
                              + +s +g+++   +++++ +ge+ +lvG++GsGKS+ll+
  ACF66691.1   356    --------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLN 394  

                   llagllkptsGeilldgkdilglslkelrgigyvvqqdallpsltvlenl
                   +l+g+l  ++G+++++g+++++ls++ +r++  +v q ++lp  t++en+
  ACF66691.1   395 VLSGFLS-YQGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAATLRENV 443  

                   llgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqr
                   ll+++ ++  +l++a+++a++ ++l ll+ g +t l+  +s LS Gq qr
  ACF66691.1   444 LLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQAQR 493  

                   valArallldpkllllDEPtsgLDpetraellellrelakgltvllvthd
                   va+Arall+  +llllDEP ++LD++++++++++l+   k  t+l+vth+
  ACF66691.1   494 VAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQ 543  

                   lsearladrilvlddGrivelgtpeellenpgllytllllgeellllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkl
                             + +s +g+++   +++++ +ge+ +lvG++GsGKS+ll++
  ACF66691.1   356    -------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNV 395  

                   lagllkptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenll
                   l+g+l + +G+++++g++++dls++ +r++  ++ q ++lp  t++en+l
  ACF66691.1   396 LSGFLSY-QGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAATLRENVL 444  

                   lgllllgellllllaakeaalralllllllgletlldrlpseLSgGqrqr
                   l+++ +    +l+ a+++a++ ++l ll+ g +t l+  +s LS Gq qr
  ACF66691.1   445 LARPDAS-EQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQAQR 493  

                   valArallldpdllllDEPtsgLDpetraellellrelakgltvllvthd
                   va+Arall+  +llllDEP ++LD++++++++++l+   k  t+l+vth+
  ACF66691.1   494 VAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQ 543  

                   lsealladrilvlddGrivelgtpeellenpgllytllllsslpglllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKST
                                 + +s +g+++   +++++ +ge+ +lvG++G+GKS+
  ACF66691.1   356    -----------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSS 391  

                   llkllagllkptsGeilldgkdildlsl..lrrgigyvfqdpalfpgltv
                   ll++l+g+l  ++G+++++g++++dls++ +r+++++v q+p l   +++
  ACF66691.1   392 LLNVLSGFLS-YQGSLRINGVELRDLSPesWRQHLSWVGQNPQLPAATLR 440  

                   lenlllgllllglslaeaaera....lelllllgledlldrlvseLSgGq
                   +++ll  + +   +l++a  +a + +++ ll+ g ++ l+ ++s LS Gq
  ACF66691.1   441 ENVLLARPDASEQELYAALDAAwvseFLPLLPQGVDTPLGNHASRLSVGQ 490  

                   rqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvl
                    qrva+arall+  +llllDEP ++LD++++++++++l+   k    t+l
  ACF66691.1   491 AQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK--RQTTL 538  

                   lvthdlsealrladrilvlddGrivelgtpeellenpkslytaallgglllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkl
                             + +s +g+++   +++++ +ge+ +lvG++GsGKS+ll++
  ACF66691.1   356    -------IITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNV 395  

                   lagllkptsGeilldgkdilglslaelrgigyvfqqlallpsltvlenla
                   l+g+l  ++G+++++g+++++ls++ +r++  ++ q ++lp  t++en++
  ACF66691.1   396 LSGFLS-YQGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAATLRENVL 444  

                   lgllllglskaeaaaraaellell.....gledlldrlpseLSgGqrqrv
                   l+++ +   + +aa  aa++ e+l    +g ++ l+ ++s LS Gq qrv
  ACF66691.1   445 LARPDASEQELYAALDAAWVSEFLpllpqGVDTPLGNHASRLSVGQAQRV 494  

                   alArallldpdllllDEPtsgLDpetraellellrelakegltvllvthd
                   a+Arall+  +llllDEP ++LD++++++++++l+   k   t+l+vth+
  ACF66691.1   495 AVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK-RQTTLMVTHQ 543  

                   ldealrladrilvlddGrivelgtpeellenpgllytllllgslpgllllllaleelpllgelllevknlsksyggvlalkdvsltikpgeiv
                                             +  s +g+++   +++++ +ge+ 
  ACF66691.1   356    -----------------------IITSPEGKTLAGPLNFSLAAGERA 379  

                   alvGpnGsGKSTllkllagllkptsGeilldgkditdlslkelrgigyvv
                   +lvG++GsGKS+ll++l+g+l  ++G+++++g++++dls++ +r++  +v
  ACF66691.1   380 VLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVELRDLSPESWRQHLSWV 428  

                   qqdallpsltvlenlllgllllgllllllaakeaalralllllllgletl
                    q ++lp  t++en+ll+++ ++  +l++a+++a++ ++l ll+ g +t 
  ACF66691.1   429 GQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTP 478  

                   ldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellell
                   l+  +s LS Gq qrva+Arall+  +llllDEP ++LD++++++++++l
  ACF66691.1   479 LGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQAL 528  

                   relakgltvllvtHdlsealladrilvlddGriveegtpeellenpglly
                   +   k  t+l+vtH+l+ ++  d i+v+ dG ive+g+++el + +g ++
  ACF66691.1   529 KAASKRQTTLMVTHQLEDLADWDAIWVMQDGAIVEQGSYAELSAANGAFA 578  

                   lllleeglskiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlL
                      +   g+++   +++++ +        ge+ ++vG sGsGKs+ll+ L
  ACF66691.1   358    TSPEGKTLAGPLNFSLAA--------GERAVLVGRSGSGKSSLLNVL 396  

                   agllkpllltggkvlvigldifrlsarelrkrig.vfqdpallphltvpe
                    g+l     ++g+ +++g+++ +ls  ++r+++  v q+p  lp  t +e
  ACF66691.1   397 SGFLS----YQGSLRINGVELRDLSPESWRQHLSwVGQNP-QLPAATLRE 441  

                   nldlgllleilervlellelvgldvvlldtyph...........elSgGq
                   n+ l+++ + +++++++l+++  ++ +l+ +p  +++   +++  lS Gq
  ACF66691.1   442 NVLLARPDASEQELYAALDAAWVSE-FLPLLPQgvdtplgnhasRLSVGQ 490  

                   rqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrt
                   +qRva+aral+++ ++lllDEp + lD+++ +  +++ l+    k   +t
  ACF66691.1   491 AQRVAVARALLNPCQLLLLDEPAASLDAHSEQ-RVMQALK-AASK--RQT 536  

                   iilvthdlreae.adrilvlrkgdivelgepqellaepklprvakkilsi
                    ++vth+l+++ + d i+v+ +g ive+g+  el a   +  +   + + 
  ACF66691.1   537 TLMVTHQLEDLAdWDAIWVMQDGAIVEQGSYAELSAANGAFATLLAHRQE 586  

                   dllkdfieqllrilkgllkdllsllpglkladlvllldedhlileillrk
                   d+                                                
  ACF66691.1   587 DI------------------------------------------------ 588  

                   llkerllllelrnvllddviGqeeakealsealelplkrpelfdglgve
                      +e ++l    n++l                                 
  ACF66691.1   360    PEGKTLAGPLNFSLA-------------------------------- 374  

                   lpgknvlLvGppGvGKTtlaralakllga.pfiridgseltekdyvGesv
                    +g+  +LvG +G+GK++l+  l ++l +++ +ri+g el++        
  ACF66691.1   375 -AGERAVLVGRSGSGKSSLLNVLSGFLSYqGSLRINGVELRDL------- 416  

                   earlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggd
                         +++  +++v q+p l  +t++en++l++ ++             
  ACF66691.1   417 --SPESWRQH-LSWVGQNPQLPAATLRENVLLARPDA------------- 450  

                   lggllteavlealriklvegelgfrelerevlldlplhdasviallgggr
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   elrdgellkalkeaeaeelle..llglkdlllrkpsqlSgGqkqRvalar
                      + el++al  a + e+l   + g+++ l+ ++s lS+Gq qRva ar
  ACF66691.1   451 --SEQELYAALDAAWVSEFLPllPQGVDTPLGNHASRLSVGQAQRVAVAR 498  

                   alladpgvlflDEidklldargssggdesrervlnaLlelleggevlsnv
                   all++  +l+lDE+ + lda        s++rv++aL+ + ++       
  ACF66691.1   499 ALLNPCQLLLLDEPAASLDA-------HSEQRVMQALKAASKRQ------ 535  

                   tviaatnrlliaigafeflkadeldpaLlrRfdlvievplpdeeerleil
                   t +++t+ l            ++l                          
  ACF66691.1   536 TTLMVTHQL------------EDLA------------------------- 548  

                   klllkklelqlvdlselakltlglsdaaldllaeaaarlrlydeeggaRe
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   llrllerllllaladriavleggkviteedveealekllpsrdleelef<
                                 d+i+v+++g +++++ ++e+                
  ACF66691.1   549 ------------DWDAIWVMQDGAIVEQGSYAEL---------------  570  

                   -*
                     
  ACF66691.1     -    -    

0041032: domain 1 of 1, from 360 to 398: score 21.2, E = 4.6e-05
                   *->yggllllkdlslelkkglkilllGlngaGKTTllnrllgyygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepg
                       + ++t    +++++ +ge+ +lvG sGsGKs+l++ L+g+l     
  ACF66691.1   360    -PEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFL---SY 402  

                   sgvvlldgddlr......lglliglvfqdpdllpfltvlenvllpllaag
                    g  +++g +lr+   + +++++++v q+p+l    t++envll++ +a 
  ACF66691.1   403 QGSLRINGVELRdlspesWRQHLSWVGQNPQLPAA-TLRENVLLARPDAS 451  

                   liv........ivdgtlllvglrealrkll....gllsgGqkqrvadlvv
                       +++ +++ v ++l+l  l + ++  l +++  ls Gq qrva++++
  ACF66691.1   452 EQElyaaldaaWVSEFLPL--LPQGVDTPLgnhaSRLSVGQAQRVAVARA 499  

                   lldadpevllaReptrgldpeteeeleellerleereplygadiviithd
                   ll+ + ++ll++ep+  ld  +e+ +++ l++       ++ + +++th 
  ACF66691.1   500 LLN-PCQLLLLDEPAASLDAHSEQRVMQALKAAS-----KRQTTLMVTHQ 543  

                   lsieevadrilallegrlvllallglklllrrlslllkkglkvllvGlpgvGKstllnrlagMknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagl
                              +++++   ++++l +G++ +lvG++GsGKS+Ll++l+g+
  ACF66691.1   361    --------EGKTLAGPLNFSLAAGeRAVLVGRSGSGKSSLLNVLSGF 399  

                   lgpdsglrvgklsdlirrgadkasvelvfeldggllallrllslsggekl
                   l +++                                             
  ACF66691.1   400 LSYQG--------------------------------------------- 404  

                   rvalakallgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfp
                               ++++ng++++ l+++ +      r+++++v q++ l  
  ACF66691.1   405 ------------SLRINGVELRDLSPESW------RQHLSWVGQNPQLP- 435  

                   lltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelar
                     t +en++l+++ a   +                               
  ACF66691.1   436 AATLRENVLLARPDASEQE------------------------------- 454  

                   llelleglkeeaekakalleelkeleklllayllqlleilllllltllea
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   llgllraelearalellervgl.pgdlldrpvstLSGGekqrlalArala
                      l+ a + a++ e+l ++    ++ l+ ++s LS G+ qr+a+Aral+
  ACF66691.1   455 ---LYAALDAAWVSEFLPLLPQgVDTPLGNHASRLSVGQAQRVAVARALL 501  

                   laellakdpplllLDEPtagLDpetreallelLrelakegrtvivvtHdl
                         ++++lllLDEP a+LD++++++++++L+  +k   t ++vtH+l
  ACF66691.1   502 ------NPCQLLLLDEPAASLDAHSEQRVMQALKAASK-RQTTLMVTHQL 544  

                   elaeladriivlddGrivegGPlellllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkl
                                  +g+++   +++++ +ge+ +lvG++GsGKS+ll++
  ACF66691.1   361    ------------EGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNV 395  

