RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF69484.1 sent8 ACF69484.1 GIB00763CH01 "macrolide export
ATP-binding/permease protein MacB"
         (648 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               179   2e-47
2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                  158   4e-41
3dmdC [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                    153   1e-39
2dwpA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                  150   8e-39
3c95A [x.x.x] EXODEOXYRIBONUCLEASE I                                  150   1e-38
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                 146   2e-37
3cmvH [x.x.x] PROTEIN RECA                                            146   2e-37
3cmvG [x.x.x] PROTEIN RECA                                            141   6e-36
2ccgA [x.x.x] THYMIDYLATE KINASE                                      138   5e-35
2akaB [x.x.x] DYNAMIN-1                                               138   5e-35
1bifA [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTO...   136   2e-34
2ccjB [x.x.x] THYMIDYLATE KINASE                                      134   5e-34
2bifA [c.37.1 - c.60.1] PROTEIN (6-PHOSPHOFRUCTO-2-KINASE/FRUCTO...   133   2e-33
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               131   5e-33
2ccgB [x.x.x] THYMIDYLATE KINASE                                      131   7e-33
2czvA [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3                      130   9e-33
3dmdB [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                    129   2e-32
2c03B [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     129   3e-32
2c61B [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B             128   5e-32
1e69A [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN                     128   6e-32
3cmvC [x.x.x] PROTEIN RECA                                            127   9e-32
4dcgA [x.x.x] VP39                                                    126   2e-31
3cmvA [x.x.x] PROTEIN RECA                                            125   4e-31
2dr3A [x.x.x] UPF0273 PROTEIN PH0284                                  124   6e-31
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA[M...   124   7e-31
3eiuB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          124   8e-31
1e9cA [c.37.1] THYMIDYLATE KINASE                                     123   1e-30
3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2                         123   2e-30
2a2zD [x.x.x] DEOXYCYTIDINE KINASE                                    123   2e-30
1e9fA [c.37.1] THYMIDYLATE KINASE                                     122   3e-30
2b8wA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          120   8e-30
2c03A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     120   9e-30
1e98A [c.37.1] THYMIDYLATE KINASE                                     120   1e-29
2b8tA [x.x.x] THYMIDINE KINASE                                        120   2e-29
1d1cA [c.37.1 - b.34.3] MYOSIN                                        119   2e-29
2a30D [x.x.x] DEOXYCYTIDINE KINASE                                    119   3e-29
3eiuA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          119   3e-29
2cjwB [x.x.x] GTP-BINDING PROTEIN GEM                                 118   4e-29
2dr3E [x.x.x] UPF0273 PROTEIN PH0284                                  116   2e-28
1e2dA [c.37.1] THYMIDYLATE KINASE                                     115   3e-28
2bc9A [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          115   3e-28
2cckA [x.x.x] THYMIDYLATE KINASE                                      115   5e-28
1e9sF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                         115   5e-28
3dm5A [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN                       114   7e-28
1e9sG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                         113   2e-27
2a2zA [x.x.x] DEOXYCYTIDINE KINASE                                    112   2e-27
1cr4A [c.37.1] DNA PRIMASE/HELICASE                                   112   2e-27
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         112   3e-27
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING            112   3e-27
3d3kA [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3                    112   3e-27
1e9rA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                         112   4e-27
3bb1B [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                           111   5e-27
3b2qA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          111   5e-27
1e9dA [c.37.1] THYMIDYLATE KINASE                                     110   9e-27
3b85A [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN                  110   1e-26
3bpbA [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE                 110   1e-26
2c9oC [x.x.x] RUVB-LIKE 1                                             109   3e-26
2cgtH [x.x.x] 60 KDA GROEL                                            108   4e-26
2c04A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     108   6e-26
2b92B [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          107   7e-26
2a5gA [x.x.x] ADP-RIBOSYLATION FACTOR 6                               106   1e-25
2c61A [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B             106   2e-25
1aroP [e.8.1] T7 RNA POLYMERASE                                       106   2e-25
2c9yA [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL             106   2e-25
2d4hB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          105   3e-25
3b2qB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          105   3e-25
1ai4B [d.153.1] PENICILLIN AMIDOHYDROLASE                             105   3e-25
3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B                            105   3e-25
3cr7C [x.x.x] ADENYLYL-SULFATE KINASE                                 105   3e-25
2bdtA [x.x.x] BH3686                                                  105   4e-25
2axzC [x.x.x] PRGX                                                    104   6e-25
1e9sD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                         104   9e-25
1bg0A [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE                      103   2e-24
2a30B [x.x.x] DEOXYCYTIDINE KINASE                                    103   2e-24
1e2fA [c.37.1] THYMIDYLATE KINASE                                     103   2e-24
3dt4A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC            102   3e-24
2ctsA [x.x.x] CITRATE SYNTHASE                                        101   5e-24
3bb1E [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                           100   9e-24
3dt2A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC            100   1e-23
421pA [x.x.x] H-RAS P21 PROTEIN                                       100   1e-23
3d7wA [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1                      100   1e-23
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               100   2e-23
1e4yA [c.37.1 - g.41.2] ADENYLATE KINASE                              100   2e-23
1dg3A [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED GUANYLATE-B...   100   2e-23
2d4hA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           99   2e-23
1e9sJ [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          99   4e-23
1dkiA [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN                             99   5e-23
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          98   6e-23
2axpA [x.x.x] HYPOTHETICAL PROTEIN BSU20280                            98   6e-23
2b8tB [x.x.x] THYMIDINE KINASE                                         98   8e-23
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN               98   9e-23
2dr3B [x.x.x] UPF0273 PROTEIN PH0284                                   97   1e-22
3cr7A [x.x.x] ADENYLYL-SULFATE KINASE                                  97   1e-22
2b8tC [x.x.x] THYMIDINE KINASE                                         97   2e-22
2a5jA [x.x.x] RAS-RELATED PROTEIN RAB-2B                               97   2e-22
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                97   2e-22
2a30A [x.x.x] DEOXYCYTIDINE KINASE                                     96   2e-22
3adkA [x.x.x] ADENYLATE KINASE                                         96   3e-22
3cddD [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      95   4e-22
1e3aB [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT                        95   4e-22
3cmtD [x.x.x] PROTEIN RECA                                             95   6e-22
3bo6B [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN                        94   1e-21
3cddF [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      94   1e-21
1e0jA [c.37.1] DNA HELICASE                                            94   1e-21
3dm9B [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     93   2e-21
3da4A [x.x.x] COLICIN-M                                                93   2e-21
2c4rL [x.x.x] RIBONUCLEASE E                                           93   2e-21
1cr2A [c.37.1] DNA PRIMASE/HELICASE                                    93   3e-21
2ahwD [x.x.x] PUTATIVE ENZYME YDIF                                     93   3e-21
2b8wB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           93   3e-21
1e0jB [c.37.1] DNA HELICASE                                            93   3e-21
3czpA [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2                          92   4e-21
3cmxA [x.x.x] PROTEIN RECA                                             92   4e-21
3dtbB [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             92   4e-21
2a2zB [x.x.x] DEOXYCYTIDINE KINASE                                     92   4e-21
3bb1C [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            92   5e-21
1e9rE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          92   6e-21
1av6A [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))                   92   6e-21
3bb1F [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            91   7e-21
2akaA [x.x.x] MYOSIN II HEAVY CHAIN                                    91   8e-21
2bjbA [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE             91   9e-21
3cioD [x.x.x] TYROSINE-PROTEIN KINASE ETK                              91   9e-21
2d4uA [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I                    91   1e-20
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          91   1e-20
1e2kA [c.37.1] THYMIDINE KINASE                                        90   2e-20
2dr3F [x.x.x] UPF0273 PROTEIN PH0284                                   90   2e-20
2c0bL [x.x.x] RIBONUCLEASE E                                           90   2e-20
1d6jB [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE                       90   2e-20
3cr7D [x.x.x] ADENYLYL-SULFATE KINASE                                  90   2e-20
3clvA [x.x.x] RAB5 PROTEIN, PUTATIVE                                   90   2e-20
1e59A [c.60.1] PHOSPHOGLYCERATE MUTASE                                 89   3e-20
3dfpC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         89   3e-20
1e6cA [c.37.1] SHIKIMATE KINASE                                        89   3e-20
1e3mB [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR P...    89   3e-20
1e9sB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          89   3e-20
3dfnC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         89   3e-20
1e3mA [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR P...    89   3e-20
2eg5G [x.x.x] XANTHOSINE METHYLTRANSFERASE                             89   4e-20
2ahvA [x.x.x] PUTATIVE ENZYME YDIF                                     89   4e-20
3dfoD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         89   5e-20
3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           88   6e-20
3dfqD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         88   6e-20
2cckB [x.x.x] THYMIDYLATE KINASE                                       88   6e-20
2ausC [x.x.x] PSEUDOURIDINE SYNTHASE                                   88   8e-20
1e9rD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          88   8e-20
3cddC [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      88   8e-20
2bkiA [x.x.x] UNCONVENTIONAL MYOSIN                                    88   9e-20
3cmvE [x.x.x] PROTEIN RECA                                             88   9e-20
3dftD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         87   1e-19
3dfpD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         87   1e-19
3dt7A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             87   1e-19
1cr1A [c.37.1] DNA PRIMASE/HELICASE                                    87   1e-19
3dfqA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         87   2e-19
1dhjA [c.71.1] DIHYDROFOLATE REDUCTASE                                 87   2e-19
1aldA [c.1.10 (2aldA)] ALDOLASE A                                      86   2e-19
2dr3C [x.x.x] UPF0273 PROTEIN PH0284                                   86   2e-19
2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                86   2e-19
3ch4B [x.x.x] PHOSPHOMEVALONATE KINASE                                 86   2e-19
3dfnA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         86   3e-19
1cs4C [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        86   3e-19
1adoA [c.1.10] ALDOLASE                                                85   5e-19
3dfnD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         85   5e-19
2bwjA [x.x.x] ADENYLATE KINASE 5                                       85   5e-19
6aldA [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE                    85   6e-19
3dftC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         85   6e-19
2bx2L [x.x.x] RIBONUCLEASE E                                           85   6e-19
1cjtC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        84   8e-19
2a1fF [x.x.x] URIDYLATE KINASE                                         84   1e-18
1e9sM [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          84   1e-18
3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           83   2e-18
3dt4C [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             82   3e-18
3bb1A [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            82   3e-18
1ek0A [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)                     82   4e-18
1d6jA [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE                       82   4e-18
2bhjA [x.x.x] NITRIC OXIDE SYNTHASE                                    82   5e-18
3d3qA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   82   6e-18
1bmfC [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE        82   6e-18
3c8uA [x.x.x] FRUCTOKINASE                                             82   6e-18
2c7cH [x.x.x] 60 KDA CHAPERONIN                                        81   7e-18
3dfqC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         81   7e-18
2d0kA [x.x.x] DIHYDROFOLATE REDUCTASE                                  81   7e-18
1dekA [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE                    81   7e-18
3di4A [x.x.x] UNCHARACTERIZED PROTEIN DUF1989                          81   9e-18
1e9rF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          81   1e-17
2czvB [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3                       80   1e-17
1cr0A [c.37.1] DNA PRIMASE/HELICASE                                    80   1e-17
3d3qB [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   80   2e-17
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          80   2e-17
3dfoC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         80   2e-17
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING           80   2e-17
3a00A [x.x.x] GUANYLATE KINASE                                         80   3e-17
3cmwC [x.x.x] PROTEIN RECA                                             79   3e-17
1e9sH [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          79   3e-17
2bkhA [x.x.x] UNCONVENTIONAL MYOSIN                                    79   3e-17
3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           79   3e-17
3bjdB [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)                79   4e-17
2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB                79   5e-17
3cnlA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         79   5e-17
2bv7A [x.x.x] GLYCOLIPID TRANSFER PROTEIN                              78   5e-17
3be4A [x.x.x] ADENYLATE KINASE                                         78   6e-17
3bczC [x.x.x] PROTEIN MEMO1                                            78   7e-17
3czjA [x.x.x] BETA-GALACTOSIDASE                                       78   7e-17
2dr3D [x.x.x] UPF0273 PROTEIN PH0284                                   78   8e-17
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          78   9e-17
2bhvA [x.x.x] COMB10                                                   77   1e-16
1dw9A [a.35.1 - d.72.1] CYANATE LYASE                                  77   1e-16
3dlbB [x.x.x] ARGONAUTE                                                77   1e-16
1culC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        77   1e-16
1b0uA [c.37.1] HISTIDINE PERMEASE                                      77   1e-16
3cm0A [x.x.x] ADENYLATE KINASE                                         77   2e-16
3dymA [x.x.x] BETA-GALACTOSIDASE                                       76   2e-16
1cjaA [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)                         76   3e-16
1ak2A [x.x.x] ADENYLATE KINASE ISOENZYME-2                             76   4e-16
1dekB [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE                    76   4e-16
3bv4A [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         75   5e-16
1dhiA [c.71.1] DIHYDROFOLATE REDUCTASE                                 75   5e-16
1eilA [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE          75   5e-16
1e2gA [c.37.1] THYMIDYLATE KINASE                                      75   5e-16
3crmA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   75   5e-16
1c9kC [c.37.1] ADENOSYLCOBINAMIDE KINASE                               75   7e-16
3c14C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          74   9e-16
2ck3C [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM                   74   9e-16
1e9sL [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          74   1e-15
1bglA [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE     74   1e-15
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  74   1e-15
2d2eA [x.x.x] SUFC PROTEIN                                             74   1e-15
3brwA [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1                         73   2e-15
3bb1G [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            73   2e-15
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  73   2e-15
2ccjA [x.x.x] THYMIDYLATE KINASE                                       73   2e-15
1e2hB [c.37.1] THYMIDINE KINASE                                        73   2e-15
3c15C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          73   2e-15
2aunA [x.x.x] HYPOTHETICAL PROTEIN                                     73   3e-15
1e2iA [c.37.1] THYMIDINE KINASE                                        72   3e-15
3cueF [x.x.x] GTP-BINDING PROTEIN YPT1                                 72   4e-15
1akeA [c.37.1 - g.41.2] ADENYLATE KINASE                               71   7e-15
3ec1A [x.x.x] YQEH GTPASE                                              71   7e-15
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          71   9e-15
2aumA [x.x.x] HYPOTHETICAL PROTEIN                                     71   9e-15
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  71   9e-15
2boeX [x.x.x] ENDOGLUCANASE E-2                                        71   1e-14
1e9sI [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          71   1e-14
3dauA [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE                         71   1e-14
2aunB [x.x.x] HYPOTHETICAL PROTEIN                                     71   1e-14
2bofX [x.x.x] ENDOGLUCANASE E-2                                        70   2e-14
3bb1H [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            70   2e-14
3cmvB [x.x.x] PROTEIN RECA                                             69   3e-14
2dpyB [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE                          69   3e-14
3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC                      69   3e-14
2d4uB [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I                    69   4e-14
1e9rG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          69   4e-14
2bhvD [x.x.x] COMB10                                                   69   4e-14
3a00B [x.x.x] GUANYLATE KINASE                                         69   5e-14
2dpyA [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE                          69   5e-14
2drcA [c.71.1] DIHYDROFOLATE REDUCTASE                                 68   6e-14
3dffA [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2             68   7e-14
4atjA [a.93.1] PROTEIN (PEROXIDASE C1A)                                68   8e-14
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                68   9e-14
1e9sE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          67   1e-13
3dfdA [x.x.x] PROTEIN YQBN                                             67   1e-13
2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                67   2e-13
1cfrA [x.x.x] RESTRICTION ENDONUCLEASE                                 67   2e-13
1ckvA [x.x.x] PROTEIN (PROTEIN B)                                      66   2e-13
1eamA [c.66.1] PROTEIN (VP39)                                          66   3e-13
5dfrA [x.x.x] DIHYDROFOLATE REDUCTASE                                  66   3e-13
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      66   3e-13
3d1mB [x.x.x] SONIC HEDGEHOG PROTEIN                                   66   3e-13
4dfrA [c.71.1] DIHYDROFOLATE REDUCTASE                                 65   5e-13
3d1mA [x.x.x] SONIC HEDGEHOG PROTEIN                                   65   6e-13
3dyoA [x.x.x] BETA-GALACTOSIDASE                                       65   6e-13
3cr7B [x.x.x] ADENYLYL-SULFATE KINASE                                  65   7e-13
2a1fD [x.x.x] URIDYLATE KINASE                                         65   7e-13
2ancF [x.x.x] GUANYLATE KINASE                                         64   8e-13
2dftA [x.x.x] SHIKIMATE KINASE                                         64   8e-13
1draA [c.71.1] DIHYDROFOLATE REDUCTASE                                 64   1e-12
1dyhA [c.71.1] DIHYDROFOLATE REDUCTASE                                 64   1e-12
3ecpA [x.x.x] TN5 TRANSPOSASE                                          64   1e-12
2aumB [x.x.x] HYPOTHETICAL PROTEIN                                     64   1e-12
3cbnA [x.x.x] CONSERVED PROTEIN MTH639                                 64   1e-12
1e2nA [c.37.1] THYMIDINE KINASE                                        64   2e-12
3ed8A [x.x.x] YELLOW FLUORESCENCE PROTEIN                              64   2e-12
1e4vA [c.37.1 - g.41.2] ADENYLATE KINASE                               63   2e-12
1e2iB [c.37.1] THYMIDINE KINASE                                        63   3e-12
1d2zD [a.77.1] DEATH DOMAIN OF TUBE                                    63   3e-12
3b55A [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN                       63   3e-12
3bwdD [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6                       63   3e-12
1e1qB [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE        62   4e-12
3cnnA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         62   4e-12
3c7kA [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT          62   6e-12
2a1fC [x.x.x] URIDYLATE KINASE                                         61   7e-12
3cqcA [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107                      61   8e-12
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          61   9e-12
2b8tD [x.x.x] THYMIDINE KINASE                                         61   9e-12
1e2mB [c.37.1] THYMIDINE KINASE                                        61   1e-11
3cmuA [x.x.x] PROTEIN RECA                                             60   2e-11
3cphA [x.x.x] RAS-RELATED PROTEIN SEC4                                 60   2e-11
2d7vA [x.x.x] HYPOTHETICAL PROTEIN VCA0330                             60   2e-11
1dp0A [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE     60   2e-11
3bb1D [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            60   3e-11
2anbA [x.x.x] GUANYLATE KINASE                                         59   4e-11
3bjqB [x.x.x] PHAGE-RELATED PROTEIN                                    59   4e-11
1afrA [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE         59   5e-11
2d7vB [x.x.x] HYPOTHETICAL PROTEIN VCA0330                             59   5e-11
1cjuC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        58   6e-11
1cjvC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        58   7e-11
1drbA [c.71.1] DIHYDROFOLATE REDUCTASE                                 58   8e-11
2dftC [x.x.x] SHIKIMATE KINASE                                         58   8e-11
3e8aC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          58   9e-11
1e9sA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          58   1e-10
1accA [x.x.x] ANTHRAX PROTECTIVE ANTIGEN                               57   1e-10
2ancD [x.x.x] GUANYLATE KINASE                                         57   2e-10
1bccF [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE                   57   2e-10
3b85B [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN                   56   2e-10
2e85B [x.x.x] HYDROGENASE 3 MATURATION PROTEASE                        56   4e-10
1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE                               56   4e-10
2a1fE [x.x.x] URIDYLATE KINASE                                         56   4e-10
3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE                         55   5e-10
1azsC [c.37.1 - a.66.1] GS-ALPHA                                       55   6e-10
3dm5B [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN                        55   6e-10
2a5vB [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)               55   6e-10
2c9gA [x.x.x] PENTON PROTEIN                                           55   7e-10
2cdnA [x.x.x] ADENYLATE KINASE                                         55   7e-10
2a5vA [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)               54   1e-09
2d2fA [x.x.x] SUFC PROTEIN                                             54   1e-09
3c7kC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT          54   1e-09
3c85A [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX          54   1e-09
3bm2B [x.x.x] PROTEIN YDJA                                             54   1e-09
2b0lC [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC                  54   2e-09
1chdA [x.x.x] CHEB METHYLESTERASE                                      53   2e-09
1e2nB [c.37.1] THYMIDINE KINASE                                        53   2e-09
1e9rB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          53   3e-09
3cd9A [x.x.x] GREEN FLUORESCENT PROTEIN                                53   3e-09
1e2jA [c.37.1] THYMIDINE KINASE                                        53   3e-09
1d6aA [d.165.1] POKEWEED ANTIVIRAL PROTEIN                             50   1e-08
3b9qA [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT          50   2e-08
1d8jA [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA                  50   2e-08
2an9A [x.x.x] GUANYLATE KINASE                                         50   2e-08
1e2lA [c.37.1] THYMIDINE KINASE                                        50   2e-08
1e2mA [c.37.1] THYMIDINE KINASE                                        49   3e-08
3cbqA [x.x.x] GTP-BINDING PROTEIN REM 2                                49   4e-08
2aexA [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL            49   5e-08
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                48   5e-08
2ancB [x.x.x] GUANYLATE KINASE                                         48   6e-08
2a78A [x.x.x] RAS-RELATED PROTEIN RAL-A                                48   7e-08
2c9oA [x.x.x] RUVB-LIKE 1                                              48   9e-08
2e85A [x.x.x] HYDROGENASE 3 MATURATION PROTEASE                        48   1e-07
1e9sK [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          46   2e-07
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1                45   5e-07
1ckeA [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)                 45   6e-07
1dwmA [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR                   45   7e-07
3ci2A [x.x.x] CHYMOTRYPSIN INHIBITOR 2                                 44   9e-07
1agpA [x.x.x] C-H-RAS P21 PROTEIN                                      44   1e-06
3dkvA [x.x.x] ADENYLATE KINASE                                         44   1e-06
1e2hA [c.37.1] THYMIDINE KINASE                                        44   1e-06
1e2kB [c.37.1] THYMIDINE KINASE                                        43   2e-06
2bwjB [x.x.x] ADENYLATE KINASE 5                                       43   2e-06
2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     43   3e-06
2bhvC [x.x.x] COMB10                                                   42   7e-06
3bs4A [x.x.x] UNCHARACTERIZED PROTEIN PH0321                           41   7e-06
2cfsA [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE                          41   8e-06
1brwA [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE ...    41   1e-05
3csuA [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)       40   1e-05
2c5mD [x.x.x] CTP SYNTHASE                                             40   2e-05
3cddA [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      40   2e-05
2axnA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                   40   2e-05
2ekbA [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE                  39   5e-05
2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     38   6e-05
3dmdA [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     38   7e-05
2c95B [x.x.x] ADENYLATE KINASE 1                                       38   8e-05
3e70C [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     37   1e-04
1e2lB [c.37.1] THYMIDINE KINASE                                        37   1e-04
1dapA [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE               37   1e-04
1e2jB [c.37.1] THYMIDINE KINASE                                        37   2e-04
3cddB [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      37   2e-04
3bb4A [x.x.x] T7I23.11 PROTEIN                                         37   2e-04
2c9oB [x.x.x] RUVB-LIKE 1                                              37   2e-04
3cr8B [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE              35   8e-04
2bwjD [x.x.x] ADENYLATE KINASE 5                                       35   8e-04

