RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF67239.1 sent8 ACF67239.1 GIB00763CH01 "transcriptional
regulator HilD"
         (309 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bl0A [a.4.1 - a.4.1] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PR...    83   1e-18
2ao9H [x.x.x] PHAGE PROTEIN                                            73   1e-15
2ao9C [x.x.x] PHAGE PROTEIN                                            72   3e-15
2dg6A [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR                       68   3e-14
3bcyA [x.x.x] PROTEIN YER067W                                          47   6e-08
1d5yA [a.4.1 - a.4.1 - d.60.1] ROB TRANSCRIPTION FACTOR                34   6e-04

>1bl0A [a.4.1 - a.4.1] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE
           PROTEIN)
          Length = 116

 Score = 83.1 bits (205), Expect = 1e-18
 Identities = 22/98 (22%), Positives = 40/98 (40%), Gaps = 1/98 (1%)

Query: 209 ERVYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEE-GTSFSDIYLSARMNQAAKLLR 267
             + + I  +      L  V++    S   L+R   +E G S      S +M + A+ L+
Sbjct: 6   HSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLK 65

Query: 268 IGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIK 305
             N  +  +A + G++S     + FK YF   P  +  
Sbjct: 66  ESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRM 103


>2ao9H [x.x.x] PHAGE PROTEIN
          Length = 114

 Score = 72.8 bits (178), Expect = 1e-15
 Identities = 8/98 (8%), Positives = 29/98 (29%), Gaps = 1/98 (1%)

Query: 200 LSSAQITLKERVYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAE-EGTSFSDIYLSAR 258
           L++ QI     +          +    ++A+ + ++ +TL     + +        ++  
Sbjct: 10  LTAKQIQAAYLLVENELMESEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADS 69

Query: 259 MNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYF 296
                +           +  +    +   ++Q F    
Sbjct: 70  FLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLT 107


>2ao9C [x.x.x] PHAGE PROTEIN
          Length = 117

 Score = 71.6 bits (175), Expect = 3e-15
 Identities = 8/101 (7%), Positives = 29/101 (28%), Gaps = 1/101 (0%)

Query: 200 LSSAQITLKERVYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAE-EGTSFSDIYLSAR 258
           L++ QI     +          +    ++A+ + ++ +TL     + +        ++  
Sbjct: 11  LTAKQIQAAYLLVENELMESEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADS 70

Query: 259 MNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTT 299
                +           +  +    +   ++Q F       
Sbjct: 71  FLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKK 111


>2dg6A [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
          Length = 201

 Score = 68.4 bits (167), Expect = 3e-14
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 1/74 (1%)

Query: 224 KLTDVADHIFMSTSTLKRKLAEE-GTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKCGY 282
           +L D++    +ST+T+K  L E       D     R+     L+++G   V       G+
Sbjct: 1   RLADLSKRSGVSTATIKYYLREGLLPPGYDEDHLRRLRLVRALIQVGKVPVATAREVLGH 60

Query: 283 DSTSYFIQCFKKYF 296
                  +  +   
Sbjct: 61  VDDDSLGRTVRLGA 74


>3bcyA [x.x.x] PROTEIN YER067W
          Length = 145

 Score = 47.3 bits (111), Expect = 6e-08
 Identities = 6/87 (6%), Positives = 18/87 (20%), Gaps = 4/87 (4%)

Query: 201 SSAQITLKERVYNIISSSPSRQWKLTDVADHIFMSTST----LKRKLAEEGTSFSDIYLS 256
           +S        ++  I     +  K       +     +      +     G         
Sbjct: 59  NSHSKKFVRHLHQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKITWHYGEETEYHGRP 118

Query: 257 ARMNQAAKLLRIGNHNVNAVALKCGYD 283
            +++            V+      G +
Sbjct: 119 FKIDVQVVCTHEDAVFVDYKTHPVGAN 145


>1d5yA [a.4.1 - a.4.1 - d.60.1] ROB TRANSCRIPTION FACTOR
          Length = 288

 Score = 34.0 bits (76), Expect = 6e-04
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 1/98 (1%)

Query: 209 ERVYNIISSSPSRQWKLTDVADHIFMSTSTLK-RKLAEEGTSFSDIYLSARMNQAAKLLR 267
             +   +     +   L +VA     S   L+       G +      + R++++A  LR
Sbjct: 6   RDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALR 65

Query: 268 IGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIK 305
           +    +  +AL+  +DS   F + FKK F  TP+ + +
Sbjct: 66  LTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRR 103


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0399    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 19,599,846
Number of extensions: 1186398
Number of successful extensions: 12766
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5079
Number of HSP's successfully gapped: 225
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)