                   lagllkptsGeilldgkditglspqelrrlggvvvqevllffltllenll
                   l+g+l  ++G+++++g+++++lsp+ +r+++ +v q ++l+  tl+en+l
  ACF66691.1   396 LSGFLS-YQGSLRINGVELRDLSPESWRQHLSWVGQNPQLPAATLRENVL 444  

                   lglallllllvlllllllllllllaakeaalralllllllgledlldrlp
                   l +             +   +l++a+++a++ ++l ll+ g ++ l+  +
  ACF66691.1   445 LAR-----------PDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHA 483  

                   seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak
                   s LS Gq qrva+Arall+  +llllDEP ++LD++++++++++l+   k
  ACF66691.1   484 SRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASK 533  

                   egltvllvtHdldealrladrilvlddGriveegtpeellenplllytll
                      t+l+vtH+l+ +++  d i+v+ dG ive+g+++el + ++ ++tll
  ACF66691.1   534 -RQTTLMVTHQLEDLAD-WDAIWVMQDGAIVEQGSYAELSAANGAFATLL 581  

                   llgalplldegMkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagl
                              +++++   ++++l +ge+ +lvG++GsGKS+Ll++l+g+
  ACF66691.1   361    --------EGKTLAGPLNFSLAaGERAVLVGRSGSGKSSLLNVLSGF 399  

                   lgpdsGeilldgkdilalspeellrllrrrigyvfqepalfpgltveenl
                   l  + G+++++g+++++lspe     +r+++++v q+p+l  ++++e++l
  ACF66691.1   400 LSYQ-GSLRINGVELRDLSPES----WRQHLSWVGQNPQLPAATLRENVL 444  

                   llglllrlllelllgrlelllllllllellallldlllllllllllllll
                   l  + +                                            
  ACF66691.1   445 LARPDASEQ----------------------------------------- 453  

                   llllvlllllllllvlllllllalllllalkeaallleelllllglgdll
                                           +l  al++a+  +++ ll  g ++ l
  ACF66691.1   454 ------------------------ELYAALDAAWVSEFLPLLPQGVDTPL 479  

                   drpvstLSGGerqrvalaralalallllsdpplllLDEPtagLDpetree
                   +  +s LS G+ qrva+aral+      ++++lllLDEP a+LD++++++
  ACF66691.1   480 GNHASRLSVGQAQRVAVARALL------NPCQLLLLDEPAASLDAHSEQR 523  

                   llellkelakegktvivvtHdlelaaladriivlddGriveygtpeeGgvlalhgvsldve.gevvlltGpsGsGKStllralagl....Gtil
                       g++    +++++ +ge  +l+G sGsGKS+ll+ l g+  ++G ++
  ACF66691.1   362    -GKTLAGPLNFSLAaGERAVLVGRSGSGKSSLLNVLSGFlsyqGSLR 407  

                   ldg.dlvrlglkd...gigmvfqdpalfplltvrengvalglllag...l
                   ++g++l +l++++  +++ +v q+p l    t ren v+l++ +a +++l
  ACF66691.1   408 INGvELRDLSPESwrqHLSWVGQNPQLPAA-TLREN-VLLARPDASeqeL 455  

                   skaeieervdlllelvg..lddlldrypdelsggqrqrvaiaralalepe
                    +a + ++v + l l+++  d +l+ ++++ls gq qrva+aral+   +
  ACF66691.1   456 YAALDAAWVSEFLPLLPqgVDTPLGNHASRLSVGQAQRVAVARALLNPCQ 505  

                   lllldeptsaldplavvellelllglneeldiilalelllldelaevlalhgvsldin.gegvlivGpsGsGKStlalaLagl....Gail
                       + ++    ++++ +ge  ++vG sGsGKS+l++ L g   ++G   
  ACF66691.1   362    -GKTLAGPLNFSLAaGERAVLVGRSGSGKSSLLNVLSGFlsyqGSLR 407  

                   vdd.dlvll..elrgrdilmvfqppalfpllevrglniaevlela...gl
                   +++++l +l  e ++ ++++v q+p l    + r+ n+++++  a ++ l
  ACF66691.1   408 INGvELRDLspESWRQHLSWVGQNPQLPAA-TLRE-NVLLARPDAseqEL 455  

                   skaealkrvdlvlelvgld.....drypyelsggerqrvailr.vllp.k
                    +a   ++v ++l l++  +++   + + +ls g+ qrva++r+ l+p  
  ACF66691.1   456 YAALDAAWVSEFLPLLPQGvdtplGNHASRLSVGQAQRVAVARaLLNPcQ 505  

                   lllpdepgrnldvlievavlnlilkllgidallelvdrleprailelesliksllekllellkrlslklkkglkvalvGrpgvGKSt
                                        + l   l+++l  g + +lvGr+g+GKS+
  ACF66691.1   363    ------------------KTLAGPLNFSLAAGERAVLVGRSGSGKSS 391  

                   Llnallgevlalhgvsldve.gevvllvGpsGsGKStllralag....sGeilv
                       ++    +++++ +ge  +lvG sGsGKS+ll+ l g   ++G +++
  ACF66691.1   363    -KTLAGPLNFSLAaGERAVLVGRSGSGKSSLLNVLSGflsyQGSLRI 408  

                   dg.dlvdlep..lrrdigmvfqdpalfplltvrenvilgllelag..lsk
                   +g++l dl+p+ +r+++ +v q+p l p  t renv+l++++   ++l +
  ACF66691.1   409 NGvELRDLSPesWRQHLSWVGQNPQL-PAATLRENVLLARPDASEqeLYA 457  

                   aealarvdellelvglddellldrlp...sggqqqeilrvaiallilpvl
                   a   a+v e+l l+  + ++ l  +    s gq q   rva+a       
  ACF66691.1   458 ALDAAWVSEFLPLLPQGVDTPLGNHAsrlSVGQAQ---RVAVA------- 497  

                   lgralallpelllldeptsaldpdlveeilellleliehMmlkslelknfkslkd.vsligdfspg.ltaivGpNGsGKStlldai
                                 k l + +++  ++ +g++ ++vG++GsGKS+ll+++
  ACF66691.1   363    -----------KTLAGpLNF--SLAAGeRAVLVGRSGSGKSSLLNVL 396  

                   agllgpdsgeirldgkdlliylsdlir..rgagiayveqefdlfdgltvl
                   +g+l ++ g++r++g +    l+dl  + +++++++v q ++l+  + + 
  ACF66691.1   397 SGFLSYQ-GSLRINGVE----LRDLSPesWRQHLSWVGQNPQLPAATLRE 441  

                   envllglgdeliirrrilrdgrseyllnglgvslkeliellldlsggeln
                   +++l                                              
  ACF66691.1   442 NVLLA--------------------------------------------- 446  

                   rvalllqgevdlllldepterldfldelagleeykgnyeellklleelee
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   llkelekrlellekeleeleellerlealekaleeleerlkeleelkdkl
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   eeleeelealeeqiaeleeelsekrllaleklsklfneilkellkggsle
                       +  ++ +e++a+l++++ +++l +l++                   
  ACF66691.1   447 ----RPDASEQELYAALDAAWVSEFLPLLPQ------------------- 473  

                   lelerlgerlalvglngsgkdtllklvglpgkalrplstlSGGekqrlal
                         + +l+                        ++s lS G+ qr+a+
  ACF66691.1   474 ----GVDTPLG-----------------------NHASRLSVGQAQRVAV 496  

                   alalalaellppplllLDEptagLDpenrerllellrelaseggqvivvt
                   a+al    l+p++lllLDEp a+LD+++ +r++++l+   s+  + ++vt
  ACF66691.1   497 ARAL----LNPCQLLLLDEPAASLDAHSEQRVMQALKAA-SKRQTTLMVT 541  

                   HdpelaarladrilvlkdggivavvlgtpeevleiellsdlslsipspevvllvGppGsGKstlakklaell...gfilid
                      + l + l++s++++e+ +lvG +GsGKs+l++ l + l ++g  +i+
  ACF66691.1   363    KTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRIN 409  

                   addlr.............................................
                   + +lr+   +   ++   + ++ +    +  +++     +  +++ +   
  ACF66691.1   410 GVELRdlspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaal 459  

                   .............................gqkqrvalleaalkegylvvv
                   +   + +      + +++   ++     +gq+qrva+++a+l+  +l+++
  ACF66691.1   460 daawvseflpllpqgvdtplgnhasrlsvGQAQRVAVARALLNPCQLLLL 509  

                   Det..gldraqrlellelardlgrpvlviflatspevlierlldrvllld
                   De++++ld  + ++++++++++  + +++++ +  e+l++   d + +++
  ACF66691.1   510 DEPaaSLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLAD--WDAIWVMQ 557  

                   egslvdlgvledllaslepltnregldlvidlplspeevaaevlkaldkl
                   +g +v++g + +l a                                   
  ACF66691.1   558 DGAIVEQGSYAELSA----------------------------------- 572  

                   lsnlvlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeili
                      ++    +++++  Ge ++l+G SGsGK++Ll+ l+g+l   +g+ +i
  ACF66691.1   363    KTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSY-QGSLRI 408  

                   dggdinleggfyakaigllrrkigyvfq..lfpfltvlenvalgld....
                   +g+ + +++      ++  r+++++v q+  +p  t++env+l++ ++ +
  ACF66691.1   409 NGVELRDLS------PESWRQHLSWVGQnpQLPAATLRENVLLARPdase 452  

                   .glvdeedleraenllalvgl..eeipnrypselsgGqqqrv........
                   + l  + d + + + l l++  ++  +    s ls Gq qrv+++ +  +
  ACF66691.1   453 qELYAALDAAWVSEFLPLLPQgvDTPLGNHASRLSVGQAQRVavaralln 502  

                   ...illldEPtsgLdpvsr.........................leladr
                     ++llldEP + Ld+ s + ++++ +++ + +++ +++++ ++l  +d+
  ACF66691.1   503 pcqLLLLDEPAASLDAHSEqrvmqalkaaskrqttlmvthqledLADWDA 552  

                   iyvllsGrivesgtteelmseliiylelselewallradvgltlteaelkrlkglndlleledls
                                                                     
  ACF66691.1     -    ----------------------------------------------- -    

                   kiygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKS
                                          ++   +++s+  +e+  ++G sGsGKS
  ACF66691.1   364 -----------------------TLAGPLNFSLAAGERAVLVGRSGSGKS 390  

                   TlarlLagllapesgglkvlligtDifylpa.eqlkrigllfqkglpeal
                    l+++L+g l+++    + ++ g     l+ +++++++  + q +  +a 
  ACF66691.1   391 SLLNVLSGFLSYQG---SLRINGVELRDLSPeSWRQHLSWVGQNPQLPAA 437  

                   dveell......................ellldlkegle...dilvpvls
                   + +e++  +  ++ +++ +++ +++ + e+l  l++g ++     +  ls
  ACF66691.1   438 TLRENVllarpdaseqelyaaldaawvsEFLPLLPQGVDtplGNHASRLS 487  

                   ggqkqrlalaralvedpdvlilDgptalldpltr.ellellkelrdlldl
                    gq qr+a aral+ ++ +l+lD+p a ld++++++++++lk  ++    
  ACF66691.1   488 VGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEqRVMQALKAASK--RQ 535  

                   tilvdadlevlleRrleRdlelvthdlddaesladrvlvldrgrilesgl
                   t l                  +vth+l+d++   d + v+ +g i+e+g+
  ACF66691.1   536 TTL------------------MVTHQLEDLAD-WDAIWVMQDGAIVEQGS 566  

                   aqylkvvlpnleeyieptkkradliitklddhevagvllrkalddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvllig
                          +++s+ +ge+ +lvG++G+GK++l++ l g+l    g+  + g
  ACF66691.1   365    LAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRING 410  

                   aDirrpsarellgllgell...............................
                   +++r++s  +++++l  + ++ +  +++  +++  +  ++ +++ +++ +
  ACF66691.1   411 VELRDLSPESWRQHLSWVGqnpqlpaatlrenvllarpdaseqelyaald 460  