>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  179 bits (455), Expect = 2e-47
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 3/226 (1%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
            +  RN+   Y      +  L +I+L I  GE++ IVG +GSGKSTL  ++     P +G
Sbjct: 3   DITFRNIRFRYKPDSPVI--LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENG 60

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
              + G D++  DP+ L +               +    +  N  +              
Sbjct: 61  QVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGA 120

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEV 183
                      +  V    + LSGGQ+QR++IARAL+N  ++++ DE T ALD  S   +
Sbjct: 121 HDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVI 180

Query: 184 MAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
           M  + ++  +G TVII+ H       A+RII +  GKIV     +E
Sbjct: 181 MRNMHKIC-KGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKE 225


>2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 449

 Score =  158 bits (400), Expect = 4e-41
 Identities = 11/219 (5%), Positives = 40/219 (18%), Gaps = 25/219 (11%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               ++ +                 S   ++  ++ +VG+   GK+ +   L        
Sbjct: 4   TQSRVQKIWVPVDHR-----PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIG 58

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
              +V        +                +   +      A   ++ +  A        
Sbjct: 59  VPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK------- 111

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                        +         +   ++R  +                +   D      
Sbjct: 112 -------------EGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVAS 158

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKI 221
            +  ++                    +       +    
Sbjct: 159 NIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLD 197


>3dmdC [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 318

 Score =  153 bits (387), Expect = 1e-39
 Identities = 30/253 (11%), Positives = 62/253 (24%), Gaps = 35/253 (13%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
                VS    +       L +   +     ++  VG +GSGK+T +  L    K    +
Sbjct: 96  AVKEAVSEILETSR--RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFS 153

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +A  D          +   +  G    ++   +   A     I               
Sbjct: 154 VVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQ-------------- 199

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     +  +D      +G  +   ++   +    +V   +      D+ +G  ++
Sbjct: 200 -------HAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIV 252

Query: 185 AILRQL-RDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGVDAAVV 241
              RQ         II+T         A   I       +      +     +       
Sbjct: 253 EQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRP------ 306

Query: 242 NTAPGWRQFASSF 254
                   F    
Sbjct: 307 ---FEKEWFLERI 316


>2dwpA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 431

 Score =  150 bits (380), Expect = 8e-39
 Identities = 14/224 (6%), Positives = 47/224 (20%), Gaps = 24/224 (10%)

Query: 18  EEQVAVLKDISLQIHAGE---MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVST 74
           E   + ++ I + +       ++ +VG+   GK+ +   L           +V       
Sbjct: 1   ELTQSRVQKIWVPVDHRNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR 60

Query: 75  LDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXX 134
            +                +   +      A   ++ +  A                    
Sbjct: 61  REAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK------------------- 101

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
            +         +   ++R  +                +   D       +  ++      
Sbjct: 102 -EGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDY 160

Query: 195 HTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDA 238
                         +     E     +  +    +    + +D 
Sbjct: 161 KDCNSAEAM-DDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDV 203


>3c95A [x.x.x] EXODEOXYRIBONUCLEASE I
          Length = 446

 Score =  150 bits (379), Expect = 1e-38
 Identities = 18/207 (8%), Positives = 41/207 (19%), Gaps = 23/207 (11%)

Query: 9   NVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVA 68
           N +            +  +            V +    K  ++     L    +    + 
Sbjct: 245 NRNAVIMVDLAGD--ISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGIN 302

Query: 69  GRDVSTLDPDALA------------QLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI 116
            +                                ++  +   +   A + V         
Sbjct: 303 RQHCLDNLKILRENPQVREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNL- 361

Query: 117 XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD 176
                             + R    P  L   +QQR    R  +              L 
Sbjct: 362 -PALDITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQV--FTPEFLQGYADELQ 418

Query: 177 SHS-----GEEVMAILRQLRDRGHTVI 198
                    +E +A+L+ L      ++
Sbjct: 419 MLVQQYADDKEKVALLKALWQYADEIV 445


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score =  146 bits (369), Expect = 2e-37
 Identities = 37/241 (15%), Positives = 78/241 (32%), Gaps = 15/241 (6%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +L ++++  S         +L+ +SL +H GE+ AI+G +GSGKSTL   L   +     
Sbjct: 1   MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVT 56

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG-------- 115
              V  +    L      +         FQ    +  ++    ++               
Sbjct: 57  GGTVEFKGKDLLALSPEDRAGE-GIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETL 115

Query: 116 -IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                          SGG+++R  I +  +   ++ + DE    
Sbjct: 116 DRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSL 175

Query: 175 LDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV-HNPPAEEKKRE 233
                      +      +   +I+  +  L   + + +  ++ G+IV        K+ E
Sbjct: 176 DIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLE 235

Query: 234 Q 234
           +
Sbjct: 236 E 236


>3cmvH [x.x.x] PROTEIN RECA
          Length = 1173

 Score =  146 bits (368), Expect = 2e-37
 Identities = 25/230 (10%), Positives = 49/230 (21%), Gaps = 20/230 (8%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               +V             +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 301 DRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 358

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG-----IXXX 119
                 + +               G            T  Q +EI    A      +   
Sbjct: 359 CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVV 412

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                                  +     Q  R        +   +I  ++   AL  ++
Sbjct: 413 DSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYA 472

Query: 180 GEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-------AERIIEIHDGKIV 222
              +          G  V+       +                ++   I 
Sbjct: 473 SVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN 522



 Score =  115 bits (287), Expect = 5e-28
 Identities = 22/222 (9%), Positives = 46/222 (20%), Gaps = 10/222 (4%)

Query: 10  VSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAG 69
              +  +G   + +    +  +  G +V I G   SGK+TL   +    +    T     
Sbjct: 612 DVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID 670

Query: 70  RDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXX 129
            + +               G            T  Q +EI    A               
Sbjct: 671 AEHALDPIY------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAA 724

Query: 130 XXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ 189
                ++        +S   ++     +        I          +    ++  I   
Sbjct: 725 LTPK-AEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAV 783

Query: 190 L-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
              +                    +  E             E
Sbjct: 784 KEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGE 825



 Score = 81.2 bits (199), Expect = 8e-18
 Identities = 24/197 (12%), Positives = 52/197 (26%), Gaps = 21/197 (10%)

Query: 31   IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
            +  G +V I G   SGK+TL   +    +    T      + +               G 
Sbjct: 931  LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI------YARKLGV 984

Query: 91   IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
                       T  Q +EI    A                    +         +S   +
Sbjct: 985  DIDNLLCSQPDTGEQALEICDALAR-------SGAVDVIVVDSVAALTPLAARMMSQAMR 1037

Query: 151  QRVSIARALMNGGQVILADEPTGALDSHSGEEV----MAILRQLR-DRGHTVIIVTHD-P 204
            +     +       +I  ++   AL  ++   +    +  +++     G    +      
Sbjct: 1038 KLAGNLKQS--NTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK 1095

Query: 205  LIAAQAERIIEIHDGKI 221
            + A   +   +I  G+ 
Sbjct: 1096 IAAPFKQAEFQILYGEG 1112



 Score = 75.8 bits (185), Expect = 3e-16
 Identities = 25/219 (11%), Positives = 46/219 (21%), Gaps = 41/219 (18%)

Query: 14  YPSGEEQVAVLKDISLQ--IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRD 71
             +G      L        +  G +V I G   SGK+TL   +    +    T      +
Sbjct: 4   ISTG---SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAE 60

Query: 72  VSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXX 131
            +               G            T  Q +EI    A                 
Sbjct: 61  HALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-----GAVDVIVVDS 109

Query: 132 XXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR 191
                       ++S        +++A+                          +   L+
Sbjct: 110 VAALTPKAEIEGEISHMGLAARMMSQAMRK------------------------LAGNLK 145

Query: 192 DRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
                +I +          A   ++I     V       
Sbjct: 146 QSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVV 184


>3cmvG [x.x.x] PROTEIN RECA
          Length = 1167

 Score =  141 bits (355), Expect = 6e-36
 Identities = 26/234 (11%), Positives = 51/234 (21%), Gaps = 16/234 (6%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
           +  +S    S +     +   +  +  G +V I G   SGK+TL   +    +    T  
Sbjct: 1   VETISTGSLSLD-----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 55

Query: 67  VAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG-----IXXXXX 121
               + +               G            T  Q +EI    A      +     
Sbjct: 56  FIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDS 109

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                                +     Q  R        +   +I  ++   AL  ++  
Sbjct: 110 VAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASV 169

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
            +          G  V+       +               +          E  
Sbjct: 170 RLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 223



 Score =  139 bits (349), Expect = 3e-35
 Identities = 22/234 (9%), Positives = 44/234 (18%), Gaps = 11/234 (4%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               +V             +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 303 DRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 360

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +               G            T  Q +EI    A          
Sbjct: 361 CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALAR-SGAVDVIV 413

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     ++        +S   ++     +        I          +    ++ 
Sbjct: 414 VDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIR 473

Query: 185 AILRQL-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGV 236
            I      +                    +  E             E       
Sbjct: 474 RIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK 527



 Score =  137 bits (344), Expect = 1e-34
 Identities = 24/241 (9%), Positives = 53/241 (21%), Gaps = 14/241 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                   +V             +   +  +  G +V I G   SGK+TL   +    + 
Sbjct: 598 RLGEDRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR 655

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
              T      + +               G            T  Q +EI    A      
Sbjct: 656 EGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-GAV 708

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         ++        +S   ++     +        I          +   
Sbjct: 709 DVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVR 768

Query: 181 EEVMAILRQLRDRG----HTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQG 235
            ++  I             T + V  + + A         ++   I       +   ++ 
Sbjct: 769 LDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEK 828

Query: 236 V 236
           +
Sbjct: 829 L 829



 Score = 97.8 bits (242), Expect = 8e-23
 Identities = 24/216 (11%), Positives = 49/216 (22%), Gaps = 12/216 (5%)

Query: 23   VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
             +   +  +  G +V I G   SGK+TL   +    +    T      + +         
Sbjct: 917  DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI----- 971

Query: 83   LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
                  G            T  Q +EI    A                    +       
Sbjct: 972  -YARKLGVDIDNLLCSQPDTGEQALEICDALAR----SGAVDVIVVDSVAALTPLAARMM 1026

Query: 143  SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD--RGHTVIIV 200
            SQ        +  +  L+             A        + A+            V +V
Sbjct: 1027 SQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVV 1086

Query: 201  THDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
             +      +      ++   I       +   ++ +
Sbjct: 1087 KNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL 1122


>2ccgA [x.x.x] THYMIDYLATE KINASE
          Length = 202

 Score =  138 bits (348), Expect = 5e-35
 Identities = 23/196 (11%), Positives = 45/196 (22%), Gaps = 13/196 (6%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQR 94
             +   G  GSGK+T++N +                       +    +   +   I   
Sbjct: 2   AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTE 61

Query: 95  YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
             L +       V                              +D   +     +   V 
Sbjct: 62  AMLFAASRREHLVLKVIP------------ALKEGKVVLCDRYIDSSLAYQGYARGIGVE 109

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQAERI 213
             RAL       L  + T  L+  +      I++  RD+             +    + I
Sbjct: 110 EVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEI 169

Query: 214 IEIHDGKIVHNPPAEE 229
           I     +       + 
Sbjct: 170 IHNESQRFKSVNADQP 185


>2akaB [x.x.x] DYNAMIN-1
          Length = 299

 Score =  138 bits (347), Expect = 5e-35
 Identities = 22/237 (9%), Positives = 56/237 (23%), Gaps = 12/237 (5%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
           + ++       ++       I          +A+VG   +GKS+++      D    G+ 
Sbjct: 1   MEDLIPLVNRLQD---AFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSG 57

Query: 66  RVAGRDVSTLDPDALAQLRRE-------HFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
            V  R +     ++  +              F   R  + +                I  
Sbjct: 58  IVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINL 117

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                                    Q    + Q   +    +     ++        D  
Sbjct: 118 RVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLA 177

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV-HNPPAEEKKREQ 234
           + + +            T+ ++T   L+    +    + +  +           R Q
Sbjct: 178 NSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQ 234


>1bifA [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
           FRUCTOSE-2,6-
          Length = 432

 Score =  136 bits (341), Expect = 2e-34
 Identities = 11/204 (5%), Positives = 32/204 (15%), Gaps = 21/204 (10%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
             ++ +VG+   GK+ +   L           R         D     +          +
Sbjct: 2   PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEE 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                     A                               +         +   ++R 
Sbjct: 62  GLK--IRKQCALAALNDVRKFLS------------------EEGGHVAVFDATNTTRERR 101

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AER 212
           ++                +  +D       +  ++                    +    
Sbjct: 102 AMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY 161

Query: 213 IIEIHDGKIVHNPPAEEKKREQGV 236
                      +      K     
Sbjct: 162 ENSYESLDEEQDRDLSYIKIMDVG 185


>2ccjB [x.x.x] THYMIDYLATE KINASE
          Length = 195

 Score =  134 bits (339), Expect = 5e-34
 Identities = 19/198 (9%), Positives = 47/198 (23%), Gaps = 13/198 (6%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQR 94
             +   G  GSGK+T++N +                       +    +           
Sbjct: 2   AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVL------EGND 55

Query: 95  YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
             + +            +   +                     +D   +     +   V 
Sbjct: 56  MDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCD------RYIDSSLAYQGYARGIGVE 109

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERI 213
             RAL       L  + T  L+  +      I++  R     +           +  +R 
Sbjct: 110 EVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRF 169

Query: 214 IEIHDGKIVHNPPAEEKK 231
             ++  + + N   +  +
Sbjct: 170 KSVNADQPLENVVEDTYQ 187


>2bifA [c.37.1 - c.60.1] PROTEIN
           (6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 432

 Score =  133 bits (334), Expect = 2e-33
 Identities = 11/191 (5%), Positives = 30/191 (15%), Gaps = 21/191 (10%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
             ++ +VG+   GK+ +   L           R         D     +           
Sbjct: 2   PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNE- 60

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
              L      A                               +         +   ++R 
Sbjct: 61  -EGLKIRKQCALAALNDVRKFLS------------------EEGGHVAVFDATNTTRERR 101

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AER 212
           ++                +  +D       +  ++                    +    
Sbjct: 102 AMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY 161

Query: 213 IIEIHDGKIVH 223
                      
Sbjct: 162 ENSYESLDEEQ 172


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score =  131 bits (330), Expect = 5e-33
 Identities = 47/245 (19%), Positives = 96/245 (39%), Gaps = 26/245 (10%)

Query: 2   TALLELRNVSRSYPSGEEQVA-------VLKDISLQIHAGEMVAIVGVSGSGKSTLMNIL 54
           T  + + NV+  +  G  ++        VLKDI+ +I  G+++A+ G +G+GK++L+ ++
Sbjct: 2   TTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI 61

Query: 55  GCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYA 114
               +P+ G  + +GR         +     +                         +  
Sbjct: 62  MGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK 121

Query: 115 GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                               +++ +     LSGGQ+ R+S+ARA+     + L D P G 
Sbjct: 122 -------------------FAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGY 162

Query: 175 LDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
           LD  + +E+            T I+VT       +A++I+ +H+G         E +  +
Sbjct: 163 LDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLR 222

Query: 235 GVDAA 239
              ++
Sbjct: 223 PDFSS 227


>2ccgB [x.x.x] THYMIDYLATE KINASE
          Length = 199

 Score =  131 bits (329), Expect = 7e-33
 Identities = 20/193 (10%), Positives = 47/193 (24%), Gaps = 16/193 (8%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              +   G  GSGK+T++N +                               E    + +
Sbjct: 2   SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGV--------PTGEEIRKIVLE 53

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
              +     A         +  +                     +D   +     +   V
Sbjct: 54  GNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLC----DRYIDSSLAYQGYARGIGV 109

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRGHTVIIVTHDP---LIAAQ 209
              RAL       L  + T  L+  +      I++               +    +I  +
Sbjct: 110 EEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIEGYQEIIHNE 169

Query: 210 AERIIEIHDGKIV 222
           ++R   ++  + +
Sbjct: 170 SQRFKSVNADQPL 182


>2czvA [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
          Length = 208

 Score =  130 bits (328), Expect = 9e-33
 Identities = 18/208 (8%), Positives = 49/208 (23%), Gaps = 20/208 (9%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALA- 81
            +K I + I   E   +           +     +DK      R     V+ L  +    
Sbjct: 5   GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPS 64

Query: 82  ------QLRREHFGFIFQRYHLLSHLTAAQNVEIP--AVYAGIXXXXXXXXXXXXXXXXX 133
                 Q  + +  ++      +   +  + V+                           
Sbjct: 65  LVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNV 124

Query: 134 XSDRVDYPPSQLSGGQQQRV------SIARALMNGGQVILADEPTGALDSHSGEEVMAIL 187
                  P    +  ++  +      +         +  L        D     +++++ 
Sbjct: 125 ALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG 184

Query: 188 RQLRDRGHTVIIVTHDPLIAAQAERIIE 215
             +   G  +        I+   E I++
Sbjct: 185 VVI---GMEIPQAKAS--ISMYPEIILK 207


>3dmdB [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 320

 Score =  129 bits (325), Expect = 2e-32
 Identities = 28/257 (10%), Positives = 59/257 (22%), Gaps = 37/257 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
             A+ E  +              L +   +     ++  VG +GSGK+T +  L    K 
Sbjct: 96  EEAVKEAVSEILETSR----RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKN 151

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
              +  +A  D          +          +          A                
Sbjct: 152 HGFSVVIAASDTFRAGAIEQLEEHA--KRIGVKVIKHSYGADPAAVAYDAIQ-------- 201

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         +  +D      +G  +   ++   +    +V   +      D+ +G
Sbjct: 202 -----------HAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAG 250

Query: 181 EEVMAILRQL-RDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGVD 237
             ++   RQ         II+T         A   I       +      +     +  +
Sbjct: 251 NAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFE 310

Query: 238 AAVVNTAPGWRQFASSF 254
                       F    
Sbjct: 311 K---------EWFLERI 318


>2c03B [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 297

 Score =  129 bits (324), Expect = 3e-32
 Identities = 35/227 (15%), Positives = 63/227 (27%), Gaps = 27/227 (11%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           + L  V  +           +     +    +  +VG+ GSGK+T    L    K     
Sbjct: 73  VILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   D          +L  E  G             + +                   
Sbjct: 129 PLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARL---------- 178

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                      +  D      +G  Q    +   L    +V+  DE    LD+ +G+E +
Sbjct: 179 -----------EARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEAL 227

Query: 185 AILRQL-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
           ++ R      G T +++T     A   A        GK ++     E
Sbjct: 228 SVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSE 274


>2c61B [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
          Length = 425

 Score =  128 bits (321), Expect = 5e-32
 Identities = 20/252 (7%), Positives = 48/252 (19%), Gaps = 39/252 (15%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
                     +G        D +  +  G+ + I   SG   + +   +           
Sbjct: 95  ARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSES 150

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---------- 115
             A    +    +   +  +       +   L   +      + PAV             
Sbjct: 151 AFAVVFAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAA 207

Query: 116 ------------------IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIAR 157
                                                   +      + G +     I  
Sbjct: 208 EYLAYEHGMHVLVILTDITNYAEALRQMGYPGYMYTDLATLYERAGIVKGAKGSVTQIPI 267

Query: 158 ALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIH 217
             M G  +           +     V   L +          +   P ++      I   
Sbjct: 268 LSMPGDDITHPIPDLSGYITEGQIVVARELHR----KGIYPPINVLPSLSRLMNSGIGAG 323

Query: 218 DGKIVHNPPAEE 229
             +  H   +++
Sbjct: 324 KTREDHKAVSDQ 335


>1e69A [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
          Length = 263

 Score =  128 bits (321), Expect = 6e-32
 Identities = 32/238 (13%), Positives = 65/238 (27%), Gaps = 45/238 (18%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
                SL   +  + AIVG +GSGKS +++ +  +             ++       +  
Sbjct: 13  SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVEL 72

Query: 83  LRREHFGFIFQRYH----------------------------------------LLSHLT 102
           +  E+   I                                                   
Sbjct: 73  VFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRI 132

Query: 103 AAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALM-- 160
                 +   +                       R D   S LSGG++  V +A      
Sbjct: 133 VNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALVGLALLFALM 192

Query: 161 --NGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEI 216
                   + DE    LD ++ E    +L++   +    I++TH+ ++   A+ +  +
Sbjct: 193 EIKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVMEAADLLHGV 249


>3cmvC [x.x.x] PROTEIN RECA
          Length = 1175

 Score =  127 bits (319), Expect = 9e-32
 Identities = 23/237 (9%), Positives = 52/237 (21%), Gaps = 14/237 (5%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               +V             +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 610 DRSMDVETISTGSLSLD--IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 667

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +               G            T  Q +EI    A          
Sbjct: 668 CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-GAVDVIV 720

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     ++        +S   ++     +        I          +    ++ 
Sbjct: 721 VDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIR 780

Query: 185 AILRQLRD-----RGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
            I               V +V +      +      ++   I       +   ++ +
Sbjct: 781 RIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL 837



 Score =  104 bits (259), Expect = 8e-25
 Identities = 25/246 (10%), Positives = 56/246 (22%), Gaps = 24/246 (9%)

Query: 1    MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                    +V             +   +  +  G +V I G   SGK+TL   +    + 
Sbjct: 905  RLGEDRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR 962

Query: 61   TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
               T      + +               G            T  Q +EI    A      
Sbjct: 963  EGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALAR----- 1011

Query: 121  XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                          +         +S   ++         +   +I  ++   AL  ++ 
Sbjct: 1012 --SGAVDVIVVDSVAALTPLAARMMSQAMRKL--AGNLKQSNTLLIFINQGGNALKFYAS 1067

Query: 181  EEVMAILRQLRDRG-------HTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKRE 233
              +          G         V +V +      +      ++   I       +   +
Sbjct: 1068 VRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK 1127

