RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF66015.1 sent8 ACF66015.1 GIB00763CH01 "invasion protein
IagB"
         (160 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

132lA [x.x.x] HEN EGG WHITE LYSOZYME                                   93   6e-22
1bb3A [d.2.1] LYSOZYME                                                 87   3e-20
1b7mA [d.2.1] PROTEIN (LYSOZYME)                                       87   3e-20
1dkkA [d.2.1] LYSOZYME                                                 87   4e-20
1a2yC [d.2.1] LYSOZYME                                                 82   1e-18
1cj8A [d.2.1] PROTEIN (LYSOZYME)                                       81   2e-18
1at5A [x.x.x] LYSOZYME                                                 81   2e-18
1c7pA [d.2.1] LYSOZYME                                                 79   1e-17
1b5uA [d.2.1] PROTEIN (LYSOZYME)                                       78   2e-17
135lA [d.2.1 (1dzbX)] TURKEY EGG WHITE LYSOZYME                        78   2e-17
1b5zA [d.2.1] LYSOZYME                                                 78   2e-17
2dqaA [x.x.x] LYSOZYME                                                 77   4e-17
1d6qA [d.2.1] LYSOZYME                                                 77   5e-17
1ckdA [d.2.1] PROTEIN (LYSOZYME)                                       77   5e-17
1b7nA [d.2.1] PROTEIN (LYSOZYME)                                       76   6e-17
1b7qA [d.2.1] PROTEIN (LYSOZYME)                                       76   6e-17
1di5A [d.2.1] LYSOZYME C                                               76   8e-17
1ckcA [d.2.1] PROTEIN (LYSOZYME)                                       75   1e-16
1b7sA [x.x.x] LYSOZYME                                                 75   1e-16
1b7lA [d.2.1] PROTEIN (LYSOZYME)                                       74   2e-16
1b7rA [d.2.1] PROTEIN (LYSOZYME)                                       74   3e-16
1ckhA [d.2.1] PROTEIN (LYSOZYME)                                       74   4e-16
2bqnA [x.x.x] LYSOZYME                                                 73   4e-16
1alcA [x.x.x] ALPHA-LACTALBUMIN                                        73   5e-16
1d0lA [d.2.1] 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE                      72   8e-16
1cj7A [d.2.1] PROTEIN (LYSOZYME)                                       72   8e-16
1cj6A [d.2.1] PROTEIN (LYSOZYME)                                       72   9e-16
2cwiA [x.x.x] LYSOZYME C, MILK ISOZYME                                 72   1e-15
1b5wA [d.2.1] PROTEIN (LYSOZYME)                                       72   1e-15
1c46A [d.2.1] LYSOZYME                                                 72   1e-15
2bqcA [x.x.x] LYSOZYME                                                 72   1e-15
1b5yA [d.2.1] PROTEIN (LYSOZYME)                                       72   1e-15
133lA [x.x.x] HUMAN LYSOZYME                                           71   2e-15
1b7pA [d.2.1] PROTEIN (LYSOZYME)                                       71   2e-15
1ckgA [d.2.1] PROTEIN (LYSOZYME)                                       71   3e-15
1cj9A [d.2.1] PROTEIN (LYSOZYME)                                       70   3e-15
1bb4A [d.2.1] LYSOZYME                                                 70   3e-15
1di3A [d.2.1] LYSOZYME C                                               70   5e-15
1c45A [d.2.1] PROTEIN (LYSOZYME)                                       70   6e-15
1ckfA [d.2.1] PROTEIN (LYSOZYME)                                       70   6e-15
1di4A [d.2.1] LYSOZYME C                                               69   9e-15
1b5xA [d.2.1] PROTEIN (LYSOZYME)                                       69   9e-15
3csrA [x.x.x] MORPHOGENESIS PROTEIN 1                                  69   1e-14
1b7oA [d.2.1] PROTEIN (LYSOZYME)                                       69   1e-14
2bqfA [x.x.x] LYSOZYME                                                 69   1e-14
2bqhA [x.x.x] LYSOZYME                                                 68   1e-14
2bqdA [x.x.x] LYSOZYME                                                 68   1e-14
134lA [x.x.x] HUMAN LYSOZYME                                           68   2e-14
1c43A [d.2.1] PROTEIN (HUMAN LYSOZYME)                                 67   3e-14
2bqmA [x.x.x] LYSOZYME                                                 67   3e-14
2bqjA [x.x.x] LYSOZYME                                                 67   3e-14
2bqiA [x.x.x] LYSOZYME                                                 67   3e-14
2bqkA [x.x.x] LYSOZYME                                                 67   4e-14
1b5vA [d.2.1] PROTEIN (LYSOZYME)                                       65   1e-13
153lA [x.x.x] GOOSE LYSOZYME                                           65   1e-13
2bqeA [x.x.x] LYSOZYME                                                 65   1e-13
2bqoA [x.x.x] LYSOZYME                                                 65   2e-13
2bqgA [x.x.x] LYSOZYME                                                 65   2e-13
2bqlA [x.x.x] LYSOZYME                                                 62   9e-13
2bqbA [x.x.x] LYSOZYME                                                 61   2e-12
1b9oA [d.2.1] PROTEIN (ALPHA-LACTALBUMIN)                              59   1e-11
3bkhA [x.x.x] LYTIC TRANSGLYCOSYLASE                                   55   1e-10
1a4vA [x.x.x] ALPHA-LACTALBUMIN                                        51   2e-09
3cb7A [x.x.x] LYS-RICH LYSOZYME 2                                      49   1e-08
2ebzA [x.x.x] REGULATOR OF G-PROTEIN SIGNALING 12                      33   6e-04
2cquA [x.x.x] PEROXISOMAL D3,D2-ENOYL-COA ISOMERASE                    32   0.001