                   .............gldvlvgarggdlsgglrqr..larallgdpdvlliD
                   ++ + +      +g+d+++g   + ls g+ qr+++arall+  ++ll+D
  ACF66691.1   461 aawvseflpllpqGVDTPLGNHASRLSVGQAQRvaVARALLNPCQLLLLD 510  

                   epgrgldpellallaelldllrelradlgllvvdathdldavlkaadril
                   ep ++ld++    +++++++l++  a    + +++th l++++   d i 
  ACF66691.1   511 EPAASLDAHS---EQRVMQALKA--ASKRQTTLMVTHQLEDLAD-WDAIW 554  

                   vldlggivlnkldlvakggaalelaeelgvpllsiplgegiddlldflle
                   v+++g iv+                                         
  ACF66691.1   555 VMQDGAIVE----------------------------------------- 563  

                   llvsrllglgLddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvga
                         +++s+  ge+ +lvG++GsGK++lln l g +    g+  + g+
  ACF66691.1   366    AGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSG-FLSYQGSLRINGV 411  

                   diarla...areqlgivfqdpgl...tvlenlalgeleararellellgl
                   ++++l+ + +r++l++v+q+p l ++t++en+ l+++ a  +el ++l++
  ACF66691.1   412 ELRDLSpesWRQHLSWVGQNPQLpaaTLRENVLLARPDASEQELYAALDA 461  

                   edydvvl......iDtagrlrlpselsggqkqrvaiaralaaplppevll
                   + ++  l    + +Dt+ ++  +s ls gq qrva+aral+   p  +ll
  ACF66691.1   462 AWVSEFLpllpqgVDTP-LGNHASRLSVGQAQRVAVARALLN--PCQLLL 508  

                   ldeptsglda..lrellellrel..gltvlvvthlDllakggadlslale
                   ldep + lda+  ++++++l+++ ++ t l+vth          l+ +++
  ACF66691.1   509 LDEPAASLDAhsEQRVMQALKAAskRQTTLMVTH---------QLEDLAD 549  

                   ladrilvlgdGeivedgtpeellalpgvllgydlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDi
                      +l++++ +ge+ +lvG++G+GK++ll+ L g+l    g+  + g+++
  ACF66691.1   368    PLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVEL 413  

                   yraaaae.rlgigavpqdvplfpsltvldnlalar......dlleaakaa
                   + ++    r ++++v q++ l  + t ++n+ lar ++ +++l+ a++aa
  ACF66691.1   414 RDLSPESwRQHLSWVGQNPQLP-AATLRENVLLARpdaseqELYAALDAA 462  

                   gydvvlidtaglld..ldrlvgelsggqkqrvaiarala.apevllldep
                    + ++l  ++ + d+ l++ ++ ls gq qrva+aral+++ ++llldep
  ACF66691.1   463 WVSEFLPLLPQGVDtpLGNHASRLSVGQAQRVAVARALLnPCQLLLLDEP 512  

                   tsgldalae..llelleel..gltvlvvtKlDgtakgghdlslalrladr
                    ++lda +e+ ++++l+++ +  t l+vt         h l+ +++  d 
  ACF66691.1   513 AASLDAHSEqrVMQALKAAskRQTTLMVT---------HQLEDLAD-WDA 552  

                   ilvlgvGeivedgtpfellelvgrllglEdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlD
                       +l++ +  g++ +lvG  G+GK++++  L ++l  + ++  + +++
  ACF66691.1   368    -PLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRINGVE 412  

                   pyrpsapeqlgilgellgvpvvgvltgldlagalrealell.........
                    + +s  ++ + l+ + ++p  +  t  +++ ++r + +  + +++ +++
  ACF66691.1   413 LRDLSPESWRQHLSWVGQNPQLPAATLRENVLLARPDASEQelyaaldaa 462  

                   ........llegydvvliDtag....glqrglllalaladlllvllldep
                    + +    l +g+d  l   a    +g+ +++++a+al++   +llldep
  ACF66691.1   463 wvseflplLPQGVDTPLGNHASrlsvGQAQRVAVARALLNPCQLLLLDEP 512  

                   llvldatagtellelakgllealgldgvvltkldlvaalgaalsvalilg
                    + lda++ +++++ +k+  ++   + +++t ++l ++++  +++ ++ +
  ACF66691.1   513 AASLDAHSEQRVMQALKAASKRQ--TTLMVT-HQLEDLAD-WDAIWVMQD 558  

                   lpilflgtgenvddlevfnpgelvdrllglgdvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp
                       +++s+  g+  +lvG++G+GK++l++ l g+l  + g+  + ++++
  ACF66691.1   368    PLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRINGVEL 413  

                   yrpaadellgvlaee...................................
                   ++ +  +++++l  + ++ +  +++  +++  +  ++ +++ +++ +++ 
  ACF66691.1   414 RDLSPESWRQHLSWVgqnpqlpaatlrenvllarpdaseqelyaaldaaw 463  

                   .........lgldvllgarggdlsgglrqr..larallgdydvliiDtp.
                   + +       g+d++lg  ++ ls g+ qr+++arall+ +++l++D+p+
  ACF66691.1   464 vseflpllpQGVDTPLGNHASRLSVGQAQRvaVARALLNPCQLLLLDEPa 513  

                   gtldvllelallellkellaelgadvvllvvdatlgleaadrilvllegl
                   + ld + e+ ++++lk+     ++ ++l+v+   ++l + d i+v+ +g+
  ACF66691.1   514 ASLDAHSEQRVMQALKAAS---KRQTTLMVTHQLEDLADWDAIWVMQDGA 560  

                   gvpgvvlNkldlvaeggaalelleelgvpilsaltgegvddllefipell
                   +v            e+g + el +  g + + + ++++            
  ACF66691.1   561 IV------------EQGSYAELSAANGAFATLLAHRQE------------ 586  

                   verllgmlsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkl
                      l++ l+                +g+  +LvG +G+GK++l+  l ++
  ACF66691.1   369    LNFSLA----------------AGERAVLVGRSGSGKSSLLNVLSGF 399  

                   lga.pfvevdaselteggyvgedlekrirelfqearllvfltvlenirld
                   l ++  +++++ el++    ++  ++++ ++ q+++l +  t +en+ l+
  ACF66691.1   400 LSYqGSLRINGVELRDL-SPESW-RQHLSWVGQNPQL-PAATLRENVLLA 446  

                   aseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekah
                   + ++ e+++ ++l  a                                 +
  ACF66691.1   447 RPDASEQELYAALDAAW-------------------------------VS 465  

                   rpirvlllsaslvlllgglglpevgelllellddvgltdllgrtvdfknt
                    ++  l++++++ l  +                                 
  ACF66691.1   466 EFLPLLPQGVDTPLGNH--------------------------------- 482  

                   iiiltsnvgelsggqrqrvalarallaepgilflDEiDklagkrggggtn
                          ++ ls+gq qrva+arall++  +l+lDE+           + 
  ACF66691.1   483 -------ASRLSVGQAQRVAVARALLNPCQLLLLDEP-----------AA 514  

                   rldeevlnaLlelleelqvtgeyitvksdvtviaatnrpeellslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnl
                      l+++laag  e+ +lvG +G+GKs+l++ l g+l  ++g   + g  
  ACF66691.1   369    LNFSLAAG--ERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVE 412  

                   sdlldpkdlrellragiplvflnfaalpasllesel..............
                   + +l+p+++r++l + ++   l+ a+l ++ l+++ ++ +++ +++ +++
  ACF66691.1   413 LRDLSPESWRQHLSWVGQNPQLPAATLRENVLLARPdaseqelyaaldaa 462  

                   .......................lsggerqrvalaralalrpGllvlAdg
                    + +      + +++   +++  ls g+ qrva+aral+           
  ACF66691.1   463 wvseflpllpqgvdtplgnhasrLSVGQAQRVAVARALLNPC-------- 504  

                   gvlllDEp.daldpevqaaLlrlleegevtieragitlllpagvtviaat
                    +lllDEp++ ld+++ ++++++l+              + ++ t +++t
  ACF66691.1   505 QLLLLDEPaASLDAHSEQRVMQALKA-------------ASKRQTTLMVT 541  

                   nddlgelllealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvp
                      l + l++g  +  +LvG++G+GK++l++ l + l    g  +++gv+
  ACF66691.1   369    LNFSLAAG--ERAVLVGRSGSGKSSLLNVLSGFL-SYQGSLRINGVE 412  

                   vvrldlsellsvsdlvgel...............................
                   ++ l+ ++ ++   +vg+  +  +++  +++  +  ++ +++ +++ +++
  ACF66691.1   413 LRDLSPESWRQHLSWVGQNpqlpaatlrenvllarpdaseqelyaaldaa 462  

                   ........................egglrgllteala.lakpsvlflDEi
                    + +      + +++   +++   + g+ ++++ a+a l+++ +l+lDE+
  ACF66691.1   463 wvseflpllpqgvdtplgnhasrlSVGQAQRVAVARAlLNPCQLLLLDEP 512  

                   drlldardsesslevlnaLlrlledgnvlviattnrpellgrleldpall
                    + lda    s ++v++aL+ + +  + + +++t+++e            
  ACF66691.1   513 AASLDA---HSEQRVMQALKAASK--RQTTLMVTHQLE------------ 545  

                   rrfdvielgppdeeelleilklslgippgknvllvGppGtGKTtlakalagel.gvpfvrisa.....
                      l++++  g+  +lvG +G+GK++l+  l g+l     +ri++++  +
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLsYQGSLRINGvelrd 415  

                   ..................................................
                      +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ + 
  ACF66691.1   416 lspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawvs 465  

                   ..........sellgkyvgelsgglrqrlalara..adpgvlllDEidal
                   +      + ++  lg     ls g+ qr+a ara  ++  +lllDE+ a 
  ACF66691.1   466 eflpllpqgvDTPLGNHASRLSVGQAQRVAVARAllNPCQLLLLDEPAAS 515  

                   ldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndleeldpa
                   lda+               + ++++l+     ++ t +++t+ le+l   
  ACF66691.1   516 LDAH-------------SEQRVMQALKAA--SKRQTTLMVTHQLEDLA-- 548  

                   llrpgrfdrvielplpdleerleilkllleklglesdealealaeltegf
                          d ++++ ++                                  
  ACF66691.1   549 -----DWDAIWVMQDG---------------------------------- 559  

                   sardlrnlleralalallegrvvitledleealekvlpsrlslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpi
                      l++ l  g++ +lvGr+g+GKS+Lln L g    + ++ +  ++++ 
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFL-SYQGSLRINGVELR 414  

                   lgv...............................................
                     + +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ +
  ACF66691.1   415 DLSpeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawv 464  

                   ..................................vlldgrdllllDtPGl
                    +      + +++   +++    + +++ ++++ +ll+  +llllD    
  ACF66691.1   465 seflpllpqgvdtplgnhasrlsvgqaqrvavarALLNPCQLLLLD---- 510  

                   idfaseptnlldleiieallraleealslgirpgkgvllyGppGtGKTtlakalagel.gapfiridg.....
                      l++++  g+  +l+G +G+GK++l+  l g+l     +ri+g++  +
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLsYQGSLRINGvelrd 415  

                   ..................................................
                      +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ + 
  ACF66691.1   416 lspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawvs 465  

                   ..........sellgkyvgelsgglrqllalara..akpsilllDEidkl
                   +      + +++ lg     ls g+ q++a ara  ++  +lllDE    
  ACF66691.1   466 eflpllpqgvDTPLGNHASRLSVGQAQRVAVARAllNPCQLLLLDE---- 511  

                   apkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrpeellllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvield
                      l++ l+ag  +  +lvG +G+GK++l++ l + l  +g     ++++
  ACF66691.1   369    LNFSLAAG--ERAVLVGRSGSGKSSLLNVLSGFLSYQGS----LRIN 409  

                   asdl..rgvddlreligevlqalglllgg.....................
                   + +l +++ ++ r+++++v q++ l+++   +++  +  ++ +++ +++ 
  ACF66691.1   410 GVELrdLSPESWRQHLSWVGQNPQLPAATlrenvllarpdaseqelyaal 459  