Query: 234  QGVDAA 239
            + +   
Sbjct: 1128 EKLIEK 1133



 Score = 99.0 bits (245), Expect = 3e-23
 Identities = 25/239 (10%), Positives = 48/239 (20%), Gaps = 13/239 (5%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
                  +V             +   +  +  G +V I G   SGK+TL   +    +  
Sbjct: 300 LGEDRSMDVETISTGSL--SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE 357

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG-----I 116
             T      + +               G            T  Q +EI    A      +
Sbjct: 358 GKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV 411

Query: 117 XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD 176
                                     +     Q  R        +   +I  ++   AL 
Sbjct: 412 IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALK 471

Query: 177 SHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
            ++   +          G  V+       +               +          E  
Sbjct: 472 FYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 530



 Score = 80.5 bits (197), Expect = 1e-17
 Identities = 24/225 (10%), Positives = 48/225 (21%), Gaps = 41/225 (18%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
           +  +S    S +     +   +  +  G +V I G   SGK+TL   +    +    T  
Sbjct: 1   VETISTGSLSLD-----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 55

Query: 67  VAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXX 126
               + +     A             Q                                 
Sbjct: 56  FIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQA-------------------------- 89

Query: 127 XXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAI 186
                    +  D      +       S+A             +    L +    + M  
Sbjct: 90  --------LEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRK 141

Query: 187 LRQL-RDRGHTVIIVTHD-PLIAAQAERIIEIHDGKIVHNPPAEE 229
           L    +     +I +      +   A   ++I     V       
Sbjct: 142 LAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVV 186


>4dcgA [x.x.x] VP39
          Length = 291

 Score =  126 bits (316), Expect = 2e-31
 Identities = 18/243 (7%), Positives = 46/243 (18%), Gaps = 19/243 (7%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDI----SLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
               V++  P   +   +L ++     LQ H     A V   GS   T +  L       
Sbjct: 26  SANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNL 85

Query: 62  SGTYRVAGRDVSTLDPDALAQLR--REHFGFIFQRYHLLSHLTAAQNV------------ 107
               +    D    DP                 +    +        +            
Sbjct: 86  GVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTA 145

Query: 108 -EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVI 166
             +                                   +  G +     A +     +++
Sbjct: 146 DLLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLL 205

Query: 167 LADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPP 226
                     +   +       +     + ++            +     H   ++    
Sbjct: 206 SIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVY 265

Query: 227 AEE 229
             +
Sbjct: 266 CNK 268


>3cmvA [x.x.x] PROTEIN RECA
          Length = 1190

 Score =  125 bits (313), Expect = 4e-31
 Identities = 26/231 (11%), Positives = 55/231 (23%), Gaps = 15/231 (6%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +++  +S    S +     +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 629 MDVETISTGSLSLD-----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 683

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +               G            T  Q +EI    A          
Sbjct: 684 CAFIDAEHALDPIY------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVV 737

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     + + +   +     Q  R        +   +I  ++   AL  ++   + 
Sbjct: 738 DSVAAL----TPKAEIGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLD 793

Query: 185 AILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
                    G  V+       +               +          E  
Sbjct: 794 IRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 844



 Score =  124 bits (310), Expect = 1e-30
 Identities = 26/233 (11%), Positives = 49/233 (21%), Gaps = 45/233 (19%)

Query: 7   LRNVSRSYPSGEEQVAVLK--DISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +  +S            L     +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 1   VETISTGSL-------SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 53

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +     A             Q       L                       
Sbjct: 54  CAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQAL----------------------- 90

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                      +  D      +       S+A             +    L +    + M
Sbjct: 91  -----------EICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAM 139

Query: 185 AILRQ-LRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
             L   L+     +I +      +   A   ++I     V           + 
Sbjct: 140 RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRV 192



 Score =  103 bits (257), Expect = 1e-24
 Identities = 27/277 (9%), Positives = 63/277 (22%), Gaps = 38/277 (13%)

Query: 5    LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
                    +          +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 926  SMDVETISTGS----LSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 981

Query: 65   YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                  + +               G            T  Q +EI    A          
Sbjct: 982  CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-------G 1028

Query: 125  XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                      +         +S   ++     +   +   +I  ++   AL  ++   + 
Sbjct: 1029 AVDVIVVDSVAALTPLAARMMSQAMRKLAGNLK--QSNTLLIFINQGGNALKFYASVRLD 1086

Query: 185  -----AILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGK-IVHNPPAEEKKREQGVD 237
                 A+       G    +      + A   +   +I  G+ I       +   ++ + 
Sbjct: 1087 IRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL- 1145

Query: 238  AAVVNTAPGWRQFASSFREALSMAWLAMAANKMRTLL 274
                          +    +     +          L
Sbjct: 1146 -----------IEKAGAWYSYKGEKIGQGKANATAWL 1171



 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 31/282 (10%), Positives = 64/282 (22%), Gaps = 34/282 (12%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP------ 77
           +   +  +  G +V I G   SGK+TL   +    +    T      + +          
Sbjct: 320 IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLG 379

Query: 78  DALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAV--YAGIXXXXXXXXXXXXXXXXXXS 135
             +  L         Q   +   L  +  V++  V   A +                  +
Sbjct: 380 VDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAA 439

Query: 136 DRV---------------DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
             +                          +  V         G   L    +  LD    
Sbjct: 440 RMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRI 499

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPP---------AEEKK 231
             V     +      T + V  + + A   +   +I  G+ ++               +K
Sbjct: 500 GAVKEG--ENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEK 557

Query: 232 REQGVDAAVVNTAPGWRQFASSFREALSMAWLAMAANKMRTL 273
                         G     +  ++    A       +   L
Sbjct: 558 AGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLL 599


>2dr3A [x.x.x] UPF0273 PROTEIN PH0284
          Length = 232

 Score =  124 bits (312), Expect = 6e-31
 Identities = 23/223 (10%), Positives = 48/223 (21%), Gaps = 34/223 (15%)

Query: 14  YPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVS 73
             +G   V   + +   I    +V + G  G+GK+                      +  
Sbjct: 3   VKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH 60

Query: 74  TLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXX 133
            +      +     FG+  + Y                                      
Sbjct: 61  PVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK-------------------- 96

Query: 134 XSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE---VMAILRQL 190
                          +   V          + ++ D  T    +        ++ + R L
Sbjct: 97  -EYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVL 155

Query: 191 RDRGHTVIIVTHDP----LIAAQAERIIEIHDGKIVHNPPAEE 229
              G T I V+        +    + II +   +I        
Sbjct: 156 AGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSL 198


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
           MSBA[MASQUE : MEMB(X) 137 / COIL(x) 0]
          Length = 572

 Score =  124 bits (312), Expect = 7e-31
 Identities = 66/251 (26%), Positives = 106/251 (42%), Gaps = 9/251 (3%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
           T  LE RNV+ +YP  E     L++I+L+I AG+ VA+VG SGSGKST+ +++       
Sbjct: 330 TGDLEFRNVTFTYPGREVPA--LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDID 387

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIF-QRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
            G   + G D+      +L          +      + +++  A+  E            
Sbjct: 388 EGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARM 447

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                            +      LSGGQ+QR++IARAL+    +++ DE T ALD+ S 
Sbjct: 448 AYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESE 507

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAV 240
             +         +  T +++ H      QA+ I+ + DG IV      E   + GV A +
Sbjct: 508 RAIQ-AALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQL 566

Query: 241 VNTAPGWRQFA 251
                   QF 
Sbjct: 567 HK-----MQFG 572


>3eiuB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 426

 Score =  124 bits (311), Expect = 8e-31
 Identities = 20/266 (7%), Positives = 50/266 (18%), Gaps = 42/266 (15%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                          +G        D +  +  G+ + I   SG   + +   +      
Sbjct: 90  AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASV 145

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI---- 116
                  A    +    +   +  +       +   L   +      + PAV   +    
Sbjct: 146 PGSESAFAVVFAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRM 202

Query: 117 ---------------------------XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
                                                           +      + G +
Sbjct: 203 ALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVKGAK 262

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ 209
                I    M G  +                E   ++ +   R      +   P ++  
Sbjct: 263 GSVTQIPILSMPGDDITHPIPDLSGYI----TEGQIVVARELHRKGIYPPINVLPSLSRL 318

Query: 210 AERIIEIHDGKIVHNPPAEEKKREQG 235
               I     +  H   +++      
Sbjct: 319 MNSGIGAGKTREDHKAVSDQMYAGYA 344


>1e9cA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score =  123 bits (310), Expect = 1e-30
 Identities = 15/204 (7%), Positives = 39/204 (19%), Gaps = 12/204 (5%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G ++ + GV  +GKST    L            +      + +         +      Q
Sbjct: 3   GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-------IGKLLSSYLQ 55

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
           +   +   +                                   V Y  ++ +       
Sbjct: 56  KKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCK 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQAER 212
                L     V+                      +  +       +     L+      
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAKRGAFGHE----RYENGAFQERALRCFHQLMKDTTLN 171

Query: 213 IIEIHDGKIVHNPPAEEKKREQGV 236
              +   K +     + +   +  
Sbjct: 172 WKMVDASKSIEAVHEDIRVLSEDA 195


>3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
          Length = 452

 Score =  123 bits (308), Expect = 2e-30
 Identities = 24/234 (10%), Positives = 46/234 (19%), Gaps = 13/234 (5%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           L+         + + ++A L           +    G   +GK   +  +     P    
Sbjct: 227 LDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYH 286

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHL--TAAQNVEIPAVYAGIXXXXXX 122
                                 H     Q                               
Sbjct: 287 IVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYG 346

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                          V      +    Q+R    R      +  + +E     D      
Sbjct: 347 EINDFEEQLSEYGIIVVKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWD--- 402

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAA---QAERIIEIHDGKIVHNPPAEEKKRE 233
               +  + D   T   +    L+ A   +  R+  +    I     A  KK +
Sbjct: 403 --QYVDAVGDVDRTSTEIAPWTLVEANDKRFARVKVLRT--INDAIEAAYKKDK 452



 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 11/109 (10%), Positives = 28/109 (25%), Gaps = 10/109 (9%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
             +  +       E  +    ++  Q     ++ I G+ G+GK   + +L   D      
Sbjct: 17  KAVIEL------REALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEV 70

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVY 113
                     L+       +   +  +  +           +     V 
Sbjct: 71  QSFLRPSDEELERPP----QWRFWRRLPPKGRTGIFFGNWYSQLYARVE 115


>2a2zD [x.x.x] DEOXYCYTIDINE KINASE
          Length = 220

 Score =  123 bits (308), Expect = 2e-30
 Identities = 23/211 (10%), Positives = 50/211 (23%), Gaps = 12/211 (5%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL--RREHFGFI 91
            + ++I G   +GKST +NIL  L +          R  +    + L  +  + E + F 
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
           FQ Y  LS + A                                   +   +        
Sbjct: 62  FQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDW 121

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVM---------AILRQLRDRGHTVIIVTH 202
             +     +    +I                            + +        ++  T 
Sbjct: 122 MNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL 181

Query: 203 DPLIAAQ-AERIIEIHDGKIVHNPPAEEKKR 232
                      I+ +   +   +      ++
Sbjct: 182 KTNFDYLQEVPILTLDVNEDFKDKYESLVEK 212


>1e9fA [c.37.1] THYMIDYLATE KINASE
          Length = 202

 Score =  122 bits (306), Expect = 3e-30
 Identities = 16/205 (7%), Positives = 39/205 (19%), Gaps = 17/205 (8%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G ++ + GV G+GKST    L            +      + +         +      Q
Sbjct: 3   GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI-------GKLLSSYLQ 55

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
           +   +   +                                   V +  ++ +       
Sbjct: 56  KKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAIL---------RQLRDRGHTVIIVTHDP 204
                L     V+                              +        ++  +   
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLN-WKMVDASKSI 174

Query: 205 LIAAQAERIIEIHDGKIVHNPPAEE 229
               +  R++           P  E
Sbjct: 175 EAVHEDIRVLSEDAIATATEKPLGE 199


>2b8wA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 288

 Score =  120 bits (302), Expect = 8e-30
 Identities = 37/251 (14%), Positives = 55/251 (21%), Gaps = 19/251 (7%)

Query: 1   MT-ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDK 59
           MT  +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L    K
Sbjct: 2   MTGPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK 58

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPA-------- 111
             S    V                +      +      L  +    N             
Sbjct: 59  GFSLGSTVQSHTKGIWMWCVPHPKKP-GHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL 117

Query: 112 ----VYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVIL 167
               VY  I                          S            +  L   GQ + 
Sbjct: 118 SSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLT 177

Query: 168 ADEPTGALDSHSGEEV-MAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNP 225
            DE                    L               +  +   R       K+    
Sbjct: 178 PDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEE 237

Query: 226 PAEEKKREQGV 236
              E  ++   
Sbjct: 238 LDPEFVQQVAD 248


>2c03A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 295

 Score =  120 bits (302), Expect = 9e-30
 Identities = 35/253 (13%), Positives = 68/253 (26%), Gaps = 37/253 (14%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           + L  V  +      +    +     +    +  +VG+ GSGK+T    L    K     
Sbjct: 73  VILATVYEALK----EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   D          +L  E  G             + +                   
Sbjct: 129 PLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKAR----------- 177

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                      +  D      +G  Q    +   L    +V+  DE    LD+ +G+E +
Sbjct: 178 ----------LEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEAL 227

Query: 185 AILRQL-RDRGHTVIIVTHDPLIAAQ--AERIIEIHDGKIVHNPPAEEKKREQGVDAAVV 241
           ++ R      G T +++T     A    A     +    I     +E+ +  +       
Sbjct: 228 SVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYP--- 284

Query: 242 NTAPGWRQFASSF 254
                  + A   
Sbjct: 285 ------ERLAGRI 291


>1e98A [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score =  120 bits (300), Expect = 1e-29
 Identities = 15/211 (7%), Positives = 37/211 (17%), Gaps = 10/211 (4%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G ++ + GV  +GKST    L            +      + +         +     
Sbjct: 2   RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-------IGKLLSSY 54

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            Q+   +   +                                   V +  ++ +     
Sbjct: 55  LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW 114

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAE 211
                  L     V+                                +     L+     
Sbjct: 115 CKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF---QERALRCFHQLMKDTTL 171

Query: 212 RIIEIHDGKIVHNPPAEEKKREQGVDAAVVN 242
               +   K +     E +   +        
Sbjct: 172 NWKMVDASKRIEAVHEEIRVLSEDAIRTATE 202


>2b8tA [x.x.x] THYMIDINE KINASE
          Length = 206

 Score =  120 bits (300), Expect = 2e-29
 Identities = 19/209 (9%), Positives = 43/209 (20%), Gaps = 24/209 (11%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  I G   +GK+  +       +     Y V    + T          +   G    
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRN----IQSRTGTSLP 57

Query: 94  RYHLLSHLTAAQNVEIPAVYAGI-------------XXXXXXXXXXXXXXXXXXSDRVDY 140
              + S       +   +                                    S     
Sbjct: 58  SVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKN 117

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
              +  G   +  + A  +     +             +   +  I  +  D    ++ +
Sbjct: 118 FKGEPFGPIAKLFTYADKITKLTAICNECGAE------ATHSLRKIDGKHADYNDDIVKI 171

Query: 201 THDPLIAAQAERIIEIHDGKIVHNPPAEE 229
                 +A           +   N  +EE
Sbjct: 172 GCQEFYSAVCRHHH-KVPNRPYLNSNSEE 199


>1d1cA [c.37.1 - b.34.3] MYOSIN
          Length = 744

 Score =  119 bits (298), Expect = 2e-29
 Identities = 20/214 (9%), Positives = 49/214 (22%), Gaps = 3/214 (1%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
           V     L     + + I G SG+GK+     +       +G  +    +   L  + + +
Sbjct: 160 VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQANPILE 219

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
                     +  +        +     A +                     ++R  +  
Sbjct: 220 AFG--NAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIF 277

Query: 143 SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
            QL  G       A  L         ++          +     + +             
Sbjct: 278 YQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA-MDIVGFSQEE 336

Query: 203 DPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
              I      I+ + + K           +++  
Sbjct: 337 QMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTA 370



 Score = 62.9 bits (151), Expect = 2e-12
 Identities = 8/90 (8%), Positives = 22/90 (24%), Gaps = 1/90 (1%)

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDR 193
                    +    +Q    + +  ++  + I  +      DS+   E+++        +
Sbjct: 3   IHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFK 62

Query: 194 GHTVIIVTHDPLIAAQAERIIEIHDGKIVH 223
                        A Q   I       +  
Sbjct: 63  TVDGQDRQVKKDDANQRNPIKFDGVEDMSE 92


>2a30D [x.x.x] DEOXYCYTIDINE KINASE
          Length = 215

 Score =  119 bits (297), Expect = 3e-29
 Identities = 26/201 (12%), Positives = 50/201 (24%), Gaps = 12/201 (5%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRR--EHFGFI 91
            + ++I G   +GKST +NIL  L +          R  +    + L  +    E + F 
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
           FQ Y  LS + A                                   +   +        
Sbjct: 62  FQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDW 121

Query: 152 RVSIARALMNGGQVILADEPTGALD--------SHSGEEVMAILRQL-RDRGHTVIIVTH 202
             +     +    +I                  +      +  L +L       ++  T 
Sbjct: 122 MNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL 181

Query: 203 DP-LIAAQAERIIEIHDGKIV 222
                  Q   I+ +   +  
Sbjct: 182 KTNFDYLQEVPILTLDVNEYE 202


>3eiuA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 418

 Score =  119 bits (297), Expect = 3e-29
 Identities = 20/263 (7%), Positives = 48/263 (18%), Gaps = 40/263 (15%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                          +G        D +  +  G+ + I   SG   + +   +      
Sbjct: 90  AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASV 145

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYA------ 114
                  A    +    +   +  +       +   L   +      + PAV        
Sbjct: 146 PGSESAFAVVFAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRM 202

Query: 115 ---------------------GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                                 I                     +      + G +    
Sbjct: 203 ALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKGAKGSVT 262

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AER 212
            I    M G  +           +     V   L         +    +     ++    
Sbjct: 263 QIPILSMPGDDITHPIPDLSGYITEGQIVVAREL-----HRKGIYPPINVLPSLSRLMNS 317

Query: 213 IIEIHDGKIVHNPPAEEKKREQG 235
            I     +  H   +++      
Sbjct: 318 GIGAGKTREDHKAVSDQMYAGYA 340


>2cjwB [x.x.x] GTP-BINDING PROTEIN GEM
          Length = 170

 Score =  118 bits (297), Expect = 4e-29
 Identities = 22/187 (11%), Positives = 43/187 (22%), Gaps = 23/187 (12%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              V ++G  G GKSTL NI   ++     T  V G   + +       +   H      
Sbjct: 6   YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILL----DMWENHDHMQVG 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
             +L+ +    +     A    I                     +      +S G+   V
Sbjct: 62  DAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGRAAVV 121

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
              + +                        +    +    G    +            R+
Sbjct: 122 FDCKFIET-------------------SAAVQHNVKELFEGIVRQVRLRRDSKEKNERRL 162

Query: 214 IEIHDGK 220
                 +
Sbjct: 163 AYQKRKE 169


>2dr3E [x.x.x] UPF0273 PROTEIN PH0284
          Length = 236

 Score =  116 bits (291), Expect = 2e-28
 Identities = 25/219 (11%), Positives = 52/219 (23%), Gaps = 33/219 (15%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           +R   +G   V   + +   I    +V + G  G+GK+                      
Sbjct: 1   TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL 58

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
           +   +      +     FG+  + Y                                   
Sbjct: 59  EEHPVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK----------------- 97

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD---SHSGEEVMAIL 187
                             +   V          + ++ D  T       + +   ++ + 
Sbjct: 98  ----EYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLK 153

Query: 188 RQLRDRGHTVIIVTHD---PLIAAQAERIIEIHDGKIVH 223
           R L   G T I V+     P +    + II +   +I  
Sbjct: 154 RVLAGTGCTSIFVSQVSVGPGVEHGVDGIIRLDLDEIDG 192


>1e2dA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score =  115 bits (289), Expect = 3e-28
 Identities = 15/209 (7%), Positives = 41/209 (19%), Gaps = 10/209 (4%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G ++ + GV  +GKST    L            +      + +        +    ++ +
Sbjct: 3   GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI------GKLLSSYLQK 56

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
           +  +  H               +                  S        +       + 
Sbjct: 57  KSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQ 116

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
                      + L  +   A    +                   +     L+       
Sbjct: 117 PDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF----QERALRCFHQLMKDTTLNW 172

Query: 214 IEIHDGKIVHNPPAEEKKREQGVDAAVVN 242
             +   K +     + +   +   A    
Sbjct: 173 KMVDASKSIEAVHEDIRVLSEDAIATATE 201


>2bc9A [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 294

 Score =  115 bits (288), Expect = 3e-28
 Identities = 27/200 (13%), Positives = 49/200 (24%), Gaps = 21/200 (10%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L    K  S
Sbjct: 9   PMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS 65

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
               V                +  H   +     L          +       +      
Sbjct: 66  LGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV------ 119

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                            +  + +    QQ +     +      I +     +        
Sbjct: 120 ------------LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWT 167

Query: 183 VMAILRQLRDRGHTVIIVTH 202
           +      L   G  +    +
Sbjct: 168 LRDFSLDLEADGQPLTPDEY 187


>2cckA [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score =  115 bits (287), Expect = 5e-28
 Identities = 17/193 (8%), Positives = 33/193 (17%), Gaps = 23/193 (11%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQR 94
             +   G  GSGK+T++N +                       +    +  +        
Sbjct: 2   AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEAM 61

Query: 95  YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
               S         IPA+  G                       D         Q     
Sbjct: 62  LFAASRREHLVLKVIPALKEGK------------------VVLCDRYIDSSLAYQGYARG 103

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH----TVIIVTHDP-LIAAQ 209
           I    +        +     L  +          ++          +             
Sbjct: 104 IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEI 163

Query: 210 AERIIEIHDGKIV 222
                   D  + 
Sbjct: 164 IRFKSVNADQPLE 176


>1e9sF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score =  115 bits (287), Expect = 5e-28
 Identities = 25/225 (11%), Positives = 55/225 (24%), Gaps = 33/225 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 22  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 77

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 78  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--- 128

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 129 ----------------YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 172

Query: 180 GEEVMAILRQLRDR---GHTVIIVTHDPLIAAQAERIIEIHDGKI 221
               +A    LR          +       +        +   K+
Sbjct: 173 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKL 217


>3dm5A [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
          Length = 416

 Score =  114 bits (286), Expect = 7e-28
 Identities = 27/232 (11%), Positives = 54/232 (23%), Gaps = 25/232 (10%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
              +  +     +                   ++ +VG+ GSGK+T +  L    +    
Sbjct: 72  KEHIIKIVYEELTKFLGT--EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGY 129