>132lA [x.x.x] HEN EGG WHITE LYSOZYME
          Length = 124

 Score = 92.8 bits (230), Expect = 6e-22
 Identities = 24/116 (20%), Positives = 38/116 (32%), Gaps = 1/116 (0%)

Query: 18  WADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKM 77
            A         +   S   +  A  ES     A   N DGSTD G++QINS       + 
Sbjct: 7   LAAAMRHGLDNYRGYSLGNWVCAAFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRT 66

Query: 78  GISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAK 133
             S       PC +++      S            + A+ A  +   +D++     
Sbjct: 67  PGSRNLCN-IPCSALLSSDITASVNCAKIVSDGNGMNAWVAWRNRCGTDVQAWIRG 121


>1bb3A [d.2.1] LYSOZYME
          Length = 130

 Score = 87.4 bits (216), Expect = 3e-20
 Identities = 20/122 (16%), Positives = 34/122 (27%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASILSDMMKIYGYS----WEAVGAYNAGTSPKRSDIRKRY 131
           K   +        C +++      +               A  A+      +      + 
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACLKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG 127

Query: 132 AK 133
             
Sbjct: 128 CG 129


>1b7mA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 87.1 bits (215), Expect = 3e-20
 Identities = 21/122 (17%), Positives = 36/122 (29%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASILSD----MMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +        C +++      +      +        A  A+      +      + 
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACMKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG 127

Query: 132 AK 133
             
Sbjct: 128 CG 129


>1dkkA [d.2.1] LYSOZYME
          Length = 129

 Score = 86.7 bits (214), Expect = 4e-20
 Identities = 25/121 (20%), Positives = 35/121 (28%), Gaps = 5/121 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A A      +             A+ ES     A   N DGSTD G++QINS       K
Sbjct: 9   AAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINSRWWCNDGK 68

Query: 77  MGISEKQLLQDPCISVIVGASILSDMMKIYGYS----WEAVGAYNAGTSPKRSDIRKRYA 132
              S       PC +++      +        S      A  A+             R  
Sbjct: 69  TPGSRNLCN-IPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGC 127

Query: 133 K 133
           +
Sbjct: 128 R 128


>1a2yC [d.2.1] LYSOZYME
          Length = 129

 Score = 81.7 bits (201), Expect = 1e-18
 Identities = 25/121 (20%), Positives = 34/121 (28%), Gaps = 5/121 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A A                    A+ ES     A   N DGSTD G++QINS       +
Sbjct: 9   AAAMKRHGLANYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGR 68

Query: 77  MGISEKQLLQDPCISVIVGASILSDMMK----IYGYSWEAVGAYNAGTSPKRSDIRKRYA 132
              S       PC +++      S          G    A  A+             R  
Sbjct: 69  TPGSRNLCN-IPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGC 127