                   ...........................................kpdvlll
                   +++ + +      + +++   +++    + +++ ++++ +  ++  +lll
  ACF66691.1   460 daawvseflpllpqgvdtplgnhasrlsvgqaqrvavarallnPCQLLLL 509  

                   DEi.drldpdaqnallklleelpagvtlilttnrleellpallsrfdiie
                   DE++  ld++ ++ ++++l+   ++ t +++t++le              
  ACF66691.1   510 DEPaASLDAHSEQRVMQALKAASKRQTTLMVTHQLE-------------- 545  

                   fkplseeelleilkrileeegvklsdealealaelsggdpraalnllera
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   aagrelitledvkellgelslgirpgrillLyGppGvGKTtlakalakelgap.vieidaselrd
                      l++++ +g+  +L+G +G+GK++l++ l ++l ++  ++i++ elrd
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQgSLRINGVELRD 415  

                   ..................................................
                      +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ + 
  ACF66691.1   416 lspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawvs 465  

                   ..........vddlsgyvgelsggeklrellaealteavlkgkpsvlllD
                   +      + +   l    + ls g+ +r+++a+a     l ++  +lllD
  ACF66691.1   466 eflpllpqgvDTPLGNHASRLSVGQAQRVAVARA-----LLNPCQLLLLD 510  

                   Ei.daldpdvlnallklldglrdlsgvliilttndpeeldpallrRfdii
                   E++ +ld    + ++++l+    +++ + +++t+ +e             
  ACF66691.1   511 EPaASLDAHSEQRVMQALKAA--SKRQTTLMVTHQLE------------- 545  

                   efpppdeeelleilkrilekeglklddealealaelsegsprdllnller
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   aalgrkvitledveealgkvlpsidlslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgid
                      l+++l++g  e  +lvG +G+GK++l++ l g+l  ++ ++r+ g+ 
  ACF66691.1   369    LNFSLAAG--ERAVLVGRSGSGKSSLLNVLSGFLSYQG-SLRINGVE 412  

                   aselld............................................
                   + +l  +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++
  ACF66691.1   413 LRDLSPeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaa 462  

                   ....................pselsggerqrvliaralladpkvlllDEi
                    + +      + +++   ++ s ls g+ qrv++arall++  +lllDE+
  ACF66691.1   463 wvseflpllpqgvdtplgnhASRLSVGQAQRVAVARALLNPCQLLLLDEP 512  

                   .daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdviefpp
                   + +ld+++ + ++++l+  +k+ t++++t+ le                 
  ACF66691.1   513 aASLDAHSEQRVMQALKAASKRQTTLMVTHQLE----------------- 545  

                   pdeeelleilklilkkeglklddealellaelsggsprdalnlldraavl
                                                           l+  d ++v+
  ACF66691.1   546 ---------------------------------------DLADWDAIWVM 556  

                   aagriveegtpedllealekilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgr
                      +++++ +g++ +lvG+sG+GKS+LlN L+g  l + g+ +++g+++r
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSG-FLSYQGSLRINGVELR 414  

                   htTrdvllirle..g..lvliDtpGfrdtileniekeeleatfeeiread
                   + + ++++ +l+ +g++ +l        t +en+  ++++a+ +e+  a 
  ACF66691.1   415 DLSPESWRQHLSwvGqnPQL-----PAATLRENVLLARPDASEQELYAAL 459  

                   lvllvidaihllepdlavlealeeggipvilvlnkldlleelellklkk<
                    +++v ++  ll+++ ++                                
  ACF66691.1   460 DAAWVSEFLPLLPQGVDT-------------------------------  477  

                   -*
                     
  ACF66691.1     -    -    

0050867: domain 1 of 1, from 369 to 530: score 31.3, E = 1.9e-08
                   *->hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepg
                                 +++s+  ge  vlvG sGsGKs+l++ L++ L  + 
  ACF66691.1   369    -----------LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ- 403  

                   sgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvld
                    g  +++g +l          +d   + +r++l  v q++ l    ++ +
  ACF66691.1   404 -GSLRINGVEL----------RDLSPESWRQHLSWVGQNPQLPAA-TLRE 441  

                   gtalgl..elrdelrellkeagl....pllvvfldaplevlleRdrrgly
                   ++ l + ++  +el+++l++a + +  pll  ++d+pl   ++R      
  ACF66691.1   442 NVLLARpdASEQELYAALDAAWVseflPLLPQGVDTPLGNHASR------ 485  

                   peelsgglkqrvaiarplelaaepdlvi..dtsaldpeevveeilellke
                      ls g+ qrva+ar+l l  +  l++++++ +ld     ++++++lk 
  ACF66691.1   486 ---LSVGQAQRVAVARAL-LNPCQLLLLdePAASLDA-HSEQRVMQALKA 530  

                   lgltvllsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg....
                      l+f+l  g++ ++vG++g+GKS+Lln+l+g l +  +  + + +  +
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVelrd 415  

                   ..............................................gtll
                      +   ++   + ++ +  +++  +++  +  ++ +++ +++ ++  ++
  ACF66691.1   416 lspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaAWVS 465  

                   lllgllsfllalvldslplerergitidvalarllldgrkilllDtPlslglrpgkgvlLvGppGtGKTtlaralagllga.............
                      l+++l +g+  +LvG +G+GK++l++ l g+l ++    ++ ++  +
  ACF66691.1   369    LNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYqgslringvelrd 415  

                   ..................................................
                      +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ + 
  ACF66691.1   416 lspeswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawvs 465  

                   ...pfvrlsaselvgkyvgelegglrqllalaraa.npg.vlflDEidkl
                   +  p++    ++ +g     l+ g+ q++a ara+ np+++l+lDE    
  ACF66691.1   466 eflPLLPQGVDTPLGNHASRLSVGQAQRVAVARALlNPCqLLLLDE---- 511  

                   apkrsptsglddvsrrrvlnaLlrllegledlsnvlviaatnrpeelnpfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtl
                                             l++ l++++  +l+G++GsGK++l
  ACF66691.1   369    -----------------------LNFSLaaGERAVLVGRSGSGKSSL 392  

                   lkalakel.gkpviyidlselsskgyvdleellrela.............
                   l+ l + l   + ++i++ el++     +e+ +++l+ + ++ +  +++ 
  ACF66691.1   393 LNVLSGFLsYQGSLRINGVELRDLS---PESWRQHLSwvgqnpqlpaatl 439  

                   .........................eelgellellkkllkklsellglsi
                    +++  +  ++ +++ +++ +++ ++e+++ll+             g++ 
  ACF66691.1   440 renvllarpdaseqelyaaldaawvSEFLPLLPQ------------GVDT 477  

                   lglelilglsggdleelleelaellkklgkpvililDEiqslldvsske.
                   +  ++++ ls+g+ +++  ++a++l +     +l+lDE+ + ld +s++ 
  ACF66691.1   478 PLGNHASRLSVGQAQRV--AVARALLN--PCQLLLLDEPAASLDAHSEQr 523  

                   lleaLlrlldegknvtiiltgsdlglldelllrpdlksplygRfdeiiel
                   +++aL+ + + +   t+ +t + ++l+d  +                   
  ACF66691.1   524 VMQALKAASKRQ--TTLMVTHQLEDLADWDAI------------------ 553  

                   kplsfeelleilkklleelgisdealekiyeltgGlprylellleellll
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   alleeileilledvkkllkeelrelsryslelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptl
                      +++l  g++ +lvGr+g+GKS+Lln+l g                + 
  ACF66691.1   370    NFSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-------------YQ 403  

                   gvveldgrkl........................................
                   g+++++g++l +   +   ++   + ++ +  +++  +++  +  ++ ++
  ACF66691.1   404 GSLRINGVELrdlspeswrqhlswvgqnpqlpaatlrenvllarpdaseq 453  

                   ...................vliDtp..Gleefasggekqrvalalallre
                   + +++ +++ + +      + +Dtp   + + +s g+ qrva a+all  
  ACF66691.1   454 elyaaldaawvseflpllpQGVDTPlgNHASRLSVGQAQRVAVARALLNP 503  

                   advlllvvdadeptsfldle....llellrelllagkpvilvlnKiDlld
                   +++lll    dep ++ld++ ++ +++ l++   ++ ++++     Dl+d
  ACF66691.1   504 CQLLLL----DEPAASLDAHseqrVMQALKAASKRQTTLMVTHQLEDLAD 549  

                   ar.....eelakllgvpvvevSaktgegvdellealaelllenegarpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTT
                                               ++++  +++ +lvG +GsGK++
  ACF66691.1   370    -------------------------NFSLAAGERAVLVGRSGSGKSS 391  

                   laralakel.gagfilidgddlrekavgeleklgrdlfqvaregglvpdi
                   l++ l ++l   g ++i+g +lr+   +  ++++  ++q+++ ++     
  ACF66691.1   392 LLNVLSGFLsYQGSLRINGVELRDLSPESWRQHLSWVGQNPQLPA----A 437  

                   lfideidallrkgpd.vildgagrtpeqlealldllee.....lgrpvvv
                   ++++++  ++ ++  + +  +   + +++ ++l ll + +++ lg +   
  ACF66691.1   438 TLRENVLLARPDASEqELYAAL--DAAWVSEFLPLLPQgvdtpLGNHASR 485  

                   iilttnrevlldral.rRpgrllldep..eldppdreerleilkrllkkl
                   +++++ ++v+++ral + ++ llldep++ ld+ +++ +++ lk   k+ 
  ACF66691.1   486 LSVGQAQRVAVARALlNPCQLLLLDEPaaSLDAHSEQRVMQALKAASKRQ 535  

                   gtvldvthddelarladrgtlvliaalelrgllaeidlekaidevftled
                    t ++   +++la                                     
  ACF66691.1   536 TTLMVTHQLEDLADW----------------------------------- 550  

                   flealesiiesvlldyllklgslkdllkmleslldssleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilge
                      ++++ +ge+ ++vG+sGsGKS+Lln L+g+ls+            g+
  ACF66691.1   370    NFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ-----------GS 405  

                   illdgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaen
                   ++++g++l+            +l  e +r+++++v q++ l    t +en
  ACF66691.1   406 LRINGVELR------------DLSPESWRQHLSWVGQNPQLPAA-TLREN 442  

                   lllgldllllellkelkydpvilllnkidllddrllrraeaeerieelle
                   +ll+++++ ++ l ++                    + a++ e++  l++
  ACF66691.1   443 VLLARPDASEQELYAAL-------------------DAAWVSEFLPLLPQ 473  

                   lvglsallgqnvdeLpsggqkqrvaiarallkdp..lllDEptsaLDesalellleledltklstgikaLddvlggglpkGeivlllGpsGsGK
                                                ++  l +Ge  +l+G+sGsGK
  ACF66691.1   370    -------------------------NFS--LAAGERAVLVGRSGSGK 389  

                   ttlalrllagllkp..evlvdgldltglspa.rggiglvfqteallpplt
                   + l l++l g+l  + + +++g++l +lsp+  +    ++     lp  t
  ACF66691.1   390 SSL-LNVLSGFLSYqgSLRINGVELRDLSPEsWRQHLSWVGQNPQLPAAT 438  

                   vrenlealgldlrglld......rerviellelv..gleelldrlprels
                   +ren+  l++      + +++ + ++v e l+l+ +g++  l   ++ ls
  ACF66691.1   439 LRENV-LLARPDASEQElyaaldAAWVSEFLPLLpqGVDTPLGNHASRLS 487  

                   ggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelg
                    g q qrv++a al++  +llllDEp ++ld++  +++++ Lk   k+ +
  ACF66691.1   488 VG-QAQRVAVArALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKR-Q 535  

                   vtvllvthdleeveeladrvavlaggriveqgadvvlflrrdegglreli
                   +t+++++++ + ++   d ++v+ +g iveqg+ ++l             
  ACF66691.1   536 TTLMVTHQLEDLAD--WDAIWVMQDGAIVEQGSYAEL------------- 570  

                   vvknrlgptgevvfeitgeGlvePslslkkgklivltGppGsGKtTlakaLaerl...glpfidtddllr
                       ++sl  g++ vl+G +GsGK++l++ L+++l ++g   i++ +l+ 
  ACF66691.1   370    -NFSLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVELRD 415  