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
              V   D          +   + +                    +              
Sbjct: 130 KVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK---------- 179

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEV 183
                      S  VD      +G  ++  ++   +     VI   E    +D   G++ 
Sbjct: 180 -----------SKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQA 228

Query: 184 MAILRQLRDR-GHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKRE 233
                  ++      IIVT     A            G  +      EK  +
Sbjct: 229 YNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDD 280


>1e9sG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score =  113 bits (282), Expect = 2e-27
 Identities = 25/226 (11%), Positives = 55/226 (24%), Gaps = 33/226 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 22  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 77

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 78  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRN--------- 122

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 123 ----------DYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 172

Query: 180 GEEVMAILRQLRDRGH---TVIIVTHDPLIAAQAERIIEIHDGKIV 222
               +A    LR          +       +        +   K+ 
Sbjct: 173 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLP 218


>2a2zA [x.x.x] DEOXYCYTIDINE KINASE
          Length = 222

 Score =  112 bits (281), Expect = 2e-27
 Identities = 20/206 (9%), Positives = 48/206 (23%), Gaps = 8/206 (3%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
            + ++I G   +GKST +NIL  L +          R  +    + L  +  +   + F 
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                        +                                    +     +   
Sbjct: 62  FQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDR-------YIFASNLYESECMNETEW 114

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH-TVIIVTHDPLIAAQAER 212
           +I +   +                +        L ++  RG      +  + L     + 
Sbjct: 115 TIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKH 174

Query: 213 IIEIHDGKIVHNPPAEEKKREQGVDA 238
              +    +  N    ++     +D 
Sbjct: 175 ESWLLHRTLKTNFDYLQEVPILTLDV 200


>1cr4A [c.37.1] DNA PRIMASE/HELICASE
          Length = 243

 Score =  112 bits (281), Expect = 2e-27
 Identities = 28/258 (10%), Positives = 67/258 (25%), Gaps = 28/258 (10%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            L    +V   +         + D +L    GE++ +   SG GKST +           
Sbjct: 8   HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G          +++  A   +   +   + Q   L   +      +              
Sbjct: 64  GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT--- 120

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                          +    ++    +            G  VI+ D  +      +   
Sbjct: 121 -------------FHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMT 167

Query: 183 VMAILRQLRDRGHTVIIVTHDP-----LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGV 236
            +      +  G  ++++ H        +   ++ II +   ++V           + G+
Sbjct: 168 KLKGFA--KSTGVVLVVICHLKDLRGGALRQLSDTIIALERNQLVLVRILKCRFTGDTGI 225

Query: 237 DAAVVNTAPGWRQFASSF 254
              +           SS+
Sbjct: 226 AGYMEYNKETGWLEPSSY 243


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score =  112 bits (280), Expect = 3e-27
 Identities = 37/250 (14%), Positives = 74/250 (29%), Gaps = 14/250 (5%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           A ++L+NV++++        V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TS
Sbjct: 1   ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G   +  + ++   P    +                     A       +          
Sbjct: 57  GDLFIGEKRMNDTPPA---ERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG 113

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILAD-----EPTGALDS 177
                       +  +      L  G+  +V     L +                  L  
Sbjct: 114 RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPV 173

Query: 178 HSGEEVMAILRQLRDRGH-TVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQG 235
                 +  ++      +   + +  +       A   + I    ++ +  A+     + 
Sbjct: 174 KVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEV 233

Query: 236 VDAAVVNTAP 245
                +    
Sbjct: 234 QVVEQLGNET 243


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score =  112 bits (280), Expect = 3e-27
 Identities = 52/229 (22%), Positives = 95/229 (41%), Gaps = 11/229 (4%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           + A ++L N+ + +         +KD+SL+I  GE + ++G SG GK+T + I G  +  
Sbjct: 1   IGAEVKLINIWKRFGDVT----AVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPT 56

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
               Y          DP+    +  +       + + L   T   N+    +        
Sbjct: 57  RGQIYIEDNLVA---DPEKGVFVPPKERDVAVFQSYALYPHTVYDNI-AFPLKLRKVPKQ 112

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         ++ ++  P +LSGGQ+QRV++ RA++     +  DEP   LD+   
Sbjct: 113 EIDKRVREVAELGLTELLNRKPRELSGGQRQRVALGRAII-RRPKVFLDEPLSNLDAKLR 171

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
            +   + +  R  G T I VTHD + A      I ++ G++      +E
Sbjct: 172 VKRAELKKLQRQLGVTTIYVTHDQVEA--TGDRIAVNKGELQQVGTPDE 218


>3d3kA [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
          Length = 233

 Score =  112 bits (280), Expect = 3e-27
 Identities = 22/213 (10%), Positives = 47/213 (22%), Gaps = 6/213 (2%)

Query: 12  RSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRD 71
            S      +  +       +     + + GV  S  +  +                    
Sbjct: 20  PSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKGA 79

Query: 72  VSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXX 131
                   LA    +   F+     +L  +T   ++        +               
Sbjct: 80  QGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQV---SSLKDLPTSPVD 136

Query: 132 XXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR 191
              +         L      + ++A A  N   V+  D P   +D+     +   L    
Sbjct: 137 LVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVH-IDAKWSLALGLPLPLGE 195

Query: 192 DRGHTVIIVTHDP-LIAAQAERIIEIHD-GKIV 222
             G   +     P  +  +           K V
Sbjct: 196 HAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFV 228


>1e9rA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 420

 Score =  112 bits (279), Expect = 4e-27
 Identities = 22/225 (9%), Positives = 50/225 (22%), Gaps = 12/225 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAG-EMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 20  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 75

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 76  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL 129

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                          S                     R L +   +   D+  G L+   
Sbjct: 130 SVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTL 189

Query: 180 GEEVMAILRQLR-DRGHTVIIVTHDPLIAAQAERIIEIHDGKIVH 223
            E + A   +          +++                   +  
Sbjct: 190 AESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLED 234


>3bb1B [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 243

 Score =  111 bits (278), Expect = 5e-27
 Identities = 23/242 (9%), Positives = 61/242 (25%), Gaps = 4/242 (1%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 3   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 60

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
             ++   R V      A   L       + +  ++           +      +      
Sbjct: 61  SPFQSGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDR 120

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                         +            +  V++  A  +    +  DE          + 
Sbjct: 121 LDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQV 180

Query: 183 VMAILRQLRDRGHTVIIVTH-DPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG-VDAAV 240
           V +      D    +I  +             I      +         K E   VD  +
Sbjct: 181 VRSGASLASDIPVVLIENSGRCNSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNL 240

Query: 241 VN 242
           ++
Sbjct: 241 ID 242


>3b2qA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 436

 Score =  111 bits (278), Expect = 5e-27
 Identities = 26/275 (9%), Positives = 63/275 (22%), Gaps = 14/275 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                          +G        D +  +  G+ + I   SG   + +   +      
Sbjct: 93  AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASV 148

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEI-PAVYAGIXXX 119
                  A    +    +       ++F   F++   L       N+   PAV   +   
Sbjct: 149 PGSESAFAVVFAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPR 204

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             V            +++  AR  +               D  +
Sbjct: 205 MALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEV---PGRRGYPGYMYTDLAT 261

Query: 180 GEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
             E   I++  +     + I++            +  +  +       E     +G+   
Sbjct: 262 LYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH--RKGIYPP 319

Query: 240 VVNTAPGWRQFASSFREALSMAWLAMAANKMRTLL 274
           +       R   S      +       +++M    
Sbjct: 320 INVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY 354


>1e9dA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score =  110 bits (276), Expect = 9e-27
 Identities = 15/205 (7%), Positives = 39/205 (19%), Gaps = 12/205 (5%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G ++ + GV  +GKST    L            +      + +         +     
Sbjct: 2   RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-------IGKLLSSY 54

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            Q+   +   +                                   V Y  ++ +     
Sbjct: 55  LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDW 114

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQA 210
                  L     V+                      +  +       +     L+    
Sbjct: 115 CKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE----RYENGAFQERALRCFHQLMKDTT 170

Query: 211 ERIIEIHDGKIVHNPPAEEKKREQG 235
                +   K +     + +   + 
Sbjct: 171 LNWKMVDASKSIEAVHEDIRVLSED 195


>3b85A [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
          Length = 180

 Score =  110 bits (276), Expect = 1e-26
 Identities = 19/173 (10%), Positives = 39/173 (22%), Gaps = 4/173 (2%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
             K     I    +V  +G +GSGK+ L        +    +  +  R            
Sbjct: 8   GQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFL 67

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
               +   +      +        +E   V                       +      
Sbjct: 68  PGDPYLRPLHDALRDV-EPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQK 126

Query: 143 SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM--AILRQLRDR 193
                G   +V     L    + IL           +  +V+   ++  + D 
Sbjct: 127 FLTRLGFGSKVVTGDGLRL-VRHILRGVDDVHFSELTSSDVVRHQLVGHIVDA 178


>3bpbA [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
          Length = 254

 Score =  110 bits (274), Expect = 1e-26
 Identities = 20/239 (8%), Positives = 59/239 (24%), Gaps = 14/239 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSG---SGKSTLMNILGCLDKPTS 62
             R  +RS   G    + L          +  A +          + L       D    
Sbjct: 6   IARTPARSLVDGLT-SSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVFV 64

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
               +     + +        R E                             I      
Sbjct: 65  EDPVLCTSRCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDH 124

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                       S R +   ++      ++  ++ +++   +V+        L+ ++   
Sbjct: 125 FYIGE-------SARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLA 177

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVV 241
               + +   +   +I +  +    + A   I +++  I+       +++   +   V+
Sbjct: 178 AGEFVSKPEFQDFNIIEIPEEE---SYAANCIWVNERVIMPAGYPRTREKIARLGYRVI 233


>2c9oC [x.x.x] RUVB-LIKE 1
          Length = 311

 Score =  109 bits (271), Expect = 3e-26
 Identities = 32/263 (12%), Positives = 65/263 (24%), Gaps = 13/263 (4%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
               +     + E    +++ I  +  AG  V + G  G+GK+ L   +           
Sbjct: 29  AASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFC 88

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV---EIPAVYAGIXXXXXX 122
            + G +V + +                +   L    T  + +                  
Sbjct: 89  PMVGSEVYSTEIKK----TEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKV 144

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                          V +         +    + RAL +    I+            G E
Sbjct: 145 VNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTE 204

Query: 183 VMAILRQLR-DRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVV 241
            +     +  D    V+I+        + ++II+I       N   E       +     
Sbjct: 205 DITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGT--- 261

Query: 242 NTAPGWRQFASSFREALSMAWLA 264
                 R        A  +A + 
Sbjct: 262 --KTTLRYSVQLLTPANLLAKIN 282


>2cgtH [x.x.x] 60 KDA GROEL
          Length = 515

 Score =  108 bits (271), Expect = 4e-26
 Identities = 18/233 (7%), Positives = 44/233 (18%), Gaps = 24/233 (10%)

Query: 21  VAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDA 79
           V+V ++I L+         +V    S  +             +      G        + 
Sbjct: 53  VSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNP 112

Query: 80  LAQLR---------------------REHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
           +   R                                   S  T  + +       G   
Sbjct: 113 MDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEG 172

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                            + + +    LS     +       +    ++LAD+    +   
Sbjct: 173 VITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREM 232

Query: 179 SGEEVMAILRQL-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
                               +       +       I+++   K        +
Sbjct: 233 LPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRK 285


>2c04A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 297

 Score =  108 bits (269), Expect = 6e-26
 Identities = 33/237 (13%), Positives = 66/237 (27%), Gaps = 28/237 (11%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           + L  V  +           +     +    +  +VG+ GSGK+T    L    K     
Sbjct: 73  VILATVYEALKEAL----GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   D          +L  E  G             + +                   
Sbjct: 129 PLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKAR----------- 177

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                      +  D      +G  Q    +   L    +V+  DE    LD+ +G+E +
Sbjct: 178 ----------LEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEAL 227

Query: 185 AILRQLRDRGH-TVIIVTHDPLIAAQ--AERIIEIHDGKIVHNPPAEEKKREQGVDA 238
           ++ R   ++   T +++T     A    A     +    I     +E+ +  +    
Sbjct: 228 SVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYP 284


>2b92B [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 290

 Score =  107 bits (268), Expect = 7e-26
 Identities = 30/249 (12%), Positives = 56/249 (22%), Gaps = 18/249 (7%)

Query: 1   MTA-LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDK 59
           MT  +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L    K
Sbjct: 2   MTGPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK 58

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPA-------- 111
             S    V                +  H   +     L          +           
Sbjct: 59  GFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLS 118

Query: 112 -VYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADE 170
             +                             S         V   R      +      
Sbjct: 119 STFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSFVSFFPDFVWTLRDFSLDLEADGQPL 178

Query: 171 PTGALDSHSGEEVMAIL----RQLRDRGHTVIIVTH-DPLIAAQAERIIEIHDGKIVHNP 225
                 ++S +               R             +  +     ++   + + + 
Sbjct: 179 TPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDE 238

Query: 226 PAEEKKREQ 234
             + +  +Q
Sbjct: 239 ELDPEFVQQ 247


>2a5gA [x.x.x] ADP-RIBOSYLATION FACTOR 6
          Length = 162

 Score =  106 bits (266), Expect = 1e-25
 Identities = 14/160 (8%), Positives = 31/160 (19%), Gaps = 3/160 (1%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              + ++G+  +GK+T++  L      T+        +  T                I  
Sbjct: 2   EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRP 61

Query: 94  ---RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
               Y+  +                                                 + 
Sbjct: 62  LWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKP 121

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
             +     L          +P+ A       E +  L   
Sbjct: 122 HEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 161


>2c61A [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
          Length = 431

 Score =  106 bits (265), Expect = 2e-25
 Identities = 22/276 (7%), Positives = 59/276 (21%), Gaps = 12/276 (4%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                          +G        D +  +  G+ + I   SG   + +   +      
Sbjct: 89  AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASV 144

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                  A    +    +   +  +       +   L   +      + PAV   +    
Sbjct: 145 PGSESAFAVVFAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRM 201

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                            V            +++  AR  + G +       T     +  
Sbjct: 202 ALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYER 261

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAV 240
             ++   +    +   + +   D                 +V       +   +G+   +
Sbjct: 262 AGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV-----ARELHRKGIYPPI 316

Query: 241 VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTM 276
                  R   S      +       +++M      
Sbjct: 317 NVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYAE 352


>1aroP [e.8.1] T7 RNA POLYMERASE
          Length = 774

 Score =  106 bits (265), Expect = 2e-25
 Identities = 6/88 (6%), Positives = 23/88 (26%), Gaps = 1/88 (1%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH 195
           +  +   ++     ++++ I   L      I                    L++++    
Sbjct: 35  ESYEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAV 94

Query: 196 TVIIVTHDP-LIAAQAERIIEIHDGKIV 222
             I +      + +     ++     I 
Sbjct: 95  AYITIKTTLACLTSADNTTVQAVASAIG 122



 Score = 34.4 bits (78), Expect = 0.001
 Identities = 9/79 (11%), Positives = 18/79 (22%), Gaps = 3/79 (3%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVI 198
           D          +  +  A    N   +                 V     Q  D    ++
Sbjct: 305 DKARKSRRISLEFMLEQANKFANHKAIWFPYNMDW---RGRVYAVSMFNPQGNDMTKGLL 361

Query: 199 IVTHDPLIAAQAERIIEIH 217
            +     I  +    ++IH
Sbjct: 362 TLAKGKPIGKEGYYWLKIH 380


>2c9yA [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
          Length = 218

 Score =  106 bits (264), Expect = 2e-25
 Identities = 20/224 (8%), Positives = 41/224 (18%), Gaps = 8/224 (3%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G    ++G  G+GK T    L               R +     +   +L+         
Sbjct: 1   GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV 60

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
              ++  L              +                    R +   S +       +
Sbjct: 61  SDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSL 120

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
            I R                  +         I  +   R  +        +        
Sbjct: 121 LIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIR-RSDDNEKALKIRLQAYHTQ 179

Query: 214 IEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREA 257
                               Q  D         +    ++F +A
Sbjct: 180 TTPLIEYYRKRGIHSAIDASQTPDVV-------FASILAAFSKA 216


>2d4hB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 284

 Score =  105 bits (263), Expect = 3e-25
 Identities = 28/284 (9%), Positives = 55/284 (19%), Gaps = 51/284 (17%)

Query: 1   MTA-LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMN------- 52
           MT  +  + N +    +  E + +L  I+       +VAIVG+  +GKS LMN       
Sbjct: 2   MTGPMCLIENTNGRLMANPEALKILSAITQP---MVVVAIVGLYRTGKSYLMNKLAGKKK 58

Query: 53  ---------ILGCLDKPTSGTYRVAGRDVSTLDPDALAQL--RREHFGFIFQRYHLLSHL 101
                     + C+  P    + +   D   L  +                       + 
Sbjct: 59  GFSLGSKGIWMWCVPHPKKPGHILVLLDTEGLGQNDSWIFALAVLLSSTFVYNSIGTINQ 118

Query: 102 TAAQNVEIPAVYAGI--XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARAL 159
            A   +                             + R      +  G            
Sbjct: 119 QAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYS 178

Query: 160 ------------------------MNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH 195
                                       +  + D P         E++            
Sbjct: 179 LKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQ 238

Query: 196 TVIIVTHDP---LIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
                ++          +  I                      +
Sbjct: 239 VADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDL 282


>3b2qB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 431

 Score =  105 bits (263), Expect = 3e-25
 Identities = 20/254 (7%), Positives = 48/254 (18%), Gaps = 43/254 (16%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
                    +G        D +  +  G+ + I   SG   + +   +            
Sbjct: 100 RLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESA 155

Query: 67  VAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG----------- 115
            A    +    +       ++F   F++   L       N+                   
Sbjct: 156 FAVVFAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAA 211

Query: 116 --------------------IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSI 155
                                                     +      + G +     I
Sbjct: 212 EYLAYEHGMHVLVILTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKGAKGSVTQI 271

Query: 156 ARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIE 215
               M G  +           +     V     +   R      +   P ++      I 
Sbjct: 272 PILSMPGDDITHPIPDLSGYITEGQIVVA----RELHRKGIYPPINVLPSLSRLMNSGIG 327

Query: 216 IHDGKIVHNPPAEE 229
               +  H   +++
Sbjct: 328 AGKTREDHKAVSDQ 341


>1ai4B [d.153.1] PENICILLIN AMIDOHYDROLASE
          Length = 557

 Score =  105 bits (263), Expect = 3e-25
 Identities = 23/256 (8%), Positives = 62/256 (24%), Gaps = 19/256 (7%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                  +  ++++    +Q A  + +++  +  ++   +G   +G             P
Sbjct: 150 SLLAWTHQMKAKNWQQWTQQAAK-QALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLP 208

Query: 61  TSGTYRVAGRDVSTLDP---------------DALAQLRREHFGFIFQRYHLLSHLTAAQ 105
             GT +   + +   +                +   Q            +     +T   
Sbjct: 209 VPGTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADRVTEID 268

Query: 106 NVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDR--VDYPPSQLSGGQQQRVSIARALMNGG 163
            +                                +    S L+    +R  +       G
Sbjct: 269 RLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDG 328

Query: 164 QVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIV 222
             +L D+        S    + +   L+      + +  D   +A   E   +   G + 
Sbjct: 329 INLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPTGSLN 388

Query: 223 HNPPAEEKKREQGVDA 238
            +  A+        D 
Sbjct: 389 ISVGAKILYEAVQGDK 404


>3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 159

 Score =  105 bits (263), Expect = 3e-25
 Identities = 15/154 (9%), Positives = 32/154 (20%), Gaps = 1/154 (0%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           VA+ G    GK++L N L    +  +    V       +       +             
Sbjct: 5   VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINL-IDLPGTYSLG 63

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
             S         +    A +                            L+          
Sbjct: 64  YSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKI 123

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
                   + +    T ++     EE+   + + 
Sbjct: 124 DRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY 157


>3cr7C [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 178

 Score =  105 bits (263), Expect = 3e-25
 Identities = 22/179 (12%), Positives = 34/179 (18%), Gaps = 19/179 (10%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G  + + G+S SGKSTL   L          +       +            E     
Sbjct: 1   QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNE 60

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS---------------- 135
             R         A +  I                                          
Sbjct: 61  NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQR 120

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
           D          G  ++   I+                  L     + V  I+  L  +G
Sbjct: 121 DPKGLYKKAREGVIKEFTGISAPYEA-PANPEVHVKNYELPVQ--DAVKQIIDYLDTKG 176


>2bdtA [x.x.x] BH3686
          Length = 170

 Score =  105 bits (262), Expect = 4e-25
 Identities = 18/169 (10%), Positives = 40/169 (23%), Gaps = 7/169 (4%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDA-----LAQLRREHFG 89
           ++  I G +G GKST    L      ++         V            L  L  ++  
Sbjct: 2   KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPPWESDELLALTWKNIT 61

Query: 90  FIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
            +   + L  +      +  P     +                      +    + +  +
Sbjct: 62  DLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRK 121

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVI 198
           +    +        +    DE      SH     +  + +        I
Sbjct: 122 KGERCLELVEEF--ESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI 168


>2axzC [x.x.x] PRGX
          Length = 275

 Score =  104 bits (261), Expect = 6e-25
 Identities = 9/94 (9%), Positives = 23/94 (24%), Gaps = 6/94 (6%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-- 193
           + ++  P +      +   I  +      + +      AL       +      +     
Sbjct: 151 NLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEH 210

Query: 194 ----GHTVIIVTHDPLIAAQAERIIEIHDGKIVH 223
                +  I   +D  I    +    + D  I  
Sbjct: 211 LKTIKNISINGYYDLEINYLKQIYQFLTDKNIDS 244


>1e9sD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 417

 Score =  104 bits (259), Expect = 9e-25
 Identities = 24/228 (10%), Positives = 54/228 (23%), Gaps = 34/228 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 17  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 72

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 73  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY-- 124

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 125 -----------------ALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 167

Query: 180 GEEVMAILR---QLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVH 223
               +A         +      +       +         + D    H
Sbjct: 168 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEH 215


>1bg0A [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
          Length = 356

 Score =  103 bits (257), Expect = 2e-24
 Identities = 23/237 (9%), Positives = 51/237 (21%), Gaps = 10/237 (4%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           +T  +     ++    G     +    S   +    V I         T   +   +   
Sbjct: 30  LTKDVFDSIKNKKTGMG--ATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDD 87