Query: 133 K 133
           +
Sbjct: 128 R 128


>1cj8A [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 81.3 bits (200), Expect = 2e-18
 Identities = 21/116 (18%), Positives = 34/116 (29%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNARATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASILSDMMKIYGYS-------WEAVGAYNAGTSPKR 124
           K   +        C +++      +                W A          ++
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1at5A [x.x.x] LYSOZYME
          Length = 127

 Score = 80.9 bits (199), Expect = 2e-18
 Identities = 24/119 (20%), Positives = 34/119 (28%), Gaps = 6/119 (5%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A A      +             A+ ES     A   N DGSTD G++QINS       +
Sbjct: 9   AAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGR 68

Query: 77  MGISEKQL---LQDPCISVIVGASILSDMMKIYGYS-WEAVGAYNAGTSPKRSDIRKRY 131
              S             S I  +   +  +   G + W A      G         +  
Sbjct: 69  TPGSRNLCNIPCSALLSSDITASVNCAKKIVSNGMNAWVAWRNRCKG--TDVQAWIRGC 125


>1c7pA [d.2.1] LYSOZYME
          Length = 133

 Score = 78.6 bits (193), Expect = 1e-17
 Identities = 20/122 (16%), Positives = 35/122 (28%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 12  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 71

Query: 76  KMGISEKQLLQDPCISVIVGASILS----DMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +        C +++      +      +        A  A+      +      + 
Sbjct: 72  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG 130

Query: 132 AK 133
             
Sbjct: 131 CG 132


>1b5uA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 78.2 bits (192), Expect = 2e-17
 Identities = 20/115 (17%), Positives = 36/115 (31%), Gaps = 7/115 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGIALANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLL----QDPCISVIVGASILSDMMKIYGY--SWEAVGAYNAGTSPKR 124
           K   +              ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>135lA [d.2.1 (1dzbX)] TURKEY EGG WHITE LYSOZYME
          Length = 129

 Score = 78.2 bits (192), Expect = 2e-17
 Identities = 25/121 (20%), Positives = 36/121 (29%), Gaps = 5/121 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A A   L  +             A+ ES     A   N DGSTD G++QINS       +
Sbjct: 9   AAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRWWCNDGR 68

Query: 77  MGISEKQLLQDPCISVIVGASILSDMMKIYGY----SWEAVGAYNAGTSPKRSDIRKRYA 132
              S+      PC +++      S               A  A+             R  
Sbjct: 69  TPGSKNLCN-IPCSALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRGC 127

Query: 133 K 133
           +
Sbjct: 128 R 128


>1b5zA [d.2.1] LYSOZYME
          Length = 130

 Score = 78.2 bits (192), Expect = 2e-17
 Identities = 19/122 (15%), Positives = 35/122 (28%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQL----LQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +              ++    +    +++       A  A+      +      + 
Sbjct: 69  KTPGAVNACHLSCAALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQYVQG 127

Query: 132 AK 133
             
Sbjct: 128 CG 129


>2dqaA [x.x.x] LYSOZYME
          Length = 123

 Score = 76.7 bits (188), Expect = 4e-17
 Identities = 18/123 (14%), Positives = 35/123 (28%), Gaps = 13/123 (10%)

Query: 30  NIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPC 89
            +  + L  + + ES            GS   G  QI   +     K G       +   
Sbjct: 5   MVSQKCLLCMCKLESGGCKPIGCRMDVGSLSCGYFQIKQPYWIDCGKPGKD----WKSCS 60

Query: 90  ISVIVGASILSDMMKIYGY-------SWEAVGAYNAGTSPKRSDIRKRYAKKIWE--NYR 140
             +   +  +   MK Y                +N G +   S    +Y + + +    +
Sbjct: 61  NDINCSSKCVQQYMKRYATHYRCPLNCEGFAREHNGGPNGCHSSRTLKYWELLQKIPGCK 120

Query: 141 KLK 143
            +K
Sbjct: 121 GVK 123


>1d6qA [d.2.1] LYSOZYME
          Length = 130

 Score = 76.6 bits (188), Expect = 5e-17
 Identities = 20/122 (16%), Positives = 36/122 (29%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQL----LQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +              ++    +    +++       A  A+      +      + 
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVR-EPQGIRAWVAWRNRCQNRDVRQYVQG 127

Query: 132 AK 133
             
Sbjct: 128 CG 129


>1ckdA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 76.6 bits (188), Expect = 5e-17
 Identities = 21/112 (18%), Positives = 36/112 (32%), Gaps = 9/112 (8%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A+ +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRAVNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIYGY--SWEAVGAYNAGT 120
           K   +        C      ++    +    +++      +W A        
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNR 119