                   epvigagtdigevfqdlllaggllvddev.......rrlllealdellla
                      +  ++++ +v q+  l    l+++ + +  ++  ++l++ald++  +
  ACF66691.1   416 LSPESWRQHLSWVGQNPQLPAATLRENVLlarpdasEQELYAALDAAWVS 465  

                   ggkvvildgf...........pggllqrealrrllprpdlvilldappee
                   ++ +++  g+++   +++   ++g+ qr+a++r+l++p  ++lld+p + 
  ACF66691.1   466 EFLPLLPQGVdtplgnhasrlSVGQAQRVAVARALLNPCQLLLLDEPAAS 515  

                   lleRllkrgrldgreddslellekrleryeeltrdlielyeeadrvivid
                   l++   +r        + +   ++ +++ + +t++l++l ++ + ++  d
  ACF66691.1   516 LDAHSEQRV-------MQALKAASKRQTTLMVTHQLEDLADWDAIWVMQD 558  

                   aglsieevveeilelleeslMsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllr
                       ++++  g++ vl+G +GsGK++l++ L++ l ++g   i++ +l+ 
  ACF66691.1   370    -NFSLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVELRD 415  

                   elvpggldig...........................evfqdaleaglll
                      ++++     + ++ +  +++  +++  +  ++ ++++++al+a +  
  ACF66691.1   416 LSPESWRQHLswvgqnpqlpaatlrenvllarpdaseQELYAALDAAW-- 463  

                   fddefrglllerleellargpvvildgfpggllqrealrrlllrpdlvif
                    + ef++ll + ++  l ++   ++     g++qr+a++r+ll+p+ +++
  ACF66691.1   464 -VSEFLPLLPQGVDTPLGNHASRLS----VGQAQRVAVARALLNPCQLLL 508  

                   ldapleelleRllkrMsikkgeiiaivGppGsGKsTlaklLakll...glivldgddl....
                       s+ +ge+ ++vG++GsGKs+l++ L+++l ++g   ++g +l +  
  ACF66691.1   371    FSLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVELrdls 417  

                   ...lreaiglvtqdgelllelidegilvpdeiv.iellrealeelda.d.
                    +  r+++  v+q+++l + +++e++l+ + ++  ++l +al+++   + 
  ACF66691.1   418 pesWRQHLSWVGQNPQLPAATLRENVLLARPDAsEQELYAALDAAWVsEf 467  

                   .gvildgfprllgqaelllsggkadlvifldaplevlleRllkrddekil
                     ++  g+++ lg    +ls g                            
  ACF66691.1   468 lPLLPQGVDTPLGNHASRLSVG---------------------------- 489  

                   krleeqkqrvaiarallkkpailildept.sld.evveeilellkellkg
                        q qrva arall + ++l+ldep +sld++ +++++++lk   k 
  ACF66691.1   490 -----QAQRVAVARALLNPCQLLLLDEPAaSLDaHSEQRVMQALKAASKR 534  

                   rttiiiatrLsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
                      +s+ +ge  +lvG++G+GK++ll+ l+g+l  ++g+ +++g+++ + 
  ACF66691.1   371    FSLAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVELrdl 416  

                   ......rrigavpqlpvlfprltvlenlalg.gadlaeraeellellgle
                     +   +++++v q+p+l    t++en++l+ +++ +++++++l+++   
  ACF66691.1   417 speswrQHLSWVGQNPQLPAA-TLRENVLLArPDASEQELYAALDAAWVS 465  

                   gfdvvliDtag..rgrrvgelsggqkqrvaiarallllldpelllldEpt
                   +f  +l+  +++ +g  ++ ls gq qrva+arall   +++lllldEp 
  ACF66691.1   466 EFLPLLPQGVDtpLGNHASRLSVGQAQRVAVARALLN--PCQLLLLDEPA 513  

                   sglda..lrlllellkel..gltvlvvthddgtakggaalslaleladri
                   + lda+ ++ ++++lk+  +  t+l+vth          l+ ++   d i
  ACF66691.1   514 ASLDAhsEQRVMQALKAAskRQTTLMVTHQ---------LEDLAD-WDAI 553  

                   lvlgdGeivedgtpeellelpgvllgelkrglnvgivGhvgaGKSTLlnaLlgll..................
                      +l  g++ ++vG++g+GKS+Lln+L+g l ++    ++ ++  +   
  ACF66691.1   372    SLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqgslringvelrdlsp 418  

                   ..................................................
                   +   ++   + ++ +  +++  +++  +  ++ +++ +++ +++ + +  
  ACF66691.1   419 eswrqhlswvgqnpqlpaatlrenvllarpdaseqelyaaldaawvsefl 468  

                   ..........ldtlkgelergitikigaasllldklaivsdtpgttldpi
                       + +++ l  ++  l+ g+ +++++a++ll+                
  ACF66691.1   469 pllpqgvdtpLGNHASRLSVGQAQRVAVARALLNP--------------- 503  

                   lgvleldgpkllllDtPsmkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywr
                      s   g+r +l+G sG+GK++l++ L+++l+++ g++ + g  ++ ++
  ACF66691.1   372    SLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRINGVELRDLS 417  

                   svggsdlleliyqlplrldlgeislddaallllslqllfaapylslnevi
                          l+ + q+p++ ++++             ++l+a p +s +e+ 
  ACF66691.1   418 PESWRQHLSWVGQNPQLPAATLRE-----------NVLLARPDASEQELY 456  

                   daarvlladefikplpagykvmsikkgklilltGppGsGKtTlaralaerl...glpvidgddllrel
                       s+  g++ +l+G +GsGK++l++ l++ l ++g   i+g +l r+l
  ACF66691.1   372    -SLAAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVEL-RDL 416  

                   vgeggrlgrdlfdedrllfrellideidllnvlgesidalgkilseilkllekgfltalgllerksverlstgika
                                                                     
  ACF66691.1     -    ----------------------------------------------- -    

                   LDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidte
                            l +Ge+ ++vG++GsGK++l l+++ +++  +g   + ++e
  ACF66691.1   373 ---------LAAGERAVLVGRSGSGKSSL-LNVLSGFLSYQGSLRINGVE 412  

                   esldqlr..arrlgldlddllllpaltveellala...............
                    +       ++ l+++ +++  lpa t++e++ la  ++ +++ +++ ++
  ACF66691.1   413 LRDLSPEswRQHLSWVGQNPQ-LPAATLRENVLLArpdaseqelyaalda 461  

                   .....................erllsggkpqlvviDsltalrpallllde
                   + + +      + +++   ++   ls g+ q+v+++++++   +llllde
  ACF66691.1   462 awvseflpllpqgvdtplgnhASRLSVGQAQRVAVARALLNPCQLLLLDE 511  

                   ptgellgldvrllsellrllkrlakelgvtvilvshvlkegedraddvpd
                   p ++l   d+    +++++lk+  k    t+++v+h l+++ d  d +++
  ACF66691.1   512 PAASL---DAHSEQRVMQALKAASK--RQTTLMVTHQLEDLADW-DAIWV 555  

                   lagggvleqiadvviflerdeaykgilpaigglrelrvvKnrfgptgeva
                   + +g ++e                                          
  ACF66691.1   556 MQDGAIVE------------------------------------------ 563  

                   lffiiteeGleverlstgipalDellgGglppgslvliaGppGsGKTtlalqlaana
                                         l  g++ +++G++GsGK++l+  l + +
  ACF66691.1   373    -------------------LAAGERAVLVGRSGSGKSSLLNVLSGFL 400  

                   alplelgklggkvlyistee.afsperlreralsl....gldleelldrl
                          +++g+  +   e   +spe  r+++  + ++  l+ + l++++
  ACF66691.1   401 -------SYQGSLRINGVELrDLSPESWRQHLSWVgqnpQLPAATLRENV 443  

                   lvidat.......dlldllellerlrrllse..............gkvdl
                   l++++++ +++ +  ld++++ e l+ l +++++   +++    +g++++
  ACF66691.1   444 LLARPDaseqelyAALDAAWVSEFLPLLPQGvdtplgnhasrlsvGQAQR 493  

                   vviDslallarael..ldepllgldarelrellrlLkrlakelgvtvilt
                   v++ ++all +++l  ldep + lda    +++++Lk+   ++++t+++t
  ACF66691.1   494 VAV-ARALLNPCQLllLDEPAASLDAHSEQRVMQALKAA-SKRQTTLMVT 541  

                   sqltrevedradkrpdlsdlrgggaleqladtvlllererggvreliivk
                   +ql + ++      + + ++ +g ++eq                      
  ACF66691.1   542 HQLEDLADW-----DAIWVMQDGAIVEQG--------------------- 565  

                   nrggptgevefeitgeGivvvpeldklgkildlalkileksflklevlalgvlerkeverlstGikaLDa
                                                                     
  ACF66691.1     -    ----------------------------------------------- -    

                   llgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesl
                         l +G++ +++G++GsGK++l+  l + l   +g+  + + e + 
  ACF66691.1   373 ------LAAGERAVLVGRSGSGKSSLLNVLSGFLS-YQGSLRINGVELRD 415  

                   eql..rarrlgldldellllpaltveellala..................
                      + ++++l+++ +++  lpa t++e++ la  ++ +++ +++ +++ +
  ACF66691.1   416 LSPesWRQHLSWVGQNPQ-LPAATLRENVLLArpdaseqelyaaldaawv 464  

                   ..................erllsggkpdlvviDsltalapslllldepgr
                    +      + +++   ++   ls g+ ++v+++++++   +lllldep  
  ACF66691.1   465 seflpllpqgvdtplgnhASRLSVGQAQRVAVARALLNPCQLLLLDEP-- 512  

                   vtqgldarllreilrllkrlakelgitvlltshvtrevedraddvpvlag
                    +++lda    +++++lk++ k+  +t ++t+++ + +    d ++v+ +
  ACF66691.1   513 -AASLDAHSEQRVMQALKAASKR-QTTLMVTHQLEDLA--DWDAIWVMQD 558  

                   ggvlehlaldglgepldgllpilaklfrpievlalgllerksverlstGikaLDl
                                                                     
  ACF66691.1     -    ----------------------------------------------- -    

                   llgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesl
                         l  Ge+ +++G++GsGK++l+  l + l   +g+  + ++e + 
  ACF66691.1   373 ------LAAGERAVLVGRSGSGKSSLLNVLSGFL-SYQGSLRINGVELRD 415  

                   eql..rarrlgld...........ldrlllldaltveellalaerll...
                    + + ++++l+++ ++ +  +++  +++ll+++++ e+ l +a  +  + 
  ACF66691.1   416 LSPesWRQHLSWVgqnpqlpaatlRENVLLARPDASEQELYAALDAAwvs 465  

                   .....................sggkvdlvviDsltalapalelsllldep
                   +      + +++   +++   s g+ ++v+++++++   +l+l   ldep
  ACF66691.1   466 eflpllpqgvdtplgnhasrlSVGQAQRVAVARALLNPCQLLL---LDEP 512  

                   tsgldasllreilrllkrlakelgvtvllvshvlkevedladpvpdlrgg
                    ++lda    +++++lk++ k    t l+v+h l++  +  d + ++++g
  ACF66691.1   513 AASLDAHSEQRVMQALKAASK--RQTTLMVTHQLED-LADWDAIWVMQDG 559  

                   gvlehiadvvlllerdeiylkdgldlvggrrelrvvKnrvgpvgsvalvf
                    ++e+++                                           
  ACF66691.1   560 AIVEQGS------------------------------------------- 566  

                   eiteeGlekpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgq
                        ge+ +lvG+sG+GK++Ll+ l g         +    g+ +i+g+
  ACF66691.1   374    AAGERAVLVGRSGSGKSSLLNVLSGF--------LS-YQGSLRINGV 411  

                   lledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid.
                    l+dl ++ +r+    v q++ l  a t++e++     l+ +pd    + 
  ACF66691.1   412 ELRDLSPESWRQHLSWVGQNPQLP-AATLRENV-----LLARPDASEQEl 455  