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
             G +++  +       D    +  +  G       +    +       P + A      
Sbjct: 88  YHGGFKLTDKHPPKQWGDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEM 147

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                              YP + +S   QQ++     L   G   L             
Sbjct: 148 EEKVSSTLSSMEDELKGTYYPLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGR 207

Query: 181 EEVMAILRQL----RDRGHTVIIVTHDPLIAAQ----AERIIEIHDGKIVHNPPAEE 229
                  +       +  H  II                  ++  + K+  +     
Sbjct: 208 GIFHNDAKTFLVWVNEEDHLRIISMQKGGDLKTVYKRLVTAVDNIESKLPFSHDDRF 264


>2a30B [x.x.x] DEOXYCYTIDINE KINASE
          Length = 212

 Score =  103 bits (256), Expect = 2e-24
 Identities = 26/201 (12%), Positives = 49/201 (24%), Gaps = 15/201 (7%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
            + ++I G   +GKST +NIL     P         +  + L        + E + F FQ
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMM---YEKPERWSFTFQ 58

Query: 94  RYHLLSHLTAAQNVEIPAVYAG--IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            Y  LS + A       A                             +   +        
Sbjct: 59  TYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDW 118

Query: 152 RVSIARALMNGGQVILADEPTGAL--------DSHSGEEVMAILRQL-RDRGHTVIIVTH 202
             +     +    +I                  +      +  L +L       ++  T 
Sbjct: 119 MNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL 178

Query: 203 DP-LIAAQAERIIEIHDGKIV 222
                  Q   I+ +   +  
Sbjct: 179 KTNFDYLQEVPILTLDVNEYE 199


>1e2fA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score =  103 bits (256), Expect = 2e-24
 Identities = 15/191 (7%), Positives = 35/191 (18%), Gaps = 10/191 (5%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G ++ + GV  +GKST    L            +      + +         +     
Sbjct: 2   RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-------IGKLLSSY 54

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            Q+   +   +                                   V +  ++ +     
Sbjct: 55  LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW 114

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAE 211
                  L     V+                     R          +     L+     
Sbjct: 115 CKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE---RYENGAFQERALRCFHQLMKDTTL 171

Query: 212 RIIEIHDGKIV 222
               +   K +
Sbjct: 172 NWKMVDASKSI 182


>3dt4A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 619

 Score =  102 bits (253), Expect = 3e-24
 Identities = 24/273 (8%), Positives = 54/273 (19%), Gaps = 19/273 (6%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
              L + +          +  ++  I+      + +A    S  GK+ L  +   L    
Sbjct: 242 CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWK 301

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXX 121
                     +       L  +  E+  F        S  T    ++             
Sbjct: 302 VECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGT--SVKTNPNAIKTIQKNTIFTNVAE 359

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                                +     + +            +          +D     
Sbjct: 360 TSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWES 419

Query: 182 EVMAILRQ-----LRDRGHTVIIVTHDPLIA---AQAER----IIEIHDGKIVHNPPAEE 229
                +        R  G  ++              A R        H GK++ + P   
Sbjct: 420 PEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPFAM 479

Query: 230 KKREQGVDAAVVNTAPGWRQFASSFREALSMAW 262
           +                    + + R A  +  
Sbjct: 480 RPFFGYNFGKY-----LAHWLSMAHRPAAKLPK 507


>2ctsA [x.x.x] CITRATE SYNTHASE
          Length = 437

 Score =  101 bits (252), Expect = 5e-24
 Identities = 14/163 (8%), Positives = 32/163 (19%), Gaps = 10/163 (6%)

Query: 13  SYPSGEEQVAVLKDIS--LQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           +  +  + +  L D+    Q          G +  G+ T+  + G +       Y  +  
Sbjct: 1   ASSTNLKDI--LADLIPKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVL 58

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG----IXXXXXXXXXX 126
           D           +       +  +              +                     
Sbjct: 59  DPDEGIRFRGYSIPE--CQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAK 116

Query: 127 XXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILAD 169
                      +D  P+ L    Q   +I              
Sbjct: 117 RAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYA 159


>3bb1E [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 248

 Score =  100 bits (250), Expect = 9e-24
 Identities = 15/241 (6%), Positives = 56/241 (23%), Gaps = 4/241 (1%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 3   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 60

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI-XXXXX 121
             ++  G     +                      ++ +                     
Sbjct: 61  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVD 120

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                          +            +  V++  A  +    +  DE          +
Sbjct: 121 RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ 180

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE-KKREQGVDAAV 240
            V +     +     V+++ +             + +G        +   +       ++
Sbjct: 181 VVRSGASLKKASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSESI 240

Query: 241 V 241
            
Sbjct: 241 F 241


>3dt2A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 621

 Score =  100 bits (249), Expect = 1e-23
 Identities = 18/255 (7%), Positives = 45/255 (17%), Gaps = 20/255 (7%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
              L + +          +  ++  I+      + +A    S  GK+ L  +   L    
Sbjct: 244 CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWK 303

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---IXX 118
                     +                      + +    +   N               
Sbjct: 304 VECVGDDIAWMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN 358

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                                   +     + +            +          +D  
Sbjct: 359 VAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPA 418

Query: 179 SGEEVMAILRQ-----LRDRGHTVIIVTHDPLIA---AQAER----IIEIHDGKIVHNPP 226
                   +        R  G  ++              A R        H GK++ + P
Sbjct: 419 WESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDP 478

Query: 227 AEEKKREQGVDAAVV 241
              +          +
Sbjct: 479 FAMRPFFGYNFGKYL 493


>421pA [x.x.x] H-RAS P21 PROTEIN
          Length = 166

 Score =  100 bits (249), Expect = 1e-23
 Identities = 20/160 (12%), Positives = 33/160 (20%), Gaps = 3/160 (1%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              + +VG  G GKS L   L            +       +  D    L         +
Sbjct: 3   EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQE 62

Query: 94  RYH---LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
            Y         T    + + A+                       D              
Sbjct: 63  EYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAA 122

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
           + V   +A        +    T A      E+    L + 
Sbjct: 123 RTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE 162


>3d7wA [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
          Length = 249

 Score =  100 bits (249), Expect = 1e-23
 Identities = 23/235 (9%), Positives = 58/235 (24%), Gaps = 36/235 (15%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
            + + S S         +L+  ++ +  G+   +V ++ +G  T+   +   +       
Sbjct: 27  YVSSGSFSNNIP-----LLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYE 81

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXX 125
                   +  P               Q ++               +  GI         
Sbjct: 82  AGNQSYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIPLGI--------- 132

Query: 126 XXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMA 185
                     D++    + L     Q  + AR       + +  E            ++ 
Sbjct: 133 ----------DQLIQSVTALRFPGGQTKTQAR--SILILIQMISEAARFNP------ILW 174

Query: 186 ILRQLRDRGHTVIIVTHD----PLIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
             RQ  + G + +   +          Q+ ++    DG   +             
Sbjct: 175 RARQYINSGASFLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIALAIAPGVIVT 229


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score =  100 bits (248), Expect = 2e-23
 Identities = 46/253 (18%), Positives = 87/253 (34%), Gaps = 23/253 (9%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
              V  +  +      VLKDI+ +I  G+++A+ G +G+GK++L+ ++    +P+ G  +
Sbjct: 2   TEVVMENVTAFW----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 57

Query: 67  VAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXX 126
            +GR         +     +                         +              
Sbjct: 58  HSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKF----------- 106

Query: 127 XXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAI 186
                    D +      LSGGQ+ R+S+ARA+     + L D P G LD  + +E+   
Sbjct: 107 ------AEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 160

Query: 187 LRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPG 246
                    T I+VT       +A++I+ +H+G         E +  +            
Sbjct: 161 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFSA--ER 218

Query: 247 WRQFASSFREALS 259
                +      S
Sbjct: 219 RNSILTETLHRFS 231


>1e4yA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score =  100 bits (248), Expect = 2e-23
 Identities = 17/200 (8%), Positives = 40/200 (20%), Gaps = 26/200 (13%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G   +GK T    +         +     R       +   Q +            
Sbjct: 3   IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDE 62

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           L+  L   +  +                            R  +          Q  ++ 
Sbjct: 63  LVIALVKERIAQED-------------------------CRNGFLLDGFPRTIPQADAMK 97

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEI 216
            A +N   V+  D P   +        +                  +       E +   
Sbjct: 98  EAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVK-FNPPKVEGKDDVTGEELTTR 156

Query: 217 HDGKIVHNPPAEEKKREQGV 236
            D +         +  +   
Sbjct: 157 KDDQEETVRKRLVEYHQMTA 176


>1dg3A [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
           GUANYLATE-BINDING
          Length = 540

 Score =  100 bits (248), Expect = 2e-23
 Identities = 28/229 (12%), Positives = 48/229 (20%), Gaps = 14/229 (6%)

Query: 1   MT-ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDK 59
           MT  +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L     
Sbjct: 2   MTGPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKH 58

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEI-----PAVYA 114
                                     +  G          + +    + +         +
Sbjct: 59  TKGIWMWCVPHPKKPGHILV----LLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNS 114

Query: 115 GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                 R     +         V   R      Q +  DE    
Sbjct: 115 IGTINQQAMDQLYYVTELTHRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTY 174

Query: 175 LDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVH 223
                             R   +               + E+    +  
Sbjct: 175 SLKLKKGTSQKDETFNLPRLC-IRKFFPKKKCFVFDRPVHELDPEFVQQ 222


>2d4hA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 299

 Score = 99.5 bits (246), Expect = 2e-23
 Identities = 31/240 (12%), Positives = 51/240 (21%), Gaps = 24/240 (10%)

Query: 1   MTA-LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDK 59
           MT  +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L    K
Sbjct: 3   MTGPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK 59

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---- 115
             S    V         P      +  H   +     L        +             
Sbjct: 60  GFSLGSTVQKGIWMWCVPH---PKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTF 116

Query: 116 -IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                                 VS     +   +    D     
Sbjct: 117 VYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADG 176

Query: 175 LDSHSGEEVMAIL------------RQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
                 E +   L              L               +  +     ++   + +
Sbjct: 177 QPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKL 236


>1e9sJ [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 99.0 bits (245), Expect = 4e-23
 Identities = 26/228 (11%), Positives = 55/228 (24%), Gaps = 34/228 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 22  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 77

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 78  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRND-------- 123

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 124 -----------YDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 172

Query: 180 GEEVMAILRQLRD---RGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVH 223
               +A    LR          +       +         + D    H
Sbjct: 173 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEH 220


>1dkiA [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
          Length = 303

 Score = 98.6 bits (244), Expect = 5e-23
 Identities = 19/222 (8%), Positives = 45/222 (20%), Gaps = 21/222 (9%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           + +LL+ + +  +  +    +       ++      V     +GS  +    I+   + P
Sbjct: 70  VKSLLDSKGIHYNQGNPYN-LLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYP 128

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
             G         S             H   +F       +             + +    
Sbjct: 129 NKGLKDYTYTLSSNNPY-------FNHPKNLFAAISTRQYNWNNILPTYSGRESNV--QK 179

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                                       + QR        N     +           S 
Sbjct: 180 MAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQSVHQINRGDF------SK 233

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
           ++  A + +   +   V                  + DG   
Sbjct: 234 QDWEAQIDKELSQNQPVYYQGVG----KVGGHAF-VIDGADG 270


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score = 98.3 bits (243), Expect = 6e-23
 Identities = 61/236 (25%), Positives = 103/236 (43%), Gaps = 12/236 (5%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           A ++L+NV++++        V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TS
Sbjct: 1   ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G   +  + ++   P             ++    +  +++    +               
Sbjct: 57  GDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                       +  +D  P  LSGGQ+QRV+I R L+    V L DEP   LD+    +
Sbjct: 117 AEVLQL------AHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQ 170

Query: 183 VMAILRQL-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGV 236
           +   + +L +  G T+I VTHD + A   A++I+ +  G++       E       
Sbjct: 171 MRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD 226



 Score = 41.7 bits (96), Expect = 6e-06
 Identities = 6/62 (9%), Positives = 12/62 (19%), Gaps = 3/62 (4%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G    I     S +  L+     +     G     G            +        +
Sbjct: 308 QLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPE--RCHLFREDGT-ACRRL 364

Query: 92  FQ 93
            +
Sbjct: 365 HK 366


>2axpA [x.x.x] HYPOTHETICAL PROTEIN BSU20280
          Length = 171

 Score = 98.2 bits (243), Expect = 6e-23
 Identities = 16/163 (9%), Positives = 37/163 (22%), Gaps = 11/163 (6%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRY 95
           ++ + G     KST+   L    K             S  +       +      +    
Sbjct: 2   LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDR 61

Query: 96  HLLSHLTAAQNVEIPAVY--------AGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSG 147
            + S+L  A+  +  ++                                        + G
Sbjct: 62  FVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEG 121

Query: 148 GQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
                +      ++   +      TG   S   +E+   +  L
Sbjct: 122 KDIDSILELYREVSNAGLHTYSWDTGQWSS---DEIAKDIIFL 161


>2b8tB [x.x.x] THYMIDINE KINASE
          Length = 189

 Score = 97.8 bits (242), Expect = 8e-23
 Identities = 16/199 (8%), Positives = 37/199 (18%), Gaps = 13/199 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  I G   +GK+  +       +     Y V    +        A     +      
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVEVESAPEILNYIMSNSF 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                              +                     S        +  G   +  
Sbjct: 62  NDETKVI------GIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLF 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
           + A  +     +                  +  +       +  I+        +   R 
Sbjct: 116 TYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCRH 168

Query: 214 IEIHDGKIVHNPPAEEKKR 232
                 +   N  +EE  +
Sbjct: 169 HHKVPNRPYLNSNSEEFIK 187


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score = 97.7 bits (241), Expect = 9e-23
 Identities = 70/228 (30%), Positives = 121/228 (53%), Gaps = 3/228 (1%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +++L N+++ +  G   +  L ++SL + AG++  ++G SG+GKSTL+  +  L++PT G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
           +  V G++++TL    L +  R   G IFQ ++LLS  T   NV +P             
Sbjct: 61  SVLVDGQELTTLSESELTK-ARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKR 119

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE-E 182
                       D+ D  PS LSGGQ+QRV+IARAL +  +V+L DE T ALD  +    
Sbjct: 120 RVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSI 179

Query: 183 VMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
           +  +    R  G T++++TH+  ++    + +  I +G+++      E
Sbjct: 180 LELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSE 227


>2dr3B [x.x.x] UPF0273 PROTEIN PH0284
          Length = 240

 Score = 97.1 bits (240), Expect = 1e-22
 Identities = 22/234 (9%), Positives = 50/234 (21%), Gaps = 35/234 (14%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           +R   +G     V + +   I    +V + G  G+GK+                      
Sbjct: 1   TRRVKTGI--PGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL 58

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
           +   +                 ++            +                       
Sbjct: 59  EEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK-------------------- 98

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILR-- 188
                             +   V          + ++ D  T    +        IL+  
Sbjct: 99  --------YIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLK 150

Query: 189 -QLRDRGHTVIIVTHDPLIAAQA--ERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
             L   G T I V+   +         +    DG I  +    + + ++ +   
Sbjct: 151 RVLAGTGCTSIFVSQVSVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVW 204


>3cr7A [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 179

 Score = 96.9 bits (240), Expect = 1e-22
 Identities = 21/181 (11%), Positives = 36/181 (19%), Gaps = 21/181 (11%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G  + + G+S SGKSTL   L          +       +            E       
Sbjct: 2   GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENI 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS----------------DR 137
           R         A +  I                                          D 
Sbjct: 62  RRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQRDP 121

Query: 138 VDYPPSQLSGGQQQRVSIARALMNGG-QVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
                    G  ++   I+          +        +     + V  I+  L  +G+ 
Sbjct: 122 KGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQ----DAVKQIIDYLDTKGYL 177

Query: 197 V 197
            
Sbjct: 178 P 178


>2b8tC [x.x.x] THYMIDINE KINASE
          Length = 199

 Score = 96.7 bits (239), Expect = 2e-22
 Identities = 19/199 (9%), Positives = 48/199 (24%), Gaps = 7/199 (3%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  I G   +GK+  +       +     Y V    + +    +L  +  E    I  
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLPSVEVESAPEILN 61

Query: 94  RYHLLSHLTAAQNV-EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQR 152
                S     + +      +                     S        +  G   + 
Sbjct: 62  YIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKL 121

Query: 153 VSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAER 212
            + A  +     +                 +  I  +  D    ++ +      +A    
Sbjct: 122 FTYADKITKLTAICNECGAEATHS------LRKIDGKHADYNDDIVKIGCQEFYSAVCRH 175

Query: 213 IIEIHDGKIVHNPPAEEKK 231
             ++ +   +++   E  K
Sbjct: 176 HHKVPNRPYLNSNSEEFIK 194


>2a5jA [x.x.x] RAS-RELATED PROTEIN RAB-2B
          Length = 177

 Score = 96.6 bits (239), Expect = 2e-22
 Identities = 19/163 (11%), Positives = 41/163 (25%), Gaps = 2/163 (1%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
             I+G +G GKS L+           G    A           L           F+   
Sbjct: 15  YIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIKLQI-WDTAGQESFRSIT 73

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
              +  AA  + +  +                      +  +    ++     ++ V   
Sbjct: 74  RSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKRE 133

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDRGHTVI 198
                  +  L    T A  + + EE      +++  +    +
Sbjct: 134 EGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL 176


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 96.6 bits (239), Expect = 2e-22
 Identities = 47/249 (18%), Positives = 90/249 (36%), Gaps = 29/249 (11%)

Query: 2   TALLELRNVSRSYPSGEE-----------QVAVLKDISLQIHAGEMVAIVGVSGSGKSTL 50
           T  + + NV+  +  G                VLKDI+ +I  G+++A+ G +G+GK++L
Sbjct: 1   TTEVVMENVTAFWEEGFGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSL 60

Query: 51  MNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIP 110
           + ++    +P+ G  + +GR         +     +                        
Sbjct: 61  LMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEE 120

Query: 111 AVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADE 170
            +                                LSGGQ+ R+S+ARA+     + L D 
Sbjct: 121 DISKFA------------------EKDNIVLGITLSGGQRARISLARAVYKDADLYLLDS 162

Query: 171 PTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEK 230
           P G LD  + +E+            T I+VT       +A++I+ +H+G         E 
Sbjct: 163 PFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 222

Query: 231 KREQGVDAA 239
           +  +   ++
Sbjct: 223 QNLRPDFSS 231


>2a30A [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 96.4 bits (238), Expect = 2e-22
 Identities = 26/207 (12%), Positives = 52/207 (25%), Gaps = 18/207 (8%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL--RREHFGFI 91
            + ++I G   +GKST +NIL  L +          R  +    + L  +  + E + F 
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGI------XXXXXXXXXXXXXXXXXXSDRVDYPPSQL 145
           FQ Y  LS + A        +                                +   +  
Sbjct: 62  FQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIY 121

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALD--------SHSGEEVMAILRQL-RDRGHT 196
                   +     +    +I                  +      +  L +L       
Sbjct: 122 QDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESW 181

Query: 197 VIIVTHDP-LIAAQAERIIEIHDGKIV 222
           ++  T        Q   I+ +   +  
Sbjct: 182 LLHRTLKTNFDYLQEVPILTLDVNEYE 208


>3adkA [x.x.x] ADENYLATE KINASE
          Length = 194

 Score = 95.9 bits (237), Expect = 3e-22
 Identities = 19/192 (9%), Positives = 46/192 (23%), Gaps = 5/192 (2%)

Query: 27  ISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRRE 86
           +  ++   +++ +VG  GSGK T    +      T  +     R   +       + +  
Sbjct: 1   MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSA---RGKML 57

Query: 87  HFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLS 146
                  +   L  +       + A                         ++  P   L 
Sbjct: 58  SEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLY 117

Query: 147 GGQQQRVSIARALMNGGQVILADEPTGALDSHSG--EEVMAILRQLRDRGHTVIIVTHDP 204
                     R L  G      D+    +        +    +    ++   V  V  + 
Sbjct: 118 VDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEG 177

Query: 205 LIAAQAERIIEI 216
            +     ++   
Sbjct: 178 SVDDVFSQVCTH 189


>3cddD [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 325

 Score = 95.4 bits (236), Expect = 4e-22
 Identities = 17/222 (7%), Positives = 41/222 (18%), Gaps = 16/222 (7%)

Query: 23  VLKDISLQIHAG-------EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTL 75
                 + I          ++          K+ +  I                  ++  
Sbjct: 13  YQGWTKIGITRSLEASGAFDLETYKFNDAQYKAFIEPIKQGQACTVDIGGER---VITGY 69

Query: 76  DPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS 135
             D +                  + L           +                      
Sbjct: 70  VDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIV 129

Query: 136 D---RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD 192
           +      +   Q+  G+     +AR     G V+L  +  G L      +  A +     
Sbjct: 130 NTDVGEPFQRIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVS--LI 186

Query: 193 RGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
            G  V           +  +        +      +    + 
Sbjct: 187 LGDNVKAARGRFSWRQRFSKFTIKDSAGLPTVGGIKADVTDS 228


>1e3aB [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
          Length = 560

 Score = 95.4 bits (235), Expect = 4e-22
 Identities = 22/242 (9%), Positives = 58/242 (23%), Gaps = 18/242 (7%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
                    Q A  + +++  +  ++   +G   +G             P  GT +   +
Sbjct: 162 KAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWK 221

Query: 71  DVSTLDPDALAQL------------RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
            +   + +                  ++ +        L         ++          
Sbjct: 222 GLLPFEMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLT 281

Query: 119 XXXXXXXXXXXXXXXXSDRVDY-----PPSQLSGGQQQRVSIARALMNGGQVILADEPTG 173
                           + R+         S L+    +R  +       G  +L D+   
Sbjct: 282 ADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKT 341

Query: 174 ALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKR 232
                S    + +   L+      + +  D   +A   E   +   G +  +  A+    
Sbjct: 342 WQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNISVGAKILYE 401

Query: 233 EQ 234
             
Sbjct: 402 AV 403


>3cmtD [x.x.x] PROTEIN RECA
          Length = 1609

 Score = 94.9 bits (234), Expect = 6e-22
 Identities = 32/254 (12%), Positives = 55/254 (21%), Gaps = 39/254 (15%)

Query: 31   IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
            +  G +V I G   SGK+TL   +    +    T      + +               G 
Sbjct: 1352 LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI------YARKLGV 1405

Query: 91   IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV------------ 138
                       T  Q +EI    A                       +            
Sbjct: 1406 DIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEMGLAARMMSQAMRKL 1465

Query: 139  ----------DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILR 188
                          +Q+     +  +   AL     V L     GA+     E    +  
Sbjct: 1466 AGNLKQSNTLLIFINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVK----EGENVVGS 1521

Query: 189  QLRDRGHTVIIVTHDPLIA-AQAERIIEIHDGKIVHNPPAEEKKREQGVD--AAVVNTAP 245
            + R +     I                    G++V     E+   + G            
Sbjct: 1522 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 1581

Query: 246  GWRQFASSFREALS 259
            G     ++    L 
Sbjct: 1582 GK----ANATAWLK 1591



 Score = 35.2 bits (79), Expect = 6e-04
 Identities = 17/79 (21%), Positives = 25/79 (31%), Gaps = 6/79 (7%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +  G +V I G   SGK+TL   +    +    T      +       AL  +     G 
Sbjct: 20  LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAE------HALDPIYARKLGV 73

Query: 91  IFQRYHLLSHLTAAQNVEI 109
                      T  Q +EI
Sbjct: 74  DIDNLLCSQPDTGEQALEI 92


>3bo6B [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
          Length = 215

 Score = 94.0 bits (232), Expect = 1e-21
 Identities = 18/213 (8%), Positives = 43/213 (20%), Gaps = 9/213 (4%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
              L N  R  P         + +    ++G   +       G     +           
Sbjct: 11  FHSLHNQMRQMP----MSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRE 66

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
             +  G             ++RE     FQ    L     +   +               
Sbjct: 67  NPQCKGDFAGDKFHI---SVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRV 123

Query: 124 XXXXXXXXXXXSD-RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                       D       +      +Q +    + ++   ++    P   +   + + 
Sbjct: 124 AVGAQFTLYVKPDQENSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKY 183

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQAERIIE 215
           V         R     + +           + E
Sbjct: 184 VSYRNELRSGRD-GGEMQSQALREEPFYRLMAE 215


>3cddF [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 319

 Score = 93.8 bits (231), Expect = 1e-21
 Identities = 27/251 (10%), Positives = 53/251 (21%), Gaps = 11/251 (4%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
             + +   SY         +          +             TL  I   + KP    
Sbjct: 67  GYVDDWVPSYD-ESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIK 125

Query: 65  YRVAGRDV---STLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXX 121
             V          +  +              QR  LL+  T    V   A          
Sbjct: 126 VIVNTDVGEPFQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI 185

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                          +     +  + G +  V+ +        +I+ +E T A  +    
Sbjct: 186 LGDNVKAARGRFSWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRG 245

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERI----IEIHDGKIVHNPPAEE--KKREQG 235
           +                +         +   I      I +  +     A     + + G
Sbjct: 246 QWERQRSI-GKSNAEYTVTGWRIPQTGKLWNINTLVPVIDEIGLDEELIASILFSEDDAG 304

Query: 236 VDAAVVNTAPG 246
             A +    P 
Sbjct: 305 RLAVISVVRPD 315


>1e0jA [c.37.1] DNA HELICASE
          Length = 287

 Score = 93.7 bits (231), Expect = 1e-21
 Identities = 22/232 (9%), Positives = 57/232 (24%), Gaps = 15/232 (6%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               +V   +         + D +L    GE++ +   SG GKST +           G 
Sbjct: 18  HLSSSVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK 73

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                    +++     +   +  G   +     S     + +E                
Sbjct: 74  KVGLAMLEESVE-----ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF----DELF 124

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                         +           +       ++     I+      + +    + +M
Sbjct: 125 GNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLM 184

Query: 185 AILRQ-LRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
             L+   +  G  ++++ H       +A           +    A  +  + 
Sbjct: 185 TKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDT 236


>3dm9B [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 301

 Score = 93.4 bits (231), Expect = 2e-21
 Identities = 30/220 (13%), Positives = 53/220 (24%), Gaps = 32/220 (14%)

Query: 8   RNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRV 67
             VS      E    +     ++      V  VG +GSGK+T +  L    K    +  +
Sbjct: 85  EAVSEIL---ETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVI 141

Query: 68  AGRDVSTLDPDALAQL--RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXX 125
           A  D          +   +R     I   Y       A   ++                 
Sbjct: 142 AASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHA--------------- 186

Query: 126 XXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMA 185
                              +    +   +         +V   +      D+ +G  ++ 
Sbjct: 187 ----------KARGIDVVLIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVE 236

Query: 186 ILRQL-RDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVH 223
             RQ         II+T     A   A   I       + 
Sbjct: 237 QARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPIL 276


>3da4A [x.x.x] COLICIN-M
          Length = 270

 Score = 93.2 bits (230), Expect = 2e-21
 Identities = 14/184 (7%), Positives = 32/184 (17%), Gaps = 33/184 (17%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           L+    +S                            +       +T +  L         
Sbjct: 89  LVLHPGISVYDAYH-------FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGA 141

Query: 64  TYRVAGRDVSTLDPD----ALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---- 115
              V   ++           +  + +      F      +H T   NV   A        
Sbjct: 142 ERSVNIANIGLKISPMKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLK 201

Query: 116 ------------------IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIAR 157
                             +                   + +    +  SG + Q +    
Sbjct: 202 TEGTLTISANGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKEYQILLPGE 261

Query: 158 ALMN 161
             + 
Sbjct: 262 IHIK 265


>2c4rL [x.x.x] RIBONUCLEASE E
          Length = 491

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 8/211 (3%), Positives = 33/211 (15%), Gaps = 15/211 (7%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
                 +++        +            +    +              +         
Sbjct: 135 GGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAA---- 190

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS---DRVD 139
                  F+  +   +        +        I                       ++ 
Sbjct: 191 -ESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKIK 249

Query: 140 YPPSQLSGGQQQRVSIARALMNG------GQVILADEPTGALDSHSGEEVMAILRQL-RD 192
               ++      ++                   +  + T AL +         + +   +
Sbjct: 250 LYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFN 309

Query: 193 RGHTVIIVTHDPLIAAQAERIIEIHDGKIVH 223
                       L       +I I    +  
Sbjct: 310 TNLEAADEIARQLRLRDLGGLIVIDFIDMTP 340


>1cr2A [c.37.1] DNA PRIMASE/HELICASE
          Length = 239

 Score = 92.8 bits (229), Expect = 3e-21
 Identities = 26/222 (11%), Positives = 57/222 (25%), Gaps = 25/222 (11%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            L    +V   +         + D +L    GE++ +   SG GKST +           
Sbjct: 8   HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G              +   +   E    +  R  L    +  + +     +         
Sbjct: 64  GKKVGLA------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW------ 111

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                            Y   +    +            G  VI+ D  +      +   
Sbjct: 112 -----FDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMT 166

Query: 183 VMAILRQLRDRGHTVIIVTHD--PLIAAQAERIIEIHDGKIV 222
            +      +  G  ++++ H     +   ++ II +    +V
Sbjct: 167 KLKGF--AKSTGVVLVVICHLKSGALRQLSDTIIALERNNLV 206


>2ahwD [x.x.x] PUTATIVE ENZYME YDIF
          Length = 487

 Score = 92.6 bits (228), Expect = 3e-21
 Identities = 12/214 (5%), Positives = 39/214 (18%), Gaps = 24/214 (11%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVG---VSGSGKSTLMNILGCLDK---- 59
           ++    +       V   ++    I     + ++G         + +  +     +    
Sbjct: 1   VKPPRINGRVP---VLSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKYKQTQTP 57

Query: 60  -------PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAV 112
                  PT    R                  +      + +   +S L     +     
Sbjct: 58  RNLSIISPTGLGDRADRGISPLAQEGL----VKWALCGHWGQSPRISDLAEQNKIIAYNY 113

Query: 113 YAG---IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILAD 169
             G                         VD         +  +  + + +    +  L  
Sbjct: 114 PQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYY 173

Query: 170 EPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD 203
           +      +                   + +    
Sbjct: 174 KAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV 207


>2b8wB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 290

 Score = 92.6 bits (228), Expect = 3e-21
 Identities = 29/232 (12%), Positives = 53/232 (22%), Gaps = 12/232 (5%)

Query: 1   MT-ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDK 59
           MT  +  + N +    +  E    LK +S       +VAIVG+  +GKS LMN L    K
Sbjct: 2   MTGPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK 58

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
             S    V                +  H   +     L          +       +   
Sbjct: 59  GFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV--- 115

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                          +             +      +++ ++     +      +LD  +
Sbjct: 116 ---LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEA 172

Query: 180 GEEVMAILRQLRDR-GHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
             + +     L             D                 K         
Sbjct: 173 DGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVH 224


>1e0jB [c.37.1] DNA HELICASE
          Length = 288

 Score = 92.6 bits (228), Expect = 3e-21
 Identities = 25/267 (9%), Positives = 62/267 (23%), Gaps = 37/267 (13%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            L    +V   +         + D +L    GE++ +   SG GKST +           
Sbjct: 17  HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 72

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G          +++         E    +  R  L    +  + +     +         
Sbjct: 73  GKKVGLAMLEESVEE------TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFG 126

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                           +           +       ++     I+      + +    + 
Sbjct: 127 NDTFHLYDSF---AEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDN 183

Query: 183 VMAILRQ-LRDRGHTVIIVTHDPLIAAQ-----------------------AERIIEIHD 218
           +M  L+   +  G  ++++ H                              ++ II +  
Sbjct: 184 LMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALER 243

Query: 219 GKIVHNPPAEEKKREQGVDAAVVNTAP 245
            +    P     +  +         A 
Sbjct: 244 NQQGDMPNLVLVRILKCRFTGDTGIAG 270


>3czpA [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
          Length = 460

 Score = 92.2 bits (227), Expect = 4e-21
 Identities = 22/215 (10%), Positives = 41/215 (19%), Gaps = 11/215 (5%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
            L           +    G   +GK   +  +     P                      
Sbjct: 253 GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLW 312

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNV--EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY 140
               H     Q             V                                V  
Sbjct: 313 RFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVK 372

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG--EEVMAILRQLRDRGHTVI 198
               +    Q+R    R      +  + +E     D      + V  + R   +     +
Sbjct: 373 FWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDQYVDAVGDVDRTSTEIAPWTL 431

Query: 199 IVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKRE 233
           +  +D     +  R+  +    I     A  KK +
Sbjct: 432 VEAND----KRFARVKVLRT--INDAIEAAYKKDK 460



 Score = 79.1 bits (193), Expect = 3e-17
 Identities = 14/140 (10%), Positives = 30/140 (21%), Gaps = 1/140 (0%)

Query: 18  EEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP 77
           E  +    ++  Q     ++ I G+ G+GK   + +L   D                L+ 
Sbjct: 24  EALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEELER 83

Query: 78  DALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDR 137
               +  R             +  +         +                         
Sbjct: 84  PPQWRFWRRLPPKGRTGIFFGNWYSQLYARVEGHI-KEAKLDQAIDAAERFERLCDEGAL 142

Query: 138 VDYPPSQLSGGQQQRVSIAR 157
           +      LS  Q +      
Sbjct: 143 LFKFWFHLSKKQLKERLSPL 162


>3cmxA [x.x.x] PROTEIN RECA
          Length = 1603

 Score = 92.1 bits (227), Expect = 4e-21
 Identities = 25/226 (11%), Positives = 48/226 (21%), Gaps = 31/226 (13%)

Query: 31   IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
            +  G +V I G   SGK+TL   +    +    T      + +         +     G 
Sbjct: 1352 LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL------DPIYARKLGV 1405

Query: 91   IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDR------------- 137
                       T  Q +EI    A                      R             
Sbjct: 1406 DIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEARMMSQAMRKLAGNL 1465

Query: 138  -----VDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD 192
                 +    +Q+   +      A         +         +  +       ++ +  
Sbjct: 1466 KQSNTLLIFINQIRNPETTTGGNALKFYAS-VRLDIRRIGAVKEGENVVGSETRVKVV-- 1522

Query: 193  RGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGVD 237
                  I         Q          G++V     E+   + G  
Sbjct: 1523 ---KNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAW 1565


>3dtbB [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 612

 Score = 92.1 bits (227), Expect = 4e-21
 Identities = 17/228 (7%), Positives = 40/228 (17%), Gaps = 10/228 (4%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
                  + +      ++  I+      + +A    S  GK+ L  +   L         
Sbjct: 251 RLAKEEGWLAE---HMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVG 307

Query: 67  VAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXX 126
                +                   F      S  T    ++                  
Sbjct: 308 DDIAWMKFDAQG--NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGG 365

Query: 127 XXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAI 186
                           +     + +            +          +D          
Sbjct: 366 VYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVP 425

Query: 187 LRQ-----LRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
           +        R  G  ++               +      I+H+P A  
Sbjct: 426 IEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEAKVIMHDPFAMR 473



 Score = 44.7 bits (104), Expect = 7e-07
 Identities = 15/186 (8%), Positives = 39/186 (20%), Gaps = 24/186 (12%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
             D S ++  G + ++       +  +      L +P                 +     
Sbjct: 6   GLDFSAKVIQGSLDSL---PQEVRKFVEGNAQ-LCQPEYIHI--------CDGSEEEYG- 52

Query: 84  RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV----- 138
                    Q   ++  L    N  + A+                      +  +     
Sbjct: 53  ---RLLAHMQEEGVIRKLKKYDNCWL-ALTDPRDVARIESKTVIITQEQRDTVPIPKSGQ 108

Query: 139 --DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
                       ++   +     M G  + +     G L S   +  + +          
Sbjct: 109 SQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASM 168

Query: 197 VIIVTH 202
            I+   
Sbjct: 169 RIMTRM 174


>2a2zB [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 92.1 bits (227), Expect = 4e-21
 Identities = 25/202 (12%), Positives = 51/202 (25%), Gaps = 13/202 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREH--FGFI 91
            + ++I G   +GKST +NIL  L +          R  +    + L  +  +   + F 
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYA-GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
           FQ Y  LS + A                                    +   +       
Sbjct: 62  FQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD 121

Query: 151 QRVSIARALMNGGQVILADEPTGA--------LDSHSGEEVMAILRQLRDR-GHTVIIVT 201
              +     +    +I                  +      +  L +L  +    ++  T
Sbjct: 122 WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT 181

Query: 202 HDPLIA-AQAERIIEIHDGKIV 222
                   Q   I+ +   +  
Sbjct: 182 LKTNFDYLQEVPILTLDVNEDF 203


>3bb1C [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 246

 Score = 91.8 bits (226), Expect = 5e-21
 Identities = 16/238 (6%), Positives = 56/238 (23%), Gaps = 4/238 (1%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 3   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 60

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEI-PAVYAGIXXXXX 121
             ++  G     +                      ++ +               +     
Sbjct: 61  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVD 120

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                          +            +  V++  A  +    +  DE          +
Sbjct: 121 RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ 180

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
            V      L+     V+I          ++  +  +    + +      +       +
Sbjct: 181 VVR-SGASLKSDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSES 237


>1e9rE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 419

 Score = 91.7 bits (226), Expect = 6e-21
 Identities = 26/234 (11%), Positives = 58/234 (24%), Gaps = 34/234 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 19  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 74

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 75  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--- 125

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 126 ----------------YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 169

Query: 180 GEEVMAILRQLRDRGHTVIIVTHDPLIAAQAE----RIIEIHDGKIVHNPPAEE 229
               +A    LR      +  +        ++        + D    H    + 
Sbjct: 170 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDG 223


>1av6A [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
          Length = 289

 Score = 91.7 bits (226), Expect = 6e-21
 Identities = 21/236 (8%), Positives = 50/236 (21%), Gaps = 13/236 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKD-----ISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           E  N        + Q+ +L         LQ H     A V   GS   T +  L      
Sbjct: 23  ESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYN 82

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                +    D    DP                   +      +   ++      +    
Sbjct: 83  LGVIIKWMLIDGRHHDPI-----LNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDV 137

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                          + +    + ++   + R       +    +   ++          
Sbjct: 138 RSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYS 197

Query: 181 EEVMAILRQLRDRGHTVIIVTH---DPLIAAQAERIIEIHDGKIVHNPPAEEKKRE 233
            E+  +     +      +      +          I  +   +  + P +E    
Sbjct: 198 AEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYF 253


>3bb1F [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 245

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 16/238 (6%), Positives = 55/238 (23%), Gaps = 4/238 (1%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 3   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 60

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHL-LSHLTAAQNVEIPAVYAGIXXXXX 121
             ++  G     +                                  +      +     
Sbjct: 61  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVD 120

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                          +            +  V++  A  +    +  DE          +
Sbjct: 121 RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ 180

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
            V +     +D    V+I          ++  +  +    + +      +       +
Sbjct: 181 VVRSGASLKKD-IPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSES 237


>2akaA [x.x.x] MYOSIN II HEAVY CHAIN
          Length = 764

 Score = 91.1 bits (224), Expect = 8e-21
 Identities = 29/235 (12%), Positives = 51/235 (21%), Gaps = 12/235 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           M  + + R  +   P       V     L     + + I G SG+GK+     +      
Sbjct: 138 MVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLAS 197

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPA-----VYAG 115
            +G  +  G  V         Q       F   +    ++ +                +G
Sbjct: 198 VAGRNQANGSGVLEQQIL---QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

Query: 116 IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL 175
                                        L+G   +               L       +
Sbjct: 255 ASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDI 314

Query: 176 DSHSGEEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
              S  E   I RQ       V     +   I      I+ + + K         
Sbjct: 315 KGVSDSEEFKITRQ---AMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGA 366



 Score = 74.1 bits (180), Expect = 1e-15
 Identities = 5/68 (7%), Positives = 17/68 (25%)

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
                    +    +Q    + +  ++  + I  +      DS+   E+++         
Sbjct: 3   IHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFK 62

Query: 195 HTVIIVTH 202
                   
Sbjct: 63  TVDGQDRQ 70


>2bjbA [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
          Length = 421

 Score = 90.9 bits (225), Expect = 9e-21
 Identities = 19/225 (8%), Positives = 40/225 (17%), Gaps = 28/225 (12%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           M   L+   +             +           +    G++G    T++  +  L   
Sbjct: 57  MLDALQTLGLRVDG---VGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAAL 107

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
            S      G          L    R   G       L   +    ++    V        
Sbjct: 108 GSVPVTFDGDQARGRPIAPLLDALR-ELGVAVDGTGLPFRVRGNGSLAGGTVA------- 159

Query: 121 XXXXXXXXXXXXXXSDRVD--YPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD-S 177
                         S  V      +              +L +   + +           
Sbjct: 160 --------IDASASSQFVSGLLLSAASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVD 211

Query: 178 HSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
                      +          +  D   A        +  G + 
Sbjct: 212 IDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSGGTVR 256


>3cioD [x.x.x] TYROSINE-PROTEIN KINASE ETK
          Length = 255

 Score = 90.9 bits (224), Expect = 9e-21
 Identities = 19/190 (10%), Positives = 37/190 (19%), Gaps = 3/190 (1%)

Query: 18  EEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP 77
                 L    ++     ++       SGK+ + + L  +   +         D+     
Sbjct: 56  RALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYS 115

Query: 78  DALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS-- 135
             L  +  EH    +       +       +                             
Sbjct: 116 HNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLE 175

Query: 136 -DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
                Y    +       VS A  +       L     G   +      M  L Q     
Sbjct: 176 WANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNI 235

Query: 195 HTVIIVTHDP 204
              I+     
Sbjct: 236 KGAILNGVIK 245


>2d4uA [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
          Length = 167

 Score = 90.7 bits (224), Expect = 1e-20
 Identities = 18/168 (10%), Positives = 44/168 (26%), Gaps = 7/168 (4%)

Query: 39  IVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP-DALAQLRREHFGFIFQRYHL 97
            +G  G   + L N         +   + +  + S +        L R    ++  + ++
Sbjct: 2   PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVALLQTRNTLNRAGIRYMMDQNNI 61

Query: 98  LSHLTAAQNVEI---PAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
            S  T A+ +E        A                    +  +            + + 
Sbjct: 62  GSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQ 121

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
           +  A          D+PT        ++ +A + Q        +   +
Sbjct: 122 LLGAGK---INEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN 166


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score = 90.6 bits (223), Expect = 1e-20
 Identities = 64/230 (27%), Positives = 90/230 (39%), Gaps = 31/230 (13%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
           V KDI+L IH GE V  VG SG GKSTL+ ++                            
Sbjct: 10  VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------------------- 43

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
                 G +FQ Y L  HL+ A+N+      AG                   +  +D  P
Sbjct: 44  ---LGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKP 100

Query: 143 SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAIL-RQLRDRGHTVIIVT 201
             LSGGQ+QRV+I R L+    V L DEP   LD+    ++   + R  +  G T+I VT
Sbjct: 101 KALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVT 160

Query: 202 HDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQF 250
           HD + A   A++I+ +  G++       E                    F
Sbjct: 161 HDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNF 210


>1e2kA [c.37.1] THYMIDINE KINASE
          Length = 308

 Score = 90.2 bits (222), Expect = 2e-20
 Identities = 20/197 (10%), Positives = 36/197 (18%), Gaps = 27/197 (13%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L   D           R +   +           +  
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASET------IANIYTT 54

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
             +          A  V   A                                 + G   
Sbjct: 55  QHRLDQGEISAGDAAVVMTSAQITMGMPYA---------------VTDAVLAPHIGGEAG 99

Query: 151 QRVSIARALMNGGQVILADEPT----GALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLI 206
              ++           L   P         +         L      G  +++       
Sbjct: 100 PPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDR 159

Query: 207 AAQ--AERIIEIHDGKI 221
                A+R        +
Sbjct: 160 HIDRLAKRQRPGERLDL 176


>2dr3F [x.x.x] UPF0273 PROTEIN PH0284
          Length = 236

 Score = 90.1 bits (222), Expect = 2e-20
 Identities = 23/228 (10%), Positives = 49/228 (21%), Gaps = 32/228 (14%)

Query: 14  YPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVS 73
             +G     V + +   I    +V + G  G+GK+                      +  
Sbjct: 3   VKTGIP--GVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH 60

Query: 74  TLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXX 133
            +            FG+  + Y                  +                   
Sbjct: 61  PVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKE----------------- 99

Query: 134 XSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS---GEEVMAILRQL 190
                          +   V          + ++ D  T    +        ++ + R L
Sbjct: 100 --YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVL 157

Query: 191 RDRGHTVIIVTHDP----LIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
              G T I V+        +    + II +   +I           + 
Sbjct: 158 AGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKM 205


>2c0bL [x.x.x] RIBONUCLEASE E
          Length = 488

 Score = 90.1 bits (222), Expect = 2e-20
 Identities = 16/227 (7%), Positives = 47/227 (20%), Gaps = 20/227 (8%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
           L  +     AG +   + +  +  S  + ++            +       L      + 
Sbjct: 121 LVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAIKK 180