>1b7nA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 76.3 bits (187), Expect = 6e-17
 Identities = 24/116 (20%), Positives = 36/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+  S     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWLSGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQ-------LLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K   +          LLQD     +  A  +    +     W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ 123


>1b7qA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 76.3 bits (187), Expect = 6e-17
 Identities = 20/122 (16%), Positives = 36/122 (29%), Gaps = 6/122 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I   L   +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLALWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQ----DPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +              ++    +    +++       A  A+      +      + 
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQYVQG 127

Query: 132 AK 133
             
Sbjct: 128 CG 129


>1di5A [d.2.1] LYSOZYME C
          Length = 129

 Score = 75.8 bits (186), Expect = 8e-17
 Identities = 21/112 (18%), Positives = 32/112 (28%), Gaps = 13/112 (11%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGI--------SEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAG 119
           K               L  +   +V     ++         +W         
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVDPQGIRAWVAW----RNRCQ 116


>1ckcA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 75.1 bits (184), Expect = 1e-16
 Identities = 21/116 (18%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRAANYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIYGY--SWEAVGAYNAGTSPKR 124
           K   +        C      ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1b7sA [x.x.x] LYSOZYME
          Length = 130

 Score = 75.0 bits (184), Expect = 1e-16
 Identities = 23/112 (20%), Positives = 34/112 (30%), Gaps = 11/112 (9%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGI--------SEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAG 119
           K               L  +   +V     ++ D       +W A       
Sbjct: 69  KTPGASNACHLSCSALLQDNIADAVACAKRVVRD--PQGIRAWVAWRNRCQN 118


>1b7lA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 74.3 bits (182), Expect = 2e-16
 Identities = 24/116 (20%), Positives = 36/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       + + ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLLKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  K-------MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +     W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ 123


>1b7rA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 73.9 bits (181), Expect = 3e-16
 Identities = 20/116 (17%), Positives = 36/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+  INS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFGINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIY--GYSWEAVGAYNAGTSPKR 124
           K   +        C      ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1ckhA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 73.5 bits (180), Expect = 4e-16
 Identities = 21/116 (18%), Positives = 38/116 (32%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIY--GYSWEAVGAYNAGTSPKR 124
           K+  +        C      ++    +    +++      +W A          ++
Sbjct: 69  KVPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>2bqnA [x.x.x] LYSOZYME
          Length = 130

 Score = 73.5 bits (180), Expect = 4e-16
 Identities = 22/118 (18%), Positives = 35/118 (29%), Gaps = 13/118 (11%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPC---------ISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K   +        C          +      ++ D       +W A          ++
Sbjct: 69  KTPGAVNAAH-LSCSALLQDNIADAAAAAKRVVRD--PQGIRAWVAWRNRCQNRDVRQ 123


>1alcA [x.x.x] ALPHA-LACTALBUMIN
          Length = 122

 Score = 73.1 bits (179), Expect = 5e-16
 Identities = 18/117 (15%), Positives = 35/117 (29%), Gaps = 2/117 (1%)

Query: 18  WADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKM 77
            +      +    I    L       S     AI  N D ST+ GL QI++    +  + 
Sbjct: 8   LSQNLYDIDGYGRIALPELICTMFHTSGYDTQAIVEN-DESTEYGLFQISNALWCKSSQS 66

Query: 78  GISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKK 134
             S + +    C   +        M        + +  + A  +     + +   +K
Sbjct: 67  PQS-RNICDITCDKFLDDDITDDIMCAKKILDIKGIDYWIAHKALCTEKLEQWLCEK 122


>1d0lA [d.2.1] 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
          Length = 314

 Score = 72.5 bits (177), Expect = 8e-16
 Identities = 15/125 (12%), Positives = 32/125 (25%), Gaps = 2/125 (1%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A           +       + +  ++    P  +  +  G+   G    +S+    +  
Sbjct: 132 ATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDF 191

Query: 77  MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIW 136
            G     L  DP  ++   A+       + G    AV A             K    ++ 
Sbjct: 192 SGDGHINLW-DPVDAIGSVANYFKAHGWVKGDQV-AVMANGQAPGLPNGFKTKYSISQLA 249