                   ...............................sgGqkqrlalaralladpd
                   +++ +++ + +      + +++   +++   s+Gq+qr+a+arall   +
  ACF66691.1   456 yaaldaawvseflpllpqgvdtplgnhasrlSVGQAQRVAVARALLNPCQ 505  

                   lgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllsel
                   l   lllDep + lDa+s +++++ lk++ +  + t l+v          
  ACF66691.1   506 L---LLLDEPAASLDAHSEQRVMQALKAASK--RQTTLMV---------- 540  

                   thdlellreladrilvlgdgrivldgppvlllsaftgeglaelldalldl
                   th+le l++  d i+v+ dg iv++g  + +lsa +g     l ++ +d 
  ACF66691.1   541 THQLEDLAD-WDAIWVMQDGAIVEQG-SYAELSAANGAFATLLAHRQED- 587  

                   llliedekpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgge
                        ge+ +lvG sGsGKS+l+++l ++l      +g+++++gv+l+  
  ACF66691.1   374    AAGERAVLVGRSGSGKSSLLNVLSGFL----SYQGSLRINGVELR-- 414  

                   sglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeele
                    +l ++++r+++ +v q+p l   ++       ++n++l++++++++el 
  ACF66691.1   415 -DLSPESWRQHLSWVGQNPQLPAATL-------RENVLLARPDASEQELY 456  

                   aalelaglprvielllegldtlaggggvvlsGgqrqrvalar.....pdl
                   aal++a + +++ ll++g+dt++g++   ls gq qrva ar+  + ++l
  ACF66691.1   457 AALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQAQRVAVARallnpCQL 506  

                   llfldeptselleRllkrltrpgldadteeellellerlareyerliepl
                   ll ldep +              lda++e+ ++++l++            
  ACF66691.1   507 LL-LDEPAA-------------SLDAHSEQRVMQALKAAS---------- 532  

                   kkggatiivdtdrlsleevadrilvlldgrlmkgmiialtGppGsGKsTlaklLaerl...glpfistddlyrevver
                      + g++ +l+G +GsGKs+l + L+  l ++g   i++ +l r+  + 
  ACF66691.1   374    AAGERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVEL-RD--LS 417  

                   gtelgklikdyfdpgalvpd.llirlllerl.....lfldegggflldgf
                   +++ ++ +  ++++++l   +l  + ll+r ++ +++++++++ +++++f
  ACF66691.1   418 PESWRQHLSWVGQNPQLPAAtLRENVLLARPdaseqELYAALDAAWVSEF 467  

                   prtleqaeals...kpavlsggrkqrlalaralavdpe.lildgrhkgelvvlvGPsGaGKsTLlnaLlgllptsgvisvsgttrpprpgev
                        ge  vlvG sG+GKs+Lln L g+l+++g+++++g+    +  e 
  ACF66691.1   374    AAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES 420  

                   dgvgyvfqsre.lfpeltvagnfleg......aevrgnlygtsrerveel
                    +++  ++  + ++p+ t ++n+l++  ++ + e++  l +  ++  + l
  ACF66691.1   421 WRQHLSWVGQNpQLPAATLRENVLLArpdaseQELYAALDAAWVSEFLPL 470  

                   leagldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdar
                   l++g+d  l  + + ls+gq qr+a+aral++p +ll+ ldep+++lda+
  ACF66691.1   471 LPQGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLL-LDEPaASLDAH 519  

                   le.raleellelaegfdvvivnhdleealelldrilvlllakelkvlllGlsnvGKttllnrl.kfvetypTigvnkglkivlvGdsgvGKTtLlnrllgmglkvalvGlPNVGKSTLlNaLtgkgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldlde
                       g++ ++vG sGsGK++ll+ L g+l  + g+  + g++ ++l+++ 
  ACF66691.1   375    AGERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRINGVELRDLSPES 420  

                   llgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagf
                   +++    + + + lp  t ren+ l   ++p++s++el +al+++   +f
  ACF66691.1   421 WRQHLSWVGQNPQLPAATLRENVLL---ARPDASEQELYAALDAAWVSEF 467  

                   dvilieGllelalplilelrelsdgqiqrvaparallrdpllllldedtv
                     +l  G++++  +++   + ls gq qrva arall    llllde+ +
  ACF66691.1   468 LPLLPQGVDTPLGNHA---SRLSVGQAQRVAVARALLNPCQLLLLDEPAA 514  

                   vldkvdlasildlllelleeilkldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdyw
                           g + v++G +GsGK++l++ L++   ++  + + i       
  ACF66691.1   375    ----AGERAVLVGRSGSGKSSLLNVLSGFlSYQ--GSLRI------- 408  

                   aavgggdllrlirelllrlg...................fgepdafdnel
                       g +l +l  e   +    + ++ +  +++  +++   +pda + el
  ACF66691.1   409 ---NGVELRDLSPESWRQHLswvgqnpqlpaatlrenvlLARPDASEQEL 455  

                   lgellealleg..............gki.vlsarraqlleirlirpllae
                   +++l  a+  +      + +++   ++   ls ++aq+++   +r+ll++
  ACF66691.1   456 YAALDAAWVSEflpllpqgvdtplgNHAsRLSVGQAQRVAV--ARALLNP 503  

                   gkvvilDrepdsadlafagagyllggldleevkaleelllvlpkpdlviy
                    ++++lD ep ++             ld    +++ + l+ + k   ++ 
  ACF66691.1   504 CQLLLLD-EPAAS-------------LDAHSEQRVMQALKAASKRQTTLM 539  

                   ldadpeelleRlkkRgrdiEeieleylervrelyeellepskvlvidaiv
                   +++ +e l+++                                       
  ACF66691.1   540 VTHQLEDLADW--------------------------------------- 550  

                   pidevkediieliideilellellileldplledtlfallkvpedidegg
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   sllevklwlldllllllvdlsvfvldlsglpeeiledvlkllpgikttvl
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   dlgalkllldlvlalneemgvkGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgev
                       Ge  vl+G sG+GKs+ll+ l+g+l++ +g++ ++g+    +++e 
  ACF66691.1   375    AGERAVLVGRSGSGKSSLLNVLSGFLSY-QGSLRINGVELRDLSPES 420  

                   ..rgigyvfqsgalfphlivagnllegaevhgllygtskerveealekgl
                      ++++v q+++l      ++ ll    + +    ++  ++++a+ +++
  ACF66691.1   421 wrQHLSWVGQNPQLPAATLRENVLL---ARPDASEQELYAALDAAWVSEF 467  

                   lvlldr...........dlsggqqlrvalaralvvfildpslelldeRls
                   l ll+  +++   +++  ls gq++rva+aral+    ++ l+llde+ +
  ACF66691.1   468 LPLLPQgvdtplgnhasRLSVGQAQRVAVARALL---NPCQLLLLDEPAA 514  

                   grdadtreeirkrlkrlleelgplieydyvivnddleealeelldiivvl
                   ++da +++ +++ lk++ +++      ++++v++ le+ ++   d+i v+
  ACF66691.1   515 SLDAHSEQRVMQALKAASKRQ------TTLMVTHQLEDLAD--WDAIWVM 556  

                   llglilqpgsllelldllllskgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvkl
                       ge+ +l+G+sgsGKS+lln+l+g             g+++i+gv+l
  ACF66691.1   375    AGERAVLVGRSGSGKSSLLNVLSGFLS--------YQGSLRINGVEL 413  

                   qlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqs
                   +                            dls  +s++    w+g+  q 
  ACF66691.1   414 R----------------------------DLSP-ESWRQHLSWVGQNPQL 434  

                   lnllesllvlenlanvpillvlnKiDlleaklvllllvglfdll......
                    +           a     ++l + D+ e++l + l   +  ++     +
  ACF66691.1   435 PA-----------ATLRENVLLARPDASEQELYAALDAAWVSEFlpllpq 473  

                   ......dglpselsggqkqrvalaralalapdlllldeptsaldgegvee
                    +++  + + s ls gq qrva+aral++  +lllldep   ld ++ + 
  ACF66691.1   474 gvdtplGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQR 523  

                   lfdallelilegkgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvkl
                       ge+ +l+G+sgsGKS+lln l+g +         ++g+++i+gv+l
  ACF66691.1   375    AGERAVLVGRSGSGKSSLLNVLSGFLS--------YQGSLRINGVEL 413  

                   qlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqd
                   +                            dls ++s +    w+g+ +q 
  ACF66691.1   414 R----------------------------DLS-PESWRQHLSWVGQNPQL 434  

                   lnlfpsltvlenlanvpillvlnKiDlleakera....eellellgl.gd
                   ++           a +   ++l + D  e++ +a+ +++++ e+l+l  +
  ACF66691.1   435 PA-----------ATLRENVLLARPDASEQELYAaldaAWVSEFLPLlPQ 473  

                   lldklpse....lsgGqkqrvalaralaldpdllll..ptsaldgegiee
                   ++d++ ++++  ls Gq qrva+aral++  +llll++p + ld ++ + 
  ACF66691.1   474 GVDTPLGNhasrLSVGQAQRVAVARALLNPCQLLLLdePAASLDAHSEQR 523  

                   lfdlllelilelilvpGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelgg
                      +G++ v++G sGsGKs+l++ L++ l  ++g  s  + g ++  l++
  ACF66691.1   375    AGERAVLVGRSGSGKSSLLNVLSGFL-SYQG--SLRINGVELRDLSP 418  

                   aalldivdegrliglvfqdldllpllevlellaa................
                   +         r      ++ + lp ++++e+++ +  ++ +++ +++ ++
  ACF66691.1   419 E-------SWRQHLSWVGQNPQLPAATLRENVLLarpdaseqelyaalda 461  

                   ............rleellerippalsggqgqrvildrslysrpavlllll
                   + + +      ++++++l      ls gq qrv+++r+l++ +++lll  
  ACF66691.1   462 awvseflpllpqGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLL-- 509  

                   yvdeplsgldvelreelrdlleslllvlplpdlviyldadpeelleRllk
                     dep++ ld++  +++++ l++    + +  +++++++ +e l+++   
  ACF66691.1   510 --DEPAASLDAHSEQRVMQALKA----ASKRQTTLMVTHQLEDLADW--- 550  

                   Rgrdpeeqerlddleevlekylelakadterliepykkaadvividands
                                                          a ++  d+   
  ACF66691.1   551 --------------------------------------DAIWVMQDGA-- 560  

                   ieevvekildllkerlklllllGeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdg
                      Ge+ ++vG sGsGKs+Ll++L+g+l ++ gs+           +++g
  ACF66691.1   376    GERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSL-----------RING 410  

                   vdltfls....reeigyvfqepallpdltvlenlylglllalllaleegk
                   v+l++ls +  r+++++v q+p+l   +t +en++l++++a +++l ++ 
  ACF66691.1   411 VELRDLSpeswRQHLSWVGQNPQLP-AATLRENVLLARPDASEQELYAAL 459  

                   ivildgdreraeellell..gldadlviilpasleellerldrrggelsg
                         d +++ e+l ll +g+d               + l   ++ ls 
  ACF66691.1   460 ------DAAWVSEFLPLLpqGVD---------------TPLGNHASRLSV 488  

                   gqkqRvalarallldpdllllDEptsglDpeetreellellrelkgervglvGrpgaGKSTLlnaltglkaivsgyp...............
                      ger +lvGr+g+GKS+Lln+l+g +++ ++  ++ ++  +   +   
  ACF66691.1   376    GERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRingvelrdlspeswr 422  

                   ....gttldpnlgvvelddgrqlvlvDtpGlielaslgeglvrqaleale
                   ++  +++++p+l   +l++++ l   D   ++ +a+l+++ v ++l  l 
  ACF66691.1   423 qhlsWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLP 472  

                   radvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiD
                   +           d  l  +++ ls g+ qr+a+arall+   +l+l   D
  ACF66691.1   473 QG---------VDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLL---D 510  

                   ep....tneldlellellee..lggtvvlvSahdgegldelldailellk
                   ep++  +++  ++++++l+ +    t+++v+ h+ e l ++ dai+++ +
  ACF66691.1   511 EPaaslDAHSEQRVMQALKAasKRQTTLMVT-HQLEDLADW-DAIWVMQD 558  

                   gklvlyegdyltdmkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlykls
                         ge  ++vG sGsGKS l++ l+g+l   + g+ +i+g +l++ls
  ACF66691.1   376    ---GERAVLVGRSGSGKSSLLNVLSGFL--SYQGSLRINGVELRDLS 417  

                   reelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk......
                   +e +r   ++++ v q+p l   p +t ren++++     + + +++ ++
  ACF66691.1   418 PESWR---QHLSWVGQNPQL---PAATLRENVLLARPDASEQELyaalda 461  