Query: 84  RREH--FGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXX---SDRV 138
             E     F+  +   +        +        I                     S ++
Sbjct: 181 AAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKI 240

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-------- 190
                ++      ++          +V L    +  +DS      + I            
Sbjct: 241 KLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARDIEETAFN 300

Query: 191 ----RDRGHTVIIVTHDP---LIAAQAERIIEIHDGKIVHNPPAEEK 230
                       +   D    ++    +     H   + +      +
Sbjct: 301 TNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAVR 347


>1d6jB [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 182

 Score = 89.9 bits (222), Expect = 2e-20
 Identities = 27/176 (15%), Positives = 46/176 (26%), Gaps = 6/176 (3%)

Query: 21  VAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG--TYRVAGRDVSTLDPD 78
           +   +   L+   G  + + G+S SGKSTL   L            YR+ G ++      
Sbjct: 5   LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNK 64

Query: 79  ALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV 138
            L     +    I +          A +  I                          +  
Sbjct: 65  DLGFSEADRNENIRRIAE--VAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEET 122

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
             P  ++       V+  RA                L     + V  I+  L  +G
Sbjct: 123 GLPFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKG 176


>3cr7D [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 183

 Score = 89.7 bits (221), Expect = 2e-20
 Identities = 22/185 (11%), Positives = 37/185 (20%), Gaps = 22/185 (11%)

Query: 32  HAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
             G  + + G+S SGKSTL   L          +       +            E     
Sbjct: 1   QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNE 60

Query: 92  FQRYHLLSHLTAAQNV-------------------EIPAVYAGIXXXXXXXXXXXXXXXX 132
             R         A +                    ++  V                    
Sbjct: 61  NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVEVYVDVPVEVA 120

Query: 133 XXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD 192
              D          G  ++   I+                  L     + V  I+  L  
Sbjct: 121 EQRDPKGLYKKAREGVIKEFTGISAPYEA-PANPEVHVKNYELPVQ--DAVKQIIDYLDT 177

Query: 193 RGHTV 197
           +G+  
Sbjct: 178 KGYLP 182


>3clvA [x.x.x] RAB5 PROTEIN, PUTATIVE
          Length = 175

 Score = 89.6 bits (221), Expect = 2e-20
 Identities = 17/173 (9%), Positives = 42/173 (24%), Gaps = 8/173 (4%)

Query: 29  LQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTL------DPDALAQ 82
           ++  +     ++G S  GKS+++  L       +    +     + +        + L  
Sbjct: 2   MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVVNLNDNYNENLCN 61

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNV-EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP 141
           ++         +    S +           V   I                  S      
Sbjct: 62  IKF-DIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIII 120

Query: 142 PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
                  +  +V I           L    T A    + + +  +L +   + 
Sbjct: 121 LVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN 173


>1e59A [c.60.1] PHOSPHOGLYCERATE MUTASE
          Length = 239

 Score = 89.5 bits (220), Expect = 3e-20
 Identities = 21/210 (10%), Positives = 45/210 (21%), Gaps = 5/210 (2%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
           +  + L +  GE         +G   +      + +  +    +     S          
Sbjct: 1   VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLK 59

Query: 84  RREHF----GFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVD 139
           R  H          +  L    +   N        G+                       
Sbjct: 60  RAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAV 119

Query: 140 YPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVII 199
            PP      ++      R      + +   E                +      G  VII
Sbjct: 120 TPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVII 179

Query: 200 VTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
             H   + A  + +  + + +I+       
Sbjct: 180 AAHGNSLRALVKYLDNMSEEEILELNIPTG 209


>3dfpC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 352

 Score = 89.5 bits (221), Expect = 3e-20
 Identities = 11/86 (12%), Positives = 29/86 (33%), Gaps = 1/86 (1%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVI 198
              P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 199 IVTHDP-LIAAQAERIIEIHDGKIVH 223
           ++T D  +       I+         
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKA 87


>1e6cA [c.37.1] SHIKIMATE KINASE
          Length = 170

 Score = 89.4 bits (220), Expect = 3e-20
 Identities = 16/167 (9%), Positives = 40/167 (23%), Gaps = 10/167 (5%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQR 94
           E + +VG  G G +T+   L            +  +  S +    +            + 
Sbjct: 3   EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRES 62

Query: 95  YHLLSHLTAAQNVEIPAVYAG--------IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLS 146
             L +  T  + V                                            + +
Sbjct: 63  EALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPT 122

Query: 147 GGQQQRVSIARALMNGGQVILADEPTGALDSH--SGEEVMAILRQLR 191
              +       A++   + +  D     +D+       V  +++ +R
Sbjct: 123 LTGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAAIVCELMQTMR 169


>1e3mB [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
           PROTEIN MUTS
          Length = 732

 Score = 89.4 bits (221), Expect = 3e-20
 Identities = 10/181 (5%), Positives = 30/181 (16%), Gaps = 10/181 (5%)

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXX 121
           + T               + + R      +     + + L  +    +            
Sbjct: 513 AYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTY 572

Query: 122 XXXXXXXXXXXXXSD-------RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                           G   +  +           ++ DE    
Sbjct: 573 RQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTFVETETANILHNATEYSLVLDEIGRG 632

Query: 175 LDSHSGEEVMAIL--RQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKK 231
             ++ G  +                +  TH   L     +  +       + +       
Sbjct: 633 TSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEGVANVHLDALEHGDTIAFH 692

Query: 232 R 232
            
Sbjct: 693 S 693


>1e9sB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 89.3 bits (220), Expect = 3e-20
 Identities = 22/223 (9%), Positives = 48/223 (21%), Gaps = 12/223 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 27  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 82

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   +   L               I   Y   +   +  N                  
Sbjct: 83  MVIVDPNGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR 136

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     S                     R L +   +   D+  G L+    E + 
Sbjct: 137 GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF 196

Query: 185 AILRQLRDR-GHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPP 226
           A   +          +++                   +     
Sbjct: 197 AGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG 239


>3dfnC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 353

 Score = 89.1 bits (220), Expect = 3e-20
 Identities = 15/102 (14%), Positives = 35/102 (34%), Gaps = 4/102 (3%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVI 198
              P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 199 IVTHDP-LIAAQAERIIEIHDGKIVH---NPPAEEKKREQGV 236
           ++T D  +       I+             P  +  K + GV
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGV 103


>1e3mA [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
           PROTEIN MUTS
          Length = 765

 Score = 89.0 bits (220), Expect = 3e-20
 Identities = 12/221 (5%), Positives = 39/221 (17%), Gaps = 15/221 (6%)

Query: 18  EEQVAVLKDISLQIHAGEMVAIVGVS-------GSGKSTLMNILGCLDKPTSGTYRVAGR 70
             +  + +++   +           S           +     L            +   
Sbjct: 507 ALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRIT 566

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
           +      +     +  +  FI    +L                                 
Sbjct: 567 EGRHPVVE-----QVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYV 621

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
                +           G  +  +           ++ DE      ++ G  +     + 
Sbjct: 622 PAQKVEIGPIDRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAEN 681

Query: 191 --RDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAE 228
                    +  TH   L     +  +       + +    
Sbjct: 682 LANKIKALTLFATHYFELTQLPEKEGVANVHLDALEHGDTI 722


>2eg5G [x.x.x] XANTHOSINE METHYLTRANSFERASE
          Length = 343

 Score = 88.8 bits (218), Expect = 4e-20
 Identities = 14/242 (5%), Positives = 55/242 (22%), Gaps = 23/242 (9%)

Query: 4   LLELRNVSRSYPSGEEQ-VAVLKDISLQIHAGEMVAIVGVSGSGKST-----LMNILGCL 57
                 +++  P  E+    +L+     I+    VA +G +    +      ++  +  +
Sbjct: 10  AYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKV 69

Query: 58  DKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI- 116
            +    T ++   D+   D +    + +    F  +     +       +      +   
Sbjct: 70  GQLERPTIQIFLNDLFPNDFN---SVFKLLPSFYRKLEK-ENGRKIGSCLIGAMPGSFYS 125

Query: 117 ---------XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVIL 167
                                         +      +   +  R+ + +A ++      
Sbjct: 126 RLFPEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSKASRLPVQKAYLDQFTKDF 185

Query: 168 ADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPA 227
                   +          +          +   +   +   A   + +          +
Sbjct: 186 TTFLRIHSEELFSHG---RMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDS 242

Query: 228 EE 229
             
Sbjct: 243 FN 244


>2ahvA [x.x.x] PUTATIVE ENZYME YDIF
          Length = 512

 Score = 88.7 bits (218), Expect = 4e-20
 Identities = 18/263 (6%), Positives = 53/263 (20%), Gaps = 26/263 (9%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVG---VSGSGKSTLMNILGCLDK---- 59
           ++    +       V   ++    I     + ++G         + +  +     +    
Sbjct: 1   VKPPRINGRVP---VLSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKYKQTQTP 57

Query: 60  -------PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAV 112
                  PT    R             +    +      + +   +S L     +     
Sbjct: 58  RNLSIISPTGLGDRADRGISPLAQEGLV----KWALCGHWGQSPRISDLAEQNKIIAYNY 113

Query: 113 YAGI---XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILAD 169
             G+                        VD         +  +  + + +    +  L  
Sbjct: 114 PQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYY 173

Query: 170 EPTGALDSHSGEEVMAIL--RQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPA 227
           +      +                D    +  +     +      ++      +      
Sbjct: 174 KAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMVKKATLH 233

Query: 228 EEKKREQGVDAAVVNTAPGWRQF 250
            +  R  G    +V   P   Q 
Sbjct: 234 PKSVRIPGYLVDIVVVDPDQSQL 256


>3dfoD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 360

 Score = 88.6 bits (219), Expect = 5e-20
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 419

 Score = 88.3 bits (217), Expect = 6e-20
 Identities = 14/235 (5%), Positives = 48/235 (20%), Gaps = 29/235 (12%)

Query: 13  SYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDV 72
           +          L  ++        V I      GK+                  +   ++
Sbjct: 159 TGVPSGFTE--LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEM 216

Query: 73  STLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXX 132
              +      +          +       +        A+                    
Sbjct: 217 GKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI------------ 264

Query: 133 XXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ--- 189
              +  D     ++    +     R       +++ D       + + +     + Q   
Sbjct: 265 ---NIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISR 321

Query: 190 -----LRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVH---NPPAEEKKREQG 235
                 R+    VI ++     +  + ++   + D +            +   + 
Sbjct: 322 DLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRD 376



 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 9/97 (9%), Positives = 23/97 (23%), Gaps = 3/97 (3%)

Query: 136 DRVDYPPSQLSGGQ-QQRVSIARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDR 193
                 P   S G+        + L   GQ +        +     +      L +L   
Sbjct: 20  KECPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAAS 79

Query: 194 GHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
             +           ++  ++   I   + +      +
Sbjct: 80  VASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNVK 116


>3dfqD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 361

 Score = 88.3 bits (218), Expect = 6e-20
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>2cckB [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 13/189 (6%), Positives = 38/189 (20%), Gaps = 5/189 (2%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           +   G  GSGK+T++N +                       +    +         +   
Sbjct: 4   ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGDMDIRTEAML 63

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS---DRVDYPPSQLSGGQQQRV 153
             +       +++                         +      +              
Sbjct: 64  FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYP 123

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHTVIIVTHDP-LIAAQAE 211
            +   L    +V         LD    +    ++   ++      +        +     
Sbjct: 124 DLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDTY 183

Query: 212 RIIEIHDGK 220
           + I  +  K
Sbjct: 184 QTIIKYLEK 192


>2ausC [x.x.x] PSEUDOURIDINE SYNTHASE
          Length = 311

 Score = 87.9 bits (216), Expect = 8e-20
 Identities = 11/100 (11%), Positives = 28/100 (28%)

Query: 137 RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
            +D PP   S      +     L   G     D     +   + E    +++ L   G  
Sbjct: 39  NLDKPPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKE 98

Query: 197 VIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
            + + H      + +    + + +        +    + +
Sbjct: 99  YVALMHLHGDVPEDKIRAVMKEFEGEIIQRTRKVYYIEIL 138


>1e9rD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 415

 Score = 87.8 bits (216), Expect = 8e-20
 Identities = 24/240 (10%), Positives = 56/240 (23%), Gaps = 34/240 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 17  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 72

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L      +    +      +     +                   
Sbjct: 73  LRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------- 123

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 124 ----------------YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 167

Query: 180 GEEVMAILRQLRDRGH---TVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
               +A    LR          +         A       + D    H    +     + 
Sbjct: 168 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRS 227


>3cddC [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 322

 Score = 87.7 bits (216), Expect = 8e-20
 Identities = 17/220 (7%), Positives = 39/220 (17%), Gaps = 30/220 (13%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVS-----TLDPDALAQLRREHFGF 90
           ++   G    G + +      L+   +                     A           
Sbjct: 4   VLKAGGKIYQGWTKIGITRS-LEASGAFDLETYKFQYKAFIEPIKQGQACTVDIGGERVI 62

Query: 91  IFQRYHLLSHLTA------------------AQNVEIPAVYAGIXXXXXXXXXXXXXXXX 132
                  +                                +                   
Sbjct: 63  TGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIK 122

Query: 133 XXSDRV---DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ 189
              +      +   Q+  G+     +AR     G V+L  +  G L      +  A +  
Sbjct: 123 VIVNTDVGEPFQRIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVSL 181

Query: 190 LRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
           +   G  V           +  +     D   +      +
Sbjct: 182 I--LGDNVKAARGRFSWRQRFSKFTIKADSAGLPTVGGIK 219


>2bkiA [x.x.x] UNCONVENTIONAL MYOSIN
          Length = 824

 Score = 87.7 bits (215), Expect = 9e-20
 Identities = 15/234 (6%), Positives = 47/234 (20%), Gaps = 13/234 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                + +++    P               +   + + + G SG+GK+     +      
Sbjct: 110 TIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTE 169

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVY-----AG 115
           + GT +     +         +       F   +    ++ +                 G
Sbjct: 170 SYGTGQDIDDRI--------VEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

Query: 116 IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL 175
                                         +G  +                L    T   
Sbjct: 222 GFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYF 281

Query: 176 DSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
            +   ++ +   R+  +      +            R+        + +    +
Sbjct: 282 ANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLD 335


>3cmvE [x.x.x] PROTEIN RECA
          Length = 1165

 Score = 87.6 bits (215), Expect = 9e-20
 Identities = 23/233 (9%), Positives = 48/233 (20%), Gaps = 12/233 (5%)

Query: 2   TALLELRNVSRSYP---SGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLD 58
            +++ L           S       +   +  +  G +V I G   SGK+TL   +    
Sbjct: 592 GSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAA 651

Query: 59  KPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
           +    T      + +               G            T  Q +EI    A    
Sbjct: 652 QREGKTCAFIDAEHALDPIY------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGA 705

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                           ++        +S   ++     +        I          + 
Sbjct: 706 VDVIVVDSVAALTPK-AEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYAS 764

Query: 179 SGEEVMAIL-RQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
              ++  I   +  +                    +  E             E
Sbjct: 765 VRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGE 817



 Score = 74.9 bits (182), Expect = 6e-16
 Identities = 25/228 (10%), Positives = 47/228 (20%), Gaps = 9/228 (3%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           L E R++     S       +   +  +  G +V I G   SGK+TL   +    +    
Sbjct: 298 LGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGK 357

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
           T      + +               G            T  Q +EI    A         
Sbjct: 358 TCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALAR-SGAVDVI 410

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD-SHSGEE 182
                      ++        +S   ++     +        I           S   + 
Sbjct: 411 VVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDI 470

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
                 +  +                    +  E             E
Sbjct: 471 RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGE 518



 Score = 51.4 bits (121), Expect = 7e-09
 Identities = 25/247 (10%), Positives = 53/247 (21%), Gaps = 35/247 (14%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISL--QIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +  +S            L        +  G +V I G   SGK+TL   +    +    T
Sbjct: 1   VETISTGSL-------SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 53

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +               G            T  Q +EI    A          
Sbjct: 54  CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-----GAV 102

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                              ++S        +++A+      +          +  G  + 
Sbjct: 103 DVIVVDSVAALTPKAEIEGEISHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALK 162

Query: 185 AILRQLRD---------------RGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
                  D                   V +V +      +      ++   I       +
Sbjct: 163 FYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVD 222

Query: 230 KKREQGV 236
              ++ +
Sbjct: 223 LGVKEKL 229


>3dftD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 360

 Score = 87.5 bits (216), Expect = 1e-19
 Identities = 20/127 (15%), Positives = 43/127 (33%), Gaps = 9/127 (7%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH---NPPAEEKKREQG-----VDAAVVNTAPGWRQFA 251
           T D  +       I+             P  +  K + G     VD  VV  A    +  
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETT 123

Query: 252 SSFREAL 258
           +   + L
Sbjct: 124 TQGLDGL 130


>3dfpD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 362

 Score = 87.5 bits (216), Expect = 1e-19
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>3dt7A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 624

 Score = 87.3 bits (214), Expect = 1e-19
 Identities = 18/255 (7%), Positives = 46/255 (18%), Gaps = 20/255 (7%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
              L + +          +  ++  I+      + +A    S  GK+ L  +   L    
Sbjct: 247 CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWK 306

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---IXX 118
                     +                      + +    +   N               
Sbjct: 307 VECVGDDIAWMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN 361

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                                   +     + +            +          +D  
Sbjct: 362 VAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPA 421

Query: 179 SGEEVMAILRQL-----RDRGHTVIIVTHDPLIA---AQAER----IIEIHDGKIVHNPP 226
                   +  +     R  G  ++              A R        H GK++ + P
Sbjct: 422 WESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDP 481

Query: 227 AEEKKREQGVDAAVV 241
              +          +
Sbjct: 482 FAMRPFFGYNFGKYL 496


>1cr1A [c.37.1] DNA PRIMASE/HELICASE
          Length = 245

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 27/231 (11%), Positives = 62/231 (26%), Gaps = 37/231 (16%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            L    +V   +         + D +L    GE++ +   SG GKST +           
Sbjct: 8   HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 63  GTYRVAGRDVSTLDPDALAQLRR--EHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
           G  +V    +     +    L                   +   +  +      G     
Sbjct: 64  G-KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN---- 118

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQ--VILADEPTGALDSH 178
                          D      S       + ++    + +G    VI+ D  +  +   
Sbjct: 119 ---------------DTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHIS--IRKM 161

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDP-------LIAAQAERIIEIHDGKIV 222
               +  +    +  G  ++++ H          +   ++ II +   ++V
Sbjct: 162 IDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLV 212


>3dfqA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 350

 Score = 86.7 bits (214), Expect = 2e-19
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>1dhjA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 86.7 bits (214), Expect = 2e-19
 Identities = 14/96 (14%), Positives = 27/96 (28%), Gaps = 2/96 (2%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRG 194
            + +     +  G+    SI R L     +IL+ +P         + V   +        
Sbjct: 31  FKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPE 90

Query: 195 HTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
             VI           +A+++   H    V       
Sbjct: 91  IMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFP 126


>1aldA [c.1.10 (2aldA)] ALDOLASE A
          Length = 363

 Score = 86.4 bits (213), Expect = 2e-19
 Identities = 11/84 (13%), Positives = 30/84 (35%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA + +    +   + +     +   R +  +++
Sbjct: 4   YPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>2dr3C [x.x.x] UPF0273 PROTEIN PH0284
          Length = 233

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 24/222 (10%), Positives = 49/222 (22%), Gaps = 31/222 (13%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           +R   +G   V   + +   I    +V + G  G+GK+                      
Sbjct: 1   TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL 58

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
           +   +            FG+  + Y                                   
Sbjct: 59  EEHPVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGE----------------- 97

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG---EEVMAIL 187
                             +   V          + ++ D  T    +        ++ + 
Sbjct: 98  -----YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLK 152

Query: 188 RQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
           R L   G T I V+    +    + II +   +I        
Sbjct: 153 RVLAGTGCTSIFVSQVSGVEHGVDGIIRLDLDEIDGELKRSL 194


>2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 294

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 26/242 (10%), Positives = 55/242 (22%), Gaps = 24/242 (9%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
              + + R   +   +G + +     ++  I    M    G  GSGK+ L + L    + 
Sbjct: 64  ALEVKKERMNVKKISTGSQAL--DGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQL 121

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                 ++G+ V           R E+                     I           
Sbjct: 122 PPEKGGLSGKAVYIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINTD-------- 173

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                            VD     +S     ++ +  ++ +  +         A+     
Sbjct: 174 ------------HQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKL 221

Query: 181 E-EVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGVDA 238
              +  + R        VII               I++   +                  
Sbjct: 222 NKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRIQLKKSRGNRRIARVVDAPHLPEGE 281

Query: 239 AV 240
            V
Sbjct: 282 VV 283


>3ch4B [x.x.x] PHOSPHOMEVALONATE KINASE
          Length = 188

 Score = 86.2 bits (212), Expect = 2e-19
 Identities = 14/187 (7%), Positives = 29/187 (15%), Gaps = 27/187 (14%)

Query: 26  DISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRR 85
              L      ++   G   SGK  +   L                 +             
Sbjct: 3   MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQE----HG 58

Query: 86  EHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSD--------- 136
            +F +       +      +    P  +                     SD         
Sbjct: 59  LNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYG 118

Query: 137 --------------RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                         R         G                  ++ +           E 
Sbjct: 119 AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLEN 178

Query: 183 VMAILRQ 189
           ++  +R 
Sbjct: 179 LIEFIRS 185


>3dfnA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 350

 Score = 86.0 bits (212), Expect = 3e-19
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>1cs4C [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 329

 Score = 85.7 bits (211), Expect = 3e-19
 Identities = 9/78 (11%), Positives = 25/78 (32%), Gaps = 1/78 (1%)

Query: 33  AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
           A   + ++G   SGKST++  +  L      T     ++      + +      +     
Sbjct: 1   ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMS-NLVPPV 59

Query: 93  QRYHLLSHLTAAQNVEIP 110
           +  +  +       + + 
Sbjct: 60  ELANPENQFRVDYILSVM 77


>1adoA [c.1.10] ALDOLASE
          Length = 363

 Score = 85.3 bits (210), Expect = 5e-19
 Identities = 15/100 (15%), Positives = 36/100 (36%), Gaps = 4/100 (4%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA + +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIV---HNPPAEEKKREQGV 236
           T D  +       I+             P  +  K + GV
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGV 103