Query: 137 ENYRK 141
                
Sbjct: 250 AAGLT 254


>1cj7A [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 72.4 bits (177), Expect = 8e-16
 Identities = 20/115 (17%), Positives = 35/115 (30%), Gaps = 7/115 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARVLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLL----QDPCISVIVGASILSDMMKIYGYS--WEAVGAYNAGTSPKR 124
           K   +              ++    +    +++       W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1cj6A [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 72.4 bits (177), Expect = 9e-16
 Identities = 22/123 (17%), Positives = 40/123 (32%), Gaps = 9/123 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A A   L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARALKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLL----QDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           K   +              ++    +    +++       A  A+      +     ++Y
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRD---VRQY 124

Query: 132 AKK 134
            + 
Sbjct: 125 VQG 127


>2cwiA [x.x.x] LYSOZYME C, MILK ISOZYME
          Length = 129

 Score = 72.0 bits (176), Expect = 1e-15
 Identities = 17/112 (15%), Positives = 33/112 (29%), Gaps = 5/112 (4%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     +  +            +A+ ES     A    N +GS+D G+ Q+NS    +  
Sbjct: 9   ARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLNSKWWCKSN 68

Query: 76  KMG---ISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
                        +    ++    +    ++K       A  A+      K 
Sbjct: 69  SHSSANACNIMCSKFLDDNIDDDIACAKRVVKDPN-GMSAWVAWVKHCKGKD 119


>1b5wA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 72.0 bits (176), Expect = 1e-15
 Identities = 20/116 (17%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QIN+ +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINARYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIY--GYSWEAVGAYNAGTSPKR 124
           K   +        C      ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1c46A [d.2.1] LYSOZYME
          Length = 131

 Score = 72.0 bits (176), Expect = 1e-15
 Identities = 21/111 (18%), Positives = 33/111 (29%), Gaps = 9/111 (8%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 10  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 69

Query: 76  KMGISEKQLLQDPCISVIVGASILSDM-------MKIYGYSWEAVGAYNAG 119
           K   +        C +++      +               +W A       
Sbjct: 70  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQN 119


>2bqcA [x.x.x] LYSOZYME
          Length = 130

 Score = 72.0 bits (176), Expect = 1e-15
 Identities = 22/114 (19%), Positives = 33/114 (28%), Gaps = 9/114 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    +       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGVSLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPC-------ISVIVGASILSDMMKIYGYSWEAVGAYNAGTSP 122
           K   +        C       I+  V A+           +W A          
Sbjct: 69  KTPGAVNAAH-LSCSALLQDNIADAVAAAKRVVRDPQGIRAWVAWRNRCQNRDV 121


>1b5yA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 71.7 bits (175), Expect = 1e-15
 Identities = 19/115 (16%), Positives = 36/115 (31%), Gaps = 7/115 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ E+     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWEAGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQL----LQDPCISVIVGASILSDMMKIYG--YSWEAVGAYNAGTSPKR 124
           K   +              ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>133lA [x.x.x] HUMAN LYSOZYME
          Length = 130

 Score = 71.2 bits (174), Expect = 2e-15
 Identities = 26/116 (22%), Positives = 39/116 (33%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  K-------MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +     W A   +      ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNHCQNRDVRQ 123


>1b7pA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 71.2 bits (174), Expect = 2e-15
 Identities = 20/115 (17%), Positives = 36/115 (31%), Gaps = 7/115 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLL----QDPCISVIVGASILSDMMKIYG--YSWEAVGAYNAGTSPKR 124
           K   +              ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACGLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1ckgA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 70.8 bits (173), Expect = 3e-15
 Identities = 25/116 (21%), Positives = 38/116 (32%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D S D G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSVDYGIFQINSRYWCNDG 68

Query: 76  KMG-------ISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +    +W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQ 123


>1cj9A [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 70.5 bits (172), Expect = 3e-15
 Identities = 26/116 (22%), Positives = 38/116 (32%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNVRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  K-------MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +     W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ 123


>1bb4A [d.2.1] LYSOZYME
          Length = 130

 Score = 70.4 bits (172), Expect = 3e-15
 Identities = 21/113 (18%), Positives = 34/113 (30%), Gaps = 6/113 (5%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASILSDMMKIYGYS----WEAVGAYNAGTSPKR 124
           K   +        C +++      +               A  A+      + 
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACLKRVVRDPQGIRAHVAWRNRCQNRD 120