                   .......llepvglpevldryphelsgGqrQRv...ralaldpdllilDe
                   + + +   l p g +  l    + ls Gq QRv+++ral+++ +ll+lDe
  ACF66691.1   462 awvseflPLLPQGVDTPLGNHASRLSVGQAQRVavaRALLNPCQLLLLDE 511  

                   ptsalgqpdpelr.elldllifldadlgltlirlitrdlgeagrsadrvl
                   p + l   d++  +++++ l+    ++++tl+  +t+ l+      d ++
  ACF66691.1   512 PAASL---DAHSEqRVMQALKAA-SKRQTTLM--VTHQLED-LADWDAIW 554  

                   ....griveqgppeelfinpqhpyadllidnvpdldvlidlivglipsll
                   ++++g iveqg+  el                                  
  ACF66691.1   555 vmqdGAIVEQGSYAEL---------------------------------- 570  

                   elpvgcrfaprcllaldlllslipdllllralllvvlggklllalelilt
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   plllrlllegrlPkgklivltGppGsGKtTlakaLaerl...glpvistddllreavpg
                        g + vl+G +GsGK++l++ L+  l ++g   i++ + lr++ p+
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRING-VELRDLSPE 419  

                   gtrlgeviq.................dlfllggllffdeldellkeriee
                   ++r  + +  ++ +  +++  +++  +  ++ + + +++ld++ +    +
  ACF66691.1   420 SWRQHLSWVgqnpqlpaatlrenvllARPDASEQELYAALDAAWVSEFLP 469  

                   llaag.gvildgfpldlegaealreallragplpdlvifldapleelleR
                   ll +g++  l      l+ ++a+r+a++ra+++p   ++ld+p   l++ 
  ACF66691.1   470 LLPQGvDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAH 519  

                   llkrgr.eplddteevilkrlerlrelyerliepyeeaddvividas.ls
                     +r ++     ++ +   +   ++e+++ + + +   d +iv  +s+ +
  ACF66691.1   520 SEQRVMqALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGAIVEQGSyAE 569  

                   ieevveeilelleekllvkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgepl
                         ge+ vl+G sGsGKs+l++ L+g+l + +gs  ++g+ ++++++
  ACF66691.1   376    ---GERAVLVGRSGSGKSSLLNVLSGFLSY-QGSLRINGVELRDLSP 418  

                   ge...ligevfqdgilfpdltvlenvalgrygllglikealaegviv...
                   +   + +  v q+++l    t +env+l+r +  ++ + a+ + ++v + 
  ACF66691.1   419 ESwrqHLSWVGQNPQLPA-ATLRENVLLARPDASEQELYAALDAAWVsef 467  

                   ..ildrvglsdla.ypgflsggeqqrvaiarallpkpdlvllldepteel
                     +l + +++ l ++++ ls g+ qrva arall  ++l llldep + l
  ACF66691.1   468 lpLLPQGVDTPLGnHASRLSVGQAQRVAVARALLNPCQL-LLLDEPAASL 516  

                   deRllkRg...rllekleyikkrlehylelaepykddvvvidangsieev
                   d+   +R +++ + ++  ++  +++h+le ++ +++ +v  d        
  ACF66691.1   517 DAHSEQRVmqaLKAASKRQTTLMVTHQLEDLADWDAIWVMQD-------- 558  

                   veeilklieellklllgkpllellkmkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrd
                        ge+ +l+G sGsGKs+l++ L+g+l  ++g+  ++g+ l    rd
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFL-SYQGSLRINGVEL----RD 415  

                   llgllreglirigyvfqdyalfprltvlenvllgll..............
                   l ++  ++ +  ++v q++ l +  t++envll++ ++ +++ +++ +++
  ACF66691.1   416 LSPESWRQHL--SWVGQNPQLPAA-TLRENVLLARPdaseqelyaaldaa 462  

                   ...............llgglvvildggvrqrlalarallldpdvllldep
                    + +      + +++ lg++   l+ g+ qr+a arall++  +llldep
  ACF66691.1   463 wvseflpllpqgvdtPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEP 512  

                   lllldaalr..........dlpdlvifldadpeelleRlkgkiigltGpsGsGKsTlaklLae.l...glpvidtddltregvllg
                       g++ +l+G sGsGKs+l++ L+  l ++g   i+  + +r+   l+
  ACF66691.1   376    -GERAVLVGRSGSGKSSLLNVLSGfLsyqGSLRING-VELRD---LS 417  

                   gpllerirellgegyllfdealdrellaallfglelegal..........
                    +++++  + +g++  l+  +l + +l a+  + e+e+ ++ +++ + + 
  ACF66691.1   418 PESWRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAaldaawvsef 467  

                   ...............ldglvygvlqdrllerllaagpdvlildgpl.lld
                        + +++   ++  +l+ g+ q+ +++r+l+ + ++l+ld+p + ld
  ACF66691.1   468 lpllpqgvdtplgnhASRLSVGQAQRVAVARALLNPCQLLLLDEPAaSLD 517  

                   vellplpdlvifldappevlleRllkRggdsleeiekrlerylelaplye
                   +                                                 
  ACF66691.1   518 A------------------------------------------------- 518  

                   eadlvidndglnllsieevveqilelleellkllenlnkkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr...
                        + + +lvG +GsGK+ l + L+  l  +  g ++i++ +lr    
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFLSYQ--GSLRINGVELRDlsp 418  

                   .......alifqdeldlfdedreegfrvpeelvrellkella........
                   +   ++   ++q ++   +  re  ++ + ++ ++ l ++l+++ + +  
  ACF66691.1   419 eswrqhlSWVGQNPQLPAATLRENVLLARPDASEQELYAALDaawvsefl 468  

                   .............................rllaeggdvvilDgt..nltl
                       + +++   +++    + +++ ++++r+l+++ + ++lD+++++l+ 
  ACF66691.1   469 pllpqgvdtplgnhasrlsvgqaqrvavaRALLNPCQLLLLDEPaaSLDA 518  

                   eqrealrrllkelgrpdlviyldapdeelleRllkrrkedrpdlldkdle
                   +  +++++ lk++ ++ +++ +++ +e l+ +                  
  ACF66691.1   519 HSEQRVMQALKAASKRQTTLMVTHQLEDLADW------------------ 550  

                   elleefegrddeyeppyepaddiieidlsrleiyevitkilvnyikglll
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   srivfyllnlhllergkvivltGppGsGKtTlarlLaellkplgg.gvvvidtddlrreair
                      g + vl+G +GsGK++l++ L+++l  +g  ++  +++ dl +e  r
  ACF66691.1   376    GERAVLVGRSGSGKSSLLNVLSGFLSYQGSlRINGVELRDLSPESWR 422  

                   elllgldlleilf.....................................
                   + l ++++++ l +++  +++  +  ++ +++ +++ +++ + +      
  ACF66691.1   423 QHLSWVGQNPQLPaatlrenvllarpdaseqelyaaldaawvseflpllp 472  

                   .........eglllsdefrelleealalladgdvvilDgfgrlldakgkvivltGppGsGKtTlarlLaellkplg.lgvvvidgddlrreav
                       g++ vl+G +GsGK++l++ L+++l  +g l++  +++ dl +e  
  ACF66691.1   376    -GERAVLVGRSGSGKSSLLNVLSGFLSYQGsLRINGVELRDLSPESW 421  

                   gqlglglsieelde................alllpdalrralleealeal
                   +q++ ++ +    ++++  +++  +  ++    l++al+ a++ e l+ l
  ACF66691.1   422 RQHLSWVGQNPQLPaatlrenvllarpdasEQELYAALDAAWVSEFLPLL 471  

                   kagkgkiigltGpsGsGKsTlarlLae.l...glpvidtddlyrelvagg
                       g++ +l+G sGsGKs+l++ L+  l ++g   i++ + +r+    +
  ACF66691.1   376    -GERAVLVGRSGSGKSSLLNVLSGfLsyqGSLRING-VELRD---LS 417  

                   tplgerirellgegyllpdealfrallaellfgdll.alalldgvv....
                    +++++  + +g++  lp  +l   +l +   + +++ +a+ld++ + + 
  ACF66691.1   418 PESWRQHLSWVGQNPQLPAATLRENVLLARPDASEQeLYAALDAAWvsef 467  

                   .......ydrlrdellaelsggqgdvliiegalllepgllplpdlvifld
                        +  d+++     +ls+gq++++++++all   +ll l++    ld
  ACF66691.1   468 lpllpqgVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLD 517  

                   appevlleRllkRg..gdseeeiekrleryreiaplleaadlvidndgsl
                   a  e ++   lk   ++ +   + ++le   +++ ++ + d  i+  gs 
  ACF66691.1   518 AHSEQRVMQALKAAskRQTTLMVTHQLEDLADWDAIWVMQDGAIVEQGSY 567  

                   eevveqilelleellklasllllelMkgklillvGppGsGKtTlaraLaellglpf.iridgddllrellge
                        g++ +lvG +GsGK++l++ L+++l ++  +ri+g +l++   ++
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFLSYQGsLRINGVELRDLSPES 420  

                   l.lgrgigfgfqqgdlledatvlenlalllldeidka.............
                      +++    + q + l+ at +en+ l+  d+ ++  +++ +++ + + 
  ACF66691.1   421 WrQHLS---WVGQNPQLPAATLRENVLLARPDASEQElyaaldaawvsef 467  

                   ...........ledggvvlldgfdrsqlqrlailrallddppdlvvflda
                        + +++ l+++ + l+ g    q+qr+a +rall  +   +++ld+
  ACF66691.1   468 lpllpqgvdtpLGNHASRLSVG----QAQRVAVARALLNPC--QLLLLDE 511  

                   pleellerllkRdgrteeeilerlarleeryradlvivtddlevvekila
                   p + l       d ++e+++++ l+++ +  r + ++vt+ le++++  a
  ACF66691.1   512 PAASL-------DAHSEQRVMQALKAASK--RQTTLMVTHQLEDLADWDA 552  

                   lllelllGkgelivllGpsGsGKsTlarlLagll..ggsvldtgepirgeplge
                        ge+ vl+G sGsGKs+l++ L+g+l ++gs+ + g  +r+++++ 
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFLsyQGSLRINGVELRDLSPES 420  

                   lir..glvfqdpllldeltvlenlalgrylhl..glilaalaagvgvvld
                    +++ ++v q+p l++  t +en++l+r ++++++l +a+ aa v ++l 
  ACF66691.1   421 WRQhlSWVGQNPQLPAA-TLRENVLLARPDASeqELYAALDAAWVSEFLP 469  

                   rvg..lsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeld
                   ++++  ++ +   ++ ls  gq+qrva+arall+p  +++lde p + ld
  ACF66691.1   470 LLPqgVDTPLGNHASRLSV-GQAQRVAVARALLNPCQLLLLDE-PAASLD 517  

                   eRlrkrl.......rlgdteevlehrleraeeladrlialyegavvvida
                   +   +r +++ +++ ++ t ++++h+le + ++ + +++  +ga+v+   
  ACF66691.1   518 AHSEQRVmqalkaaSKRQTTLMVTHQLEDLADWDAIWVMQ-DGAIVEQ-- 564  

                   sglsleevveeileileellgelvgldlllllkPgkiigltGpsGsGKsTlarlLae.l...gvividgddltrelvag
                        g++ +l+G sGsGKs+l++ L++ l ++g   i+g +l     ++
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGfLsyqGSLRINGVELRDLSPES 420  

                   gglliglifqdfglfelldrellielllenlalglal..egvildalrrr
                   ++ ++ ++ q++ l+ +  re         l  ++   ++ +  +   ++
  ACF66691.1   421 WRQHLSWVGQNPQLPAATLRE-------NVLLARPDAseQELYAALDAAW 463  

                   llelldll..gldvvilegplllsgglrqrpdlvifldappevlleRllk
                   + e+l ll +g d+ + +    ls+g+ qr++++++l  p ++ll+++++
  ACF66691.1   464 VSEFLPLLpqGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPA 513  

