RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF65947.1 sent8 ACF65947.1 GIB00763CH01 "hydrogenase-1 operon
protein HyaF2"
         (353 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1brfA [g.41.5] PROTEIN (RUBREDOXIN)                                    71   6e-15
1be7A [x.x.x] RUBREDOXIN                                               67   1e-13
1bq8A [g.41.5] PROTEIN (RUBREDOXIN)                                    65   4e-13
1b2jA [g.41.5] PROTEIN (RUBREDOXIN)                                    65   4e-13
1b2oA [g.41.5] PROTEIN (RUBREDOXIN)                                    64   6e-13
1b13A [g.41.5] PROTEIN (RUBREDOXIN)                                    63   1e-12
1bfyA [x.x.x] RUBREDOXIN                                               63   1e-12
1c09A [g.41.5] RUBREDOXIN                                              63   1e-12
2dsxA [g.41.5 (1e8jA)] RUBREDOXIN                                      61   6e-12
1dx8A [g.41.5] RUBREDOXIN                                              56   2e-10

>1brfA [g.41.5] PROTEIN (RUBREDOXIN)
          Length = 53

 Score = 70.9 bits (173), Expect = 6e-15
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
           +  CK+C ++YD   GD    I PG  F +LPD W CP+C   KS F  +++
Sbjct: 2   KWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 53


>1be7A [x.x.x] RUBREDOXIN
          Length = 54

 Score = 66.7 bits (162), Expect = 1e-13
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             C VC ++Y+P  GD    + PG  F  +PD W CP+    K  F  ++E
Sbjct: 4   YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLSGVGKDQFEEVEE 54


>1bq8A [g.41.5] PROTEIN (RUBREDOXIN)
          Length = 54

 Score = 64.8 bits (157), Expect = 4e-13
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             CK+C ++YD   GD    I PG  F +LPD W CP+C   KS F  +++
Sbjct: 4   WVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 54


>1b2jA [g.41.5] PROTEIN (RUBREDOXIN)
          Length = 54

 Score = 64.8 bits (157), Expect = 4e-13
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++E
Sbjct: 4   YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE 54


>1b2oA [g.41.5] PROTEIN (RUBREDOXIN)
          Length = 54

 Score = 64.0 bits (155), Expect = 6e-13
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++E
Sbjct: 4   YTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE 54


>1b13A [g.41.5] PROTEIN (RUBREDOXIN)
          Length = 54

 Score = 63.2 bits (153), Expect = 1e-12
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++E
Sbjct: 4   YTCTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 54


>1bfyA [x.x.x] RUBREDOXIN
          Length = 54

 Score = 63.2 bits (153), Expect = 1e-12
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
             C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++E
Sbjct: 4   YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 54


>1c09A [g.41.5] RUBREDOXIN
          Length = 53

 Score = 62.8 bits (152), Expect = 1e-12
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVID 345
             C VC ++Y+P  GD    + PG  F  +PD W CP+C   K  F  ++
Sbjct: 4   YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEEVE 53


>2dsxA [g.41.5 (1e8jA)] RUBREDOXIN
          Length = 52

 Score = 60.9 bits (147), Expect = 6e-12
 Identities = 24/48 (50%), Positives = 25/48 (52%)

Query: 295 RMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFM 342
              C VC + YDPA GD    I PG  F  LPD W CPVC  SK  F 
Sbjct: 3   IYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFE 50


>1dx8A [g.41.5] RUBREDOXIN
          Length = 70

 Score = 56.0 bits (134), Expect = 2e-10
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 296 MECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDE 346
            EC+ C ++Y+P  GD    IPPG PF  L D + CP C + K+ F  I +
Sbjct: 8   YECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKK 58


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.133    0.419 

Gapped
Lambda     K      H
   0.267   0.0482    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,981,516
Number of extensions: 1564253
Number of successful extensions: 16263
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7352
Number of HSP's successfully gapped: 212
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)