>1di3A [d.2.1] LYSOZYME C
          Length = 130

 Score = 69.7 bits (170), Expect = 5e-15
 Identities = 21/116 (18%), Positives = 34/116 (29%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   DGSTD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDGSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASILSDMMKIYGYS-------WEAVGAYNAGTSPKR 124
           K   +        C +++      +                W A          ++
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>1c45A [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 69.7 bits (170), Expect = 6e-15
 Identities = 21/111 (18%), Positives = 35/111 (31%), Gaps = 9/111 (8%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIY--GYSWEAVGAYNAG 119
           K   +        C      ++    +    +++      +W A       
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQN 118


>1ckfA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 69.7 bits (170), Expect = 6e-15
 Identities = 25/116 (21%), Positives = 38/116 (32%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D S D G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSADYGIFQINSRYWCNDG 68

Query: 76  K-------MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +    +W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQ 123


>1di4A [d.2.1] LYSOZYME C
          Length = 128

 Score = 69.0 bits (168), Expect = 9e-15
 Identities = 20/114 (17%), Positives = 36/114 (31%), Gaps = 7/114 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
           A     L  +    I       +A+ ES     A  +N D STD G+ QINS +     K
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYN-DRSTDYGIFQINSRYWCNDGK 67

Query: 77  MGISEKQL----LQDPCISVIVGASILSDMMKIYG--YSWEAVGAYNAGTSPKR 124
              +              ++    +    +++      +W A          ++
Sbjct: 68  TPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 121


>1b5xA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 69.0 bits (168), Expect = 9e-15
 Identities = 21/116 (18%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCI-----SVIVGASILSDMMKIYG--YSWEAVGAYNAGTSPKR 124
           K   +        C      ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACH-LACSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>3csrA [x.x.x] MORPHOGENESIS PROTEIN 1
          Length = 159

 Score = 68.7 bits (167), Expect = 1e-14
 Identities = 19/145 (13%), Positives = 37/145 (25%), Gaps = 22/145 (15%)

Query: 16  TAWADCWLQAEKMFNIESE---LLYAIAQQESAMKPGAIGHNRDGST--DLGLMQINSFH 70
              A   L          +    +    Q ES + PG   +  +G+T    GL+Q     
Sbjct: 15  KVNAQYILNYLSSNGWTKQAICGMLGNMQSESTINPGLWQNLDEGNTSLGFGLVQWTPAS 74

Query: 71  MKRLKKMGISEK-----QLLQDPCISVIVGASILSDMMKIYGYSWEAVG----------- 114
                              L+     V   A  ++     +    ++             
Sbjct: 75  NYINWANSQGLPYKNMDSELKRIIWEVNNNAQWINLRDMTFKEYIKSTKTPRELAMIFLA 134

Query: 115 AYNAGTSPKRSDIRKRYAKKIWENY 139
           +Y    +      R   A+  ++N 
Sbjct: 135 SYERP-ANPNQPERGDQAEYWYKNL 158


>1b7oA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 68.6 bits (167), Expect = 1e-14
 Identities = 20/118 (16%), Positives = 35/118 (29%), Gaps = 6/118 (5%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESQYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQ----DPCISVIVGASILSDMMKIYGYSWEAVG-AYNAGTSPKRSDIR 128
           K   +              ++    +    +++        V           R  ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQ 126


>2bqfA [x.x.x] LYSOZYME
          Length = 130

 Score = 68.5 bits (167), Expect = 1e-14
 Identities = 18/74 (24%), Positives = 25/74 (33%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqhA [x.x.x] LYSOZYME
          Length = 130

 Score = 68.5 bits (167), Expect = 1e-14
 Identities = 21/114 (18%), Positives = 36/114 (31%), Gaps = 9/114 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVG--ASILSDMMKI-----YGYSWEAVGAYNAGTSP 122
           K   +        C +++    A  ++   ++        +W A          
Sbjct: 69  KTPGAVNAAH-LSCSALLQDNIADAVAAAKRVVRDPQGIRAWAAWRNRCQNRDV 121


>2bqdA [x.x.x] LYSOZYME
          Length = 130

 Score = 68.4 bits (167), Expect = 1e-14
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGVFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>134lA [x.x.x] HUMAN LYSOZYME
          Length = 130

 Score = 68.2 bits (166), Expect = 2e-14
 Identities = 20/112 (17%), Positives = 34/112 (30%), Gaps = 9/112 (8%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLLQDPCISVIVGASI-----LSDMMKIYGY--SWEAVGAYNAGT 120
           K   +        C +++             +++      +W A        
Sbjct: 69  KTPGAVNACH-LSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNECQNR 119