                   Rggldeetiekrlelylelaplygaadividndlsleevvdrilallegl
                    + ld+ + +++++++++  +  +++ +++++ l+  + +d i+++ +g 
  ACF66691.1   514 -ASLDAHSEQRVMQALKAASK--RQTTLMVTHQLEDLADWDAIWVMQDGA 560  

                   ...eGkgkiigitGpsGsGKsTlaklLaellgatvgdvd.............
                       g++ +++G sGsGKs+l++ L+++l ++ g+  ++ ++  +   + 
  ACF66691.1   376    -GERAVLVGRSGSGKSSLLNVLSGFLSYQ-GSLRingvelrdlspes 420  

                   .gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllellla
                    + + ++v q++ +   + +e+    ++ + + +l+ ald++ + e+l  
  ACF66691.1   421 wRQHLSWVGQNPQLPAATLRENVLLARPDAsEQELYAALDAAWVSEFLPL 470  

                   lveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe.
                   l++g  + l+ +   ls gq+qrva+a +  ++ ++l+ld+p + ld++ 
  ACF66691.1   471 LPQGVDTPLGNHASRLSVGQAQRVAVArallnPCQLLLLDEPAASLDAHs 520  

                   .........lrpladlvifldaspeelleRmngklivltGppGsGKtTlaraLaerl...glpvistddllreavpg
                        g++ vl+G +GsGK++l++ L+  l ++g   i++ +l+    + 
  ACF66691.1   376    --GERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVELRDLSPES 420  

                   gtdigelfqdyllfpfltvdeni................rglllealeel
                    +     + ++  +p +t +en+  +  ++ +++ +++  ++ + +  +l
  ACF66691.1   421 WRQHLSWVGQNPQLPAATLRENVllarpdaseqelyaalDAAWVSEFLPL 470  

                   laagkvvild....glsggllqrvallrallrpdlvifldapleelleRl
                   l +g +  l +++ +ls+g+ qrva++rall+p+ +++ld+p + l++  
  ACF66691.1   471 LPQGVDTPLGnhasRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHS 520  

                   lkRmlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl..lr
                         g + +lvG +GsGK++l++ l++ l ++g   ++i++ +l +l 
  ACF66691.1   376    ---GERAVLVGRSGSGKSSLLNVLSGFLsyqG--SLRINGVELrdLS 417  

                   geelgriielfdearelvpelallfideidell....akgkvvild....
                   +e+ ++++ ++++  +l   +  l +++++ +  ++ ++     ld++ +
  ACF66691.1   418 PESWRQHLSWVGQNPQLPAAT--L-RENVLLARpdasEQELYAALDaawv 464  

                   ......................gtgrlleldealellgpdlvifldap..
                    +      + +++   +++   ++g  +  + a++ll p+ +++ld p++
  ACF66691.1   465 seflpllpqgvdtplgnhasrlSVGQAQRVAVARALLNPCQLLLLDEPaa 514  

                   ..peelleRllkr......gldeeaieerlerlreilepleeaddlvidt
                     ++  ++R+++  +++ ++++ +++ + le l ++ + +   d  ++  
  ACF66691.1   515 slDAHSEQRVMQAlkaaskRQTTLMVTHQLEDLADWDAIWVMQDGAIV-- 562  

                   anldleevveeilelleepllllla.kvalvGlpnvGKStLlnallgrgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp...
                       ge+ +l+G sGsGKs+l++ L++ l  ++ g+++++g+++++   +
  ACF66691.1   376    -GERAVLVGRSGSGKSSLLNVLSGFL-SYQ-GSLRINGVELRDLspe 419  

                   .lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegv
                    +++++++v q+p l    t+ren++l+++ a+  ++ ++l  ++++e  
  ACF66691.1   420 sWRQHLSWVGQNPQLP-AATLRENVLLARPDASEQELYAALDAAWVSEFL 468  

                   svildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeple
                     +l +  +++l     ++ ls g++qrva aral+   + ++lldep +
  ACF66691.1   469 P-LLPQGVDTPLG--NHASRLSVGQAQRVAVARALLNPCQ-LLLLDEPAA 514  

                   vldeRlrkrgrlelreldseevlekrlehylellekadrvvvidaggsle
                    ld+   +r +    + +s  ++  +++h+le l+ +d++ v+       
  ACF66691.1   515 SLDAHSEQRVM-QALKAASKRQTTLMVTHQLEDLADWDAIWVMQ------ 557  

                   evveeilelleellkglrlivllGpsGaGKsTlaklLaellp..glivisvgdttrepregevl
                       + vl+G sG+GKs+l++ L + l+++g ++i++ + +r+  + + +
  ACF66691.1   377    ERAVLVGRSGSGKSSLLNVLSGFLSyqGSLRING-VELRDLSPESWR 422  

                   g.vdyvfvdrelfeelivagnlled......aivhgllygtskerieeal
                    ++ +v ++++l ++ + ++n+l++  ++ + +++  l + ++++  ++l
  ACF66691.1   423 QhLSWVGQNPQL-PAATLRENVLLArpdaseQELYAALDAAWVSEFLPLL 471  

                   daglgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddte
                    +g++  l  +   ls +qa+r+a++++ll ++ l++l+e+ +++++ +e
  ACF66691.1   472 PQGVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSE 521  

                   evirkrlerlapeleyyeelgladvvivnddleealelllaillalllki
                   + +++ l+++ +           ++++v++ le++ ++ +ai +++ + i
  ACF66691.1   522 QRVMQALKAASKR---------QTTLMVTHQLEDL-ADWDAIWVMQDGAI 561  

                   l..grmkiivltGpsGsGKsTlarlLaell...gvvvidtddllra.....
                        ++ vl+G sGsGKs+l++ L+++l ++g  +i++ +l ++  +  
  ACF66691.1   377    --ERAVLVGRSGSGKSSLLNVLSGFLsyqGSLRINGVELRDLspesw 421  

                   .......gevfqdyalfphltvlelldnvllgleirgllkaerlervevl
                    ++   +g  +q +a  ++ +vl++      +++++ l +a   e +  l
  ACF66691.1   422 rqhlswvGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLL 471  

                   lervgllldrippalsgGqgqrvildrallselayqpdvllldeplsgld
                    + v+++l+ + + ls Gq qrv+++rall+      ++llldep ++ld
  ACF66691.1   472 PQGVDTPLGNHASRLSVGQAQRVAVARALLNP----CQLLLLDEPAASLD 517  

                   aklreelrdllrellpegilpdlvifldadpeelleR....llkRgrese
                   a+  +++++ l++  ++     +++++++ +e l++++++ ++++g ++e
  ACF66691.1   518 AHSEQRVMQALKAASKR----QTTLMVTHQLEDLADWdaiwVMQDGAIVE 563  

                   rgepldlleevlekylarflgeterliaplkkaadvividasgsleevve
                   +g   +                                            
  ACF66691.1   564 QGSYAE-------------------------------------------- 569  

                   eileileellkklevilltGppGvGKTTlakalagelgakf.gsvsltgrdv...rsarr
                      e  +l+G++G+GK++l++ l g l +++  ++++++ +     s r 
  ACF66691.1   377    ERAVLVGRSGSGKSSLLNVLSGFLSYQGsLRINGVELRDlspESWRQ 423  

                   gigyvfq.......tveellgllaelvgle.................vrg
                   ++++v q+ +  ++t++e++ l    + +++ +++ +++ + +      +
  ACF66691.1   424 HLSWVGQnpqlpaaTLRENVLLARPDASEQelyaaldaawvseflplLPQ 473  

                   eleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvlea
                   + +  l+ +++ ls g+ qrva+arall+ + +lllDE+ + ld  + + 
  ACF66691.1   474 GVDTPLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPAaSLDAHSEQR 523  

                   llelleelkrsgvtvilttndldeleladriallrrgrivelgplseeel
                   ++++l+   +++ t +++t+ l++l+  d i+++++g ive g + e   
  ACF66691.1   524 VMQALKAA-SKRQTTLMVTHQLEDLADWDAIWVMQDGAIVEQGSYAE--- 569  

                   leilrrrlnrkiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlg
                       + ++vG +GsGK++lln l+g+l+  g+  +               
  ACF66691.1   377    ERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRIN-------------- 409  

                   idirdlidletvmelglgpngalvfa........................
                                       g+ + +   +   ++   + ++ +  +++ 
  ACF66691.1   410 --------------------GVELRDlspeswrqhlswvgqnpqlpaatl 439  

                   ..............leellttldillealelleedydyiliDtpGglelr
                    +++  +  ++ +++ + +  + ++ e+l ll++++d  l   +   +l+
  ACF66691.1   440 renvllarpdaseqELYAALDAAWVSEFLPLLPQGVDTPLGNHAS--RLS 487  

                   allalllaiaral.aadeillvddptsgldaetqleilelllelllklgi
                   ++ a++ a+aral ++  +ll+d+p ++lda +  ++++ l+     +  
  ACF66691.1   488 VGQAQRVAVARALlNPCQLLLLDEPAASLDAHSEQRVMQALKAA--SKRQ 535  

                   piilvlnKlDllseeglelvlelleellellpilllgvgpkdldlilail
                   ++++v++ l  l++ +++ v+++   +                       
  ACF66691.1   536 TTLMVTHQLEDLADWDAIWVMQDGAIV----------------------- 562  

                   lfepdvllvpilelsaktgegvddllelivealgeleelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGl
                                               + ++vGrsgsGKS+Lln l+G+
  ACF66691.1   378    -------------------------RAVLVGRSGSGKSSLLNVLSGF 399  

                   dvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsl
                                    ++++     v +  l ++ ++++l +v q++ l
  ACF66691.1   400 LS---------------YQGSLRINGVELRDLSPESWRQHLSWVGQNPQL 434  

                   lpeliel.................enralagpiagisrdairleielpgl
                     + +++++  +  ++ +++ +++++ a +++     ++ +++ +  +  
  ACF66691.1   435 PAATLREnvllarpdaseqelyaaLDAAWVSEFLPLLPQGVDTPLGNHAS 484  

                   pdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedand
                   +                  ls gq qrva+arall+ +  l+ll+e+a +
  ACF66691.1   485 R------------------LSVGQAQRVAVARALLNPCQ-LLLLDEPAAS 515  

                   ldtesdalellkelleeg.krtivvvtKiDlldkgeevldilrglliplg
                   ld+ s+ +++++ l+++ ++ t ++vt+                      
  ACF66691.1   516 LDAHSE-QRVMQALKAASkRQTTLMVTH---------------------- 542  

                   lgyvpvvnvsaltgegidelleaieeelefflgeplydlladrvgtealr
                                                                     
  ACF66691.1     - -------------------------------------------------- -    

                   eklselllehippslpgllleieyalqllIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgeli
                         v++G +GsGKs+l++ L++ l+++g s  + ++  +++    + 
  ACF66691.1   380    ---VLVGRSGSGKSSLLNVLSGFLSYQG-SLRINGVELRDLSPESWR 422  

                   relllegfqdlilvpdllvlellaanragl.relikellaagkgvildrf
                   ++l   g++    +p ++++e+++++r +   +++ ++l+a   ++ +  
  ACF66691.1   423 QHLSWVGQNP--QLPAATLRENVLLARPDAsEQELYAALDAA--WVSEFL 468  

                   p.........lsrlayqlsggerqrlaidlegalllerllldepfpdlvi
                   p   + +++ l ++a  ls g+ qr+a+++++++    llldep      
  ACF66691.1   469 PllpqgvdtpLGNHASRLSVGQAQRVAVARALLNPCQLLLLDEPA----A 514  

                   fldaspeelleRllk