>1c43A [d.2.1] PROTEIN (HUMAN LYSOZYME)
          Length = 130

 Score = 67.4 bits (164), Expect = 3e-14
 Identities = 20/115 (17%), Positives = 36/115 (31%), Gaps = 7/115 (6%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76  KMGISEKQLL----QDPCISVIVGASILSDMMKIY--GYSWEAVGAYNAGTSPKR 124
           K   +              ++    +    +++      +W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ 123


>2bqmA [x.x.x] LYSOZYME
          Length = 130

 Score = 67.3 bits (164), Expect = 3e-14
 Identities = 18/77 (23%), Positives = 27/77 (35%), Gaps = 2/77 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +   D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPCISV 92
          K   +        C ++
Sbjct: 69 KTPGAANAAH-LSCSAL 84


>2bqjA [x.x.x] LYSOZYME
          Length = 130

 Score = 67.3 bits (164), Expect = 3e-14
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqiA [x.x.x] LYSOZYME
          Length = 130

 Score = 67.3 bits (164), Expect = 3e-14
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqkA [x.x.x] LYSOZYME
          Length = 130

 Score = 66.9 bits (163), Expect = 4e-14
 Identities = 19/77 (24%), Positives = 28/77 (36%), Gaps = 2/77 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPCISV 92
          K   +        C ++
Sbjct: 69 KTPGAVNAAH-LSCSAL 84


>1b5vA [d.2.1] PROTEIN (LYSOZYME)
          Length = 130

 Score = 65.5 bits (159), Expect = 1e-13
 Identities = 24/116 (20%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLK 75
           A     L  +    I       +A+ ES     A  +   D +TD G+ QINS +     
Sbjct: 9   ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRATDYGIFQINSRYWCNDG 68

Query: 76  K-------MGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKR 124
           K         +S   LLQD     +  A  +    +     W A          ++
Sbjct: 69  KTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ 123


>153lA [x.x.x] GOOSE LYSOZYME
          Length = 185

 Score = 65.3 bits (158), Expect = 1e-13
 Identities = 22/140 (15%), Positives = 39/140 (27%), Gaps = 18/140 (12%)

Query: 17  AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKK 76
            +     +  +   +E  ++  I  +ES           D     GLMQ++    K    
Sbjct: 47  RYKTIIKKVGEKLCVEPAVIAGIISRESHAGKVLKNGWGDRGNGFGLMQVDKRSHKPQGT 106

Query: 77  MGISEKQLLQDPCISVIVGASILSDMMKIYGY------SWEAVGAYNAGTSPKRSDIRK- 129
                            +  + +  + K +            + AYNAG    RS  R  
Sbjct: 107 -----WNGEVHITQGTTILINFIKTIQKKFPSWTKDQQLKGGISAYNAGAGNVRSYARMD 161

Query: 130 ------RYAKKIWENYRKLK 143
                  YA  +    +  K
Sbjct: 162 IGTTHDDYANDVVARAQYYK 181


>2bqeA [x.x.x] LYSOZYME
          Length = 130

 Score = 65.0 bits (158), Expect = 1e-13
 Identities = 18/74 (24%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ Q+NS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQVNSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqoA [x.x.x] LYSOZYME
          Length = 130

 Score = 64.9 bits (158), Expect = 2e-13
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqgA [x.x.x] LYSOZYME
          Length = 130

 Score = 64.9 bits (158), Expect = 2e-13
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqlA [x.x.x] LYSOZYME
          Length = 130

 Score = 62.3 bits (151), Expect = 9e-13
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>2bqbA [x.x.x] LYSOZYME
          Length = 130

 Score = 61.5 bits (149), Expect = 2e-12
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 17 AWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHN-RDGSTDLGLMQINSFHMKRLK 75
          A     L  +    I       +A+ ES     A  +N  D STD G+ QINS +     
Sbjct: 9  ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDG 68

Query: 76 KMGISEKQLLQDPC 89
          K   +        C
Sbjct: 69 KTPGAVNAAH-LSC 81


>1b9oA [d.2.1] PROTEIN (ALPHA-LACTALBUMIN)
          Length = 123

 Score = 58.8 bits (142), Expect = 1e-11
 Identities = 21/113 (18%), Positives = 35/113 (30%), Gaps = 7/113 (6%)

Query: 18  WADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKM 77
            +      +    I    L       S     AI  N D ST+ GL QI++    +  ++
Sbjct: 8   LSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVEN-DESTEYGLFQISNKLWCKSSQV 66

Query: 78  GISEKQLLQDPCISVIVGASILSD---MMKIY-GYSWEAVGAYNAGTSPKRSD 126
               + +    C    +   I  D     KI      +   A+ A  + K   
Sbjct: 67  PQ-SRNICDISC-DKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQ 117


>3bkhA [x.x.x] LYTIC TRANSGLYCOSYLASE
          Length = 260

 Score = 55.1 bits (131), Expect = 1e-10
 Identities = 25/141 (17%), Positives = 41/141 (29%), Gaps = 14/141 (9%)

Query: 1   MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTD 60
               +  +    + + A A      E    + S+LL   A  ESA            S+ 
Sbjct: 78  PPIPYKTIPPTANKSRAAATPVNAVENATGVRSQLLLTFASIESAFDYEIKAKT---SSA 134

Query: 61  LGLMQINSFHMKRLKKMGISEK------QLLQDPCISVIVGASILSDMMKIYGYSWE--- 111
            G  Q  +   K ++  G           L +DP IS +    I  + +       E   
Sbjct: 135 TGWFQFLTGTWKTIENYGKYGVLTDPTGALRKDPRISALGAELIKENNILRPVLKREPTD 194

Query: 112 --AVGAYNAGTSPKRSDIRKR 130
                A+  G    R  +   
Sbjct: 195 TDLYLAHFFGPGAARRFLTTG 215


>1a4vA [x.x.x] ALPHA-LACTALBUMIN
          Length = 123

 Score = 51.5 bits (123), Expect = 2e-09
 Identities = 16/102 (15%), Positives = 31/102 (30%), Gaps = 5/102 (4%)

Query: 18  WADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKM 77
            +      +    I    L       S     AI  N + ST+ GL QI++    +  ++
Sbjct: 8   LSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVEN-NESTEYGLFQISNKLWCKSSQV 66

Query: 78  GISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAG 119
               + +    C    +   I  D+M         +   +  
Sbjct: 67  PQ-SRNICDISC-DKFLDDDITDDIM--CAKKILDIKGIDYW 104


>3cb7A [x.x.x] LYS-RICH LYSOZYME 2
          Length = 126

 Score = 48.6 bits (115), Expect = 1e-08
 Identities = 20/98 (20%), Positives = 35/98 (35%), Gaps = 9/98 (9%)

Query: 22  WLQAEKMFNIESELLYAIAQQESAMKPGAIGH-NRDGSTDLGLMQINSFHMKRLKKMGIS 80
            +    +   +      IA+ ES+    A+G  N +GS D G+ QIN+++         S
Sbjct: 15  EMYKLGVPKNQLARWTCIAEHESSYNTKAVGSLNSNGSRDYGIFQINNYYWCSPPSGAFS 74

Query: 81  --------EKQLLQDPCISVIVGASILSDMMKIYGYSW 110
                   E  L+     +V     +L         +W
Sbjct: 75  YDECKIKCEDFLVDSIEPAVKCAQLVLKQQGWTAWSTW 112


>2ebzA [x.x.x] REGULATOR OF G-PROTEIN SIGNALING 12
          Length = 155

 Score = 33.2 bits (75), Expect = 6e-04
 Identities = 13/68 (19%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 72  KRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRY 131
           +R+    +S ++LLQDP         +  +  +     W+A   +N   +  + ++  R 
Sbjct: 10  RRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYR- 68

Query: 132 AKKIWENY 139
           A++I+  +
Sbjct: 69  AREIFSKF 76


>2cquA [x.x.x] PEROXISOMAL D3,D2-ENOYL-COA ISOMERASE
          Length = 116

 Score = 32.3 bits (73), Expect = 0.001
 Identities = 8/49 (16%), Positives = 16/49 (32%), Gaps = 3/49 (6%)

Query: 101 DMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEE 149
             +K+Y    +A         P   D+  +     W+ +  L  +  E 
Sbjct: 38  VKLKLYALYKQATEGPCNMPKPGVFDLINK---AKWDAWNALGSLPKEA 83


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0545    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 17,982,741
Number of extensions: 1002448
Number of successful extensions: 11577
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4127
Number of HSP's successfully gapped: 275
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)