>3dfnD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 361

 Score = 85.3 bits (210), Expect = 5e-19
 Identities = 15/102 (14%), Positives = 36/102 (35%), Gaps = 4/102 (3%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVI 198
              P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 199 IVTHDP-LIAAQAERIIEIHDGKIVHN---PPAEEKKREQGV 236
           ++T D  +       I+         +   P  +  K + GV
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGV 103


>2bwjA [x.x.x] ADENYLATE KINASE 5
          Length = 196

 Score = 85.1 bits (209), Expect = 5e-19
 Identities = 25/202 (12%), Positives = 49/202 (24%), Gaps = 14/202 (6%)

Query: 27  ISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALA--QLR 84
               +   +++ I+G  GSGK T    L      T             L  + LA    R
Sbjct: 2   FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL-------STGELLREELASESER 54

Query: 85  REHFGFIFQRYHLLSHLTAAQNVEIPAVYAG--IXXXXXXXXXXXXXXXXXXSDRVDYPP 142
            +    I +R  L+      + ++   V +                        R+  P 
Sbjct: 55  SKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQ 114

Query: 143 SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
             +           R L      +  D+ T  +         A +  +        +   
Sbjct: 115 LVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKI 174

Query: 203 DPLIA---AQAERIIEIHDGKI 221
           +          +    I    +
Sbjct: 175 NAEGTPEDVFLQLCTAIDSIFL 196


>6aldA [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
          Length = 343

 Score = 84.8 bits (209), Expect = 6e-19
 Identities = 11/84 (13%), Positives = 30/84 (35%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA + +    +   + +     +   R +  +++
Sbjct: 3   HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL 62

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 63  TADDRVNPCIGGVILFHETLYQKA 86


>3dftC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 352

 Score = 84.8 bits (209), Expect = 6e-19
 Identities = 11/84 (13%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVH 223
           T D  +       I+         
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKA 87


>2bx2L [x.x.x] RIBONUCLEASE E
          Length = 500

 Score = 84.8 bits (208), Expect = 6e-19
 Identities = 9/96 (9%), Positives = 25/96 (26%), Gaps = 1/96 (1%)

Query: 137 RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
           ++     ++      ++          +V L    +  +DS      + I     D   T
Sbjct: 249 KIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEET 308

Query: 197 VIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKR 232
                 +      A ++     G ++     +    
Sbjct: 309 AFNTNLE-AADEIARQLRLRDLGGLIVIDFIDMTPV 343


>1cjtC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 330

 Score = 84.5 bits (208), Expect = 8e-19
 Identities = 9/79 (11%), Positives = 25/79 (31%), Gaps = 1/79 (1%)

Query: 33  AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
           A   + ++G   SGKST++  +  L      T     ++      + +      +     
Sbjct: 1   ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMS-NLVPPV 59

Query: 93  QRYHLLSHLTAAQNVEIPA 111
           +  +  +       + +  
Sbjct: 60  ELANPENQFRVDYILSVMN 78


>2a1fF [x.x.x] URIDYLATE KINASE
          Length = 234

 Score = 83.9 bits (206), Expect = 1e-18
 Identities = 10/85 (11%), Positives = 25/85 (29%), Gaps = 6/85 (7%)

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPL 205
           S    +R+ +  +        L  E    +D    + +   +++L + G  V +V     
Sbjct: 1   SQPIYKRILLKLSG-----EALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 206 IAAQ-AERIIEIHDGKIVHNPPAEE 229
           +          ++     H      
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLAT 80


>1e9sM [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 425

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 22/229 (9%), Positives = 51/229 (22%), Gaps = 12/229 (5%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 22  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 77

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 78  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL 131

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                          S                     R L +   +   D+  G L+   
Sbjct: 132 SVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTL 191

Query: 180 GEEVMAILRQL-RDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPA 227
            E + A   +  +       +++                   +      
Sbjct: 192 AESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGG 240


>3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 284

 Score = 82.9 bits (203), Expect = 2e-18
 Identities = 15/237 (6%), Positives = 54/237 (22%), Gaps = 19/237 (8%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               N++            L  ++        V I      GK+                
Sbjct: 18  SADGNITGVPSG----FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDV 73

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   ++   +              I     + +    A   +  +   G         
Sbjct: 74  VNLHSLEMGKKEN---------IKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEI 124

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     + +        +   +++    R ++    + L +         +    +
Sbjct: 125 SNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQI 184

Query: 185 AILRQ--LRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKI---VHNPPAEEKKREQG 235
           +   +   R+    VI ++     +  + ++   + D +    +       +   + 
Sbjct: 185 SRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRD 241


>3dt4C [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 620

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 19/240 (7%), Positives = 43/240 (17%), Gaps = 20/240 (8%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           L + +          +  ++  I+      + +A    S  GK+ L  +   L       
Sbjct: 246 LRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVEC 305

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG---IXXXXX 121
                  +                      + +    +   N                  
Sbjct: 306 VGDDIAWMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAE 360

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                                +     + +            +          +D     
Sbjct: 361 TSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWES 420

Query: 182 E-----VMAILRQLRDRGHTVIIVTHDPLIA---AQAER----IIEIHDGKIVHNPPAEE 229
                    I    R  G  ++              A R        H GK++ + P   
Sbjct: 421 PEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPFAM 480


>3bb1A [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 252

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 21/229 (9%), Positives = 62/229 (27%), Gaps = 7/229 (3%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 9   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 66

Query: 63  GTYRVAGRDVSTLDPDALAQL--RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
             ++  G     +            +  G I   Y     L   ++  +      +    
Sbjct: 67  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVD 126

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         +  +           +  V++  A  +    +  DE          
Sbjct: 127 RLDAYRVDNLDKLVAKAITD-SFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEA-L 184

Query: 181 EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
            +V+     L+     V+I          ++  + + +G        + 
Sbjct: 185 LQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKV-LPNGIAWIPHLVQT 232


>1ek0A [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
          Length = 168

 Score = 82.3 bits (202), Expect = 4e-18
 Identities = 17/163 (10%), Positives = 42/163 (25%), Gaps = 6/163 (3%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G +  GKS+++      D   +    +    ++         ++ E +    Q   
Sbjct: 6   LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERF 65

Query: 97  LLSHLTAAQNVEIPAVY-----AGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
                          VY                             +      L  G ++
Sbjct: 66  ASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQEGGER 125

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDR 193
           +V+         +  L    T A    +  +V   I  ++  +
Sbjct: 126 KVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLK 168


>1d6jA [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 177

 Score = 82.0 bits (201), Expect = 4e-18
 Identities = 21/188 (11%), Positives = 43/188 (22%), Gaps = 22/188 (11%)

Query: 21  VAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDAL 80
           +   +   L+   G  + + G+S SGKSTL   L          +       +       
Sbjct: 5   LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNK 64

Query: 81  AQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY 140
                E       R         A +  I                          D    
Sbjct: 65  DLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR-------------DTARQ 111

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGA-----LDSHSGEEVM-AILRQLRDRG 194
                + G++  +      ++       + P              ++ +  I+  L  +G
Sbjct: 112 LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKG 171

Query: 195 HTVIIVTH 202
               +   
Sbjct: 172 ---YLPAK 176


>2bhjA [x.x.x] NITRIC OXIDE SYNTHASE
          Length = 414

 Score = 81.8 bits (201), Expect = 5e-18
 Identities = 11/184 (5%), Positives = 28/184 (15%), Gaps = 8/184 (4%)

Query: 57  LDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV----EIPAV 112
           +    SG                 + +  +      +             +    +    
Sbjct: 5   IKNWGSGEILHDTLHHKATSCLG-SIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYYGS 63

Query: 113 YAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPT 172
           +                     +        +L    +     A   +   Q        
Sbjct: 64  FKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFD 123

Query: 173 GALDSHSGEEVMAILRQLRD-RGHTVIIVTHDPLIAAQAERIIEIHDG--KIVHNPPAEE 229
               S + E    I R +     +  I             +          I +      
Sbjct: 124 ARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMP 183

Query: 230 KKRE 233
               
Sbjct: 184 DGTI 187


>3d3qA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 294

 Score = 81.6 bits (200), Expect = 6e-18
 Identities = 21/263 (7%), Positives = 55/263 (20%), Gaps = 28/263 (10%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL----RREHFG 89
             ++ IVG + SGK+ L   +         +                 +           
Sbjct: 2   PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDIL 61

Query: 90  FIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
                +        A+         G                            +    +
Sbjct: 62  PPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKKQVKLK 121

Query: 150 -------------QQRVSIARALMNGGQVILADEPTGALDSHSGEEVM-----AILRQLR 191
                        +   S  +                A++ +   + +      + +   
Sbjct: 122 LKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTE 181

Query: 192 DRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQF 250
           +    +I +     L     +R+  +  G         E+  E     A+     G+++ 
Sbjct: 182 NYDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAI-----GYKEL 236

Query: 251 ASSFREALSMAWLAMAANKMRTL 273
               +  +S   +       R  
Sbjct: 237 VPVIKGNISENAVEKLKQHSRQY 259


>1bmfC [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
          Length = 492

 Score = 81.6 bits (200), Expect = 6e-18
 Identities = 20/230 (8%), Positives = 53/230 (23%), Gaps = 34/230 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
              ++   +V     +G        D  + I  G+   I+G   +GK+++        K 
Sbjct: 115 APGIIPRISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKR 170

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
            +       +           +               + +                    
Sbjct: 171 FNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSA-------------- 216

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         +     P   L+      +           +I+ D+ +    ++  
Sbjct: 217 --------------TASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR- 261

Query: 181 EEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
           +  + + R      +   +      L+   A+       G +   P  E 
Sbjct: 262 QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIET 311


>3c8uA [x.x.x] FRUCTOKINASE
          Length = 203

 Score = 81.5 bits (200), Expect = 6e-18
 Identities = 28/221 (12%), Positives = 51/221 (23%), Gaps = 27/221 (12%)

Query: 13  SYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDV 72
           +  +  + V  L+ +  +    ++VA+ G  GSGKSTL N L            V     
Sbjct: 2   TLAALCQGV--LERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPD-- 57

Query: 73  STLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXX 132
                             + +   LL    A +  +                        
Sbjct: 58  -----------GFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLC--------HALKHQER 98

Query: 133 XXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS---GEEVMAILRQ 189
                 D        G  +     R  +  G  +L D P     +        +      
Sbjct: 99  VIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPADL 158

Query: 190 LRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
                   +    +   A   A+     +   I       +
Sbjct: 159 EARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPAD 199


>2c7cH [x.x.x] 60 KDA CHAPERONIN
          Length = 522

 Score = 81.4 bits (200), Expect = 7e-18
 Identities = 22/233 (9%), Positives = 49/233 (21%), Gaps = 24/233 (10%)

Query: 21  VAVLKDISLQIHAGEMVA-IVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDA 79
           V+V ++I L+     M A +V    S  +             +      G        + 
Sbjct: 52  VSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNP 111

Query: 80  LAQLR---------------------REHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
           +   R                                   S  T  + +       G   
Sbjct: 112 MDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEG 171

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                            + + +    LS     +       +    ++LAD+    +   
Sbjct: 172 VITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREM 231

Query: 179 SGEEVM-AILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
                  A   +        +       L+      I+++   K        +
Sbjct: 232 LPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRK 284


>3dfqC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 353

 Score = 81.4 bits (200), Expect = 7e-18
 Identities = 11/92 (11%), Positives = 31/92 (33%), Gaps = 1/92 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVHNPPAEEKK 231
           T D  +       I+         +      +
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKADDGRPFPQ 95


>2d0kA [x.x.x] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 81.4 bits (200), Expect = 7e-18
 Identities = 14/96 (14%), Positives = 27/96 (28%), Gaps = 2/96 (2%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRG 194
            + +     +  G+    SI R L     +IL+ +P         + V   +        
Sbjct: 31  FKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPE 90

Query: 195 HTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
             VI           +A+++   H    V       
Sbjct: 91  IFVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFP 126


>1dekA [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
          Length = 240

 Score = 81.3 bits (199), Expect = 7e-18
 Identities = 18/220 (8%), Positives = 37/220 (16%), Gaps = 12/220 (5%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLR------REHFG 89
           ++ + GV  SGK T  + +               +D         A         +E  G
Sbjct: 3   LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEG 62

Query: 90  FIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
             + R   L+         +   +  +                  S              
Sbjct: 63  IDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVIN 122

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ 209
                 +   +                       +  L +        I+          
Sbjct: 123 NIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMD 182

Query: 210 --AERIIEIHDGKIV---HNP-PAEEKKREQGVDAAVVNT 243
                   +          N     E          V+  
Sbjct: 183 AARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITN 222


>3di4A [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
          Length = 275

 Score = 80.9 bits (198), Expect = 9e-18
 Identities = 16/234 (6%), Positives = 38/234 (16%), Gaps = 14/234 (5%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           S         V   +    ++ AG+   I  V G     L             + +    
Sbjct: 43  SARKTGEVL-VPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRAL 101

Query: 71  DVSTLDPDALAQLRREHFGFIFQR----YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXX 126
             + +           +                        ++                 
Sbjct: 102 HGTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGH 161

Query: 127 XXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALM-----NGGQVILADEPTGALDSHSGE 181
                     R     + L   + + V     +                P    D     
Sbjct: 162 YHHCCHSNLTRALADHTGLPLHEAELVHDVLNVFCTGFTRDTGQYFKASPVRPGDYLEFF 221

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
             + +L  L                      +      + + + P+        
Sbjct: 222 AEIDLLGNLSACPGGDCSSEASC----HPLLVEIFAPAEGLGDWPSPSVNGYDR 271


>1e9rF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 416

 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 24/203 (11%), Positives = 52/203 (25%), Gaps = 19/203 (9%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 22  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 77

Query: 65  YRVAGRDVSTLDPDAL----AQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
             +   +   L              +     +  ++ + +    Q   +  V  G     
Sbjct: 78  MVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK---- 133

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         S                     R L +   +   D+  G L+    
Sbjct: 134 ------TDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLA 187

Query: 181 EEVMAILRQLRDRGHTVIIVTHD 203
           E + A   +      +   V  D
Sbjct: 188 ESLFAGSNEASKALTSARFVLSD 210


>2czvB [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
          Length = 206

 Score = 80.5 bits (197), Expect = 1e-17
 Identities = 8/196 (4%), Positives = 37/196 (18%), Gaps = 16/196 (8%)

Query: 23  VLKDISLQIHAG-EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALA 81
             +   L      E+V  +  +       +          +         +         
Sbjct: 11  DKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQKF- 69

Query: 82  QLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYA--GIXXXXXXXXXXXXXXXXXXSDRVD 139
              + +  ++      +   +  + V+                                 
Sbjct: 70  ---KSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSL 126

Query: 140 YPPSQLSGGQQQRVS------IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR 193
            P    +  ++  +                +  L        D     +++++   +   
Sbjct: 127 RPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI--- 183

Query: 194 GHTVIIVTHDPLIAAQ 209
           G  +        +  +
Sbjct: 184 GMEIPQAKASISMYPE 199


>1cr0A [c.37.1] DNA PRIMASE/HELICASE
          Length = 241

 Score = 80.4 bits (197), Expect = 1e-17
 Identities = 28/240 (11%), Positives = 67/240 (27%), Gaps = 30/240 (12%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
            L    +V   +         + D +L    GE++ +   SG GKST +           
Sbjct: 8   HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G          +++  A   +   +   + Q   L   +      +              
Sbjct: 64  GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN----- 118

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQ--VILADEPTGALDSHSG 180
                        D      S       + ++    + +G    VI+ D  +  +     
Sbjct: 119 -------------DTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHIS--IRKMID 163

Query: 181 EEVMAILRQLRDRGHTVIIVTHDP---LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGV 236
             +  +    +  G  ++++ H      +   ++ II +   ++V           + G+
Sbjct: 164 NLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGI 223


>3d3qB [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 290

 Score = 80.0 bits (196), Expect = 2e-17
 Identities = 24/262 (9%), Positives = 62/262 (23%), Gaps = 29/262 (11%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
             ++ IVG + SGK+ L   +         +                     E       
Sbjct: 2   PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTT--EEEGIPHYID 59

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXS---DRVDYPPSQLSGGQQ 150
                +  +A +  +    Y                             +   +    + 
Sbjct: 60  ILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVKLKL 119

Query: 151 QRVS-IARALMNGGQVILADEPTGALDSHSGEEVMAILR----------------QLRDR 193
           + +  +    ++        E    +  ++ + V+  +                 Q  + 
Sbjct: 120 KELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTEN 179

Query: 194 GHTVIIVTHD--PLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFA 251
             T++I       L     +R+  +  G         E+  E     A+     G+++  
Sbjct: 180 YDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAI-----GYKELV 234

Query: 252 SSFREALSMAWLAMAANKMRTL 273
              +  +S   +       R  
Sbjct: 235 PVIKGNISENAVEKLKQHSRQY 256


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score = 80.0 bits (195), Expect = 2e-17
 Identities = 61/227 (26%), Positives = 94/227 (41%), Gaps = 16/227 (7%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           S    +    V V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TSG   +  +
Sbjct: 2   SVQLQN----VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK 57

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
            ++   P          +  +    ++   L  A   +                      
Sbjct: 58  RMNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQ----------RVNQVAE 107

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAIL-RQ 189
               +  +D  P  LSGGQ+QRV+I R L+    V L DEP   LD+    ++   + R 
Sbjct: 108 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 167

Query: 190 LRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQG 235
            +  G T+I VTHD + A   A++I+ +  G++       E      
Sbjct: 168 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPA 214



 Score = 45.7 bits (106), Expect = 4e-07
 Identities = 5/56 (8%), Positives = 12/56 (21%), Gaps = 3/56 (5%)

Query: 44  GSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLS 99
            S +  L+     +     G     G            +        + +   + S
Sbjct: 309 PSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHL--FREDGT-ACRRLHKEPGVAS 361


>3dfoC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 351

 Score = 79.9 bits (196), Expect = 2e-17
 Identities = 11/92 (11%), Positives = 31/92 (33%), Gaps = 1/92 (1%)

Query: 141 PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
            P+     +++   IA  ++  G+ ILA   +    +   + +     +   R +  +++
Sbjct: 4   HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL 63

Query: 201 THDP-LIAAQAERIIEIHDGKIVHNPPAEEKK 231
           T D  +       I+         +      +
Sbjct: 64  TADDRVNPCIGGVILFHETLYQKADDGRPFPQ 95


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score = 79.6 bits (194), Expect = 2e-17
 Identities = 58/232 (25%), Positives = 105/232 (45%), Gaps = 16/232 (6%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           ++E+ ++SR + +       L ++SL++ +GE   I+G +G+GK+  + ++     P SG
Sbjct: 1   MIEIESLSRKWKN-----FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSG 55

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
              + G+DV+ L P+            +F   ++  +L     ++               
Sbjct: 56  RILLDGKDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPK--------- 106

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEV 183
                         +D  P  LSGG+QQRV++ARAL+   +++L DEP  ALD  + E  
Sbjct: 107 RVLDTARDLKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENA 166

Query: 184 -MAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKRE 233
              +    +    TV+ +THD       A+RI  + DGK++     EE   +
Sbjct: 167 REMLSVLHKKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQVGKPEEIFEK 218



 Score = 47.2 bits (110), Expect = 1e-07
 Identities = 4/44 (9%), Positives = 9/44 (20%)

Query: 30  QIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVS 73
            +    +   V         +        + + G    A    S
Sbjct: 299 WVLGALVRVKVDCGVPLNVLITRRSAEEMELSPGVQIYARFKAS 342


>3a00A [x.x.x] GUANYLATE KINASE
          Length = 153

 Score = 79.5 bits (194), Expect = 3e-17
 Identities = 23/171 (13%), Positives = 44/171 (25%), Gaps = 23/171 (13%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAG---RDVSTLDPDALAQLRREHFGFI 91
             + I G SG+GKSTL+  L      + G    +         ++      +  + F  +
Sbjct: 2   RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSM 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            +    +     + N     V +                            + +     Q
Sbjct: 62  IKNNEFIEWAQFSGNYYGSTVASVK-------------------QVSKSGKTCILDIDMQ 102

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
            V   +A+       L   P     +H    V   L +   +     I   
Sbjct: 103 GVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAY-KELKDFIFAE 152


>3cmwC [x.x.x] PROTEIN RECA
          Length = 1608

 Score = 79.4 bits (194), Expect = 3e-17
 Identities = 25/211 (11%), Positives = 45/211 (21%), Gaps = 15/211 (7%)

Query: 26  DISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRR 85
             +  +  G +V I G   SGK+TL   +    +    T      + +            
Sbjct: 15  LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI------YA 68

Query: 86  EHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQL 145
              G            T  Q +EI    A                        +   S +
Sbjct: 69  RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHM 128

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPL 205
               +      R L    +                +  M I     +   T         
Sbjct: 129 GLAARMMSQAMRKLAGNLKQSNTL------LIFINQIRMKIGVMFGNPETTTGGNALKFY 182

Query: 206 IA-AQAERIIEIHDG--KIVHNPPAEEKKRE 233
            +     R I        +V +    +  + 
Sbjct: 183 ASVRLDIRRIGAVKEGENVVGSETRVKVVKN 213


>1e9sH [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 79.4 bits (194), Expect = 3e-17
 Identities = 26/221 (11%), Positives = 52/221 (23%), Gaps = 11/221 (4%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 27  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 82

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   +   L               I   Y   +   +  N                  
Sbjct: 83  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR 136

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     S                     R L +   +   D+  G L+    E + 
Sbjct: 137 GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF 196

Query: 185 AILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNP 225
           A   +      +   V  D L         +      + +P
Sbjct: 197 AGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP 237


>2bkhA [x.x.x] UNCONVENTIONAL MYOSIN
          Length = 787

 Score = 79.2 bits (193), Expect = 3e-17
 Identities = 14/233 (6%), Positives = 48/233 (20%), Gaps = 7/233 (3%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
                + +++    P               +   + + + G SG+GK+     +      
Sbjct: 108 TIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTE 167

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
           + GT +     +   +P         +   +              +    +   G     
Sbjct: 168 SYGTGQDIDDRIVEANPL---LEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSH 224

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARA-LMNGGQVILADEPTGALDSHS 179
                                    +G  +           +  + +         +  +
Sbjct: 225 YLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKET 284

Query: 180 GEEVM--AILRQLRDRGHTVIIVTHD-PLIAAQAERIIEIHDGKIVHNPPAEE 229
            ++++      +    G     +  D          + +I             
Sbjct: 285 DKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRV 337


>3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 409

 Score = 79.1 bits (193), Expect = 3e-17
 Identities = 15/219 (6%), Positives = 50/219 (22%), Gaps = 15/219 (6%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
            L  ++        V I      GK+                  +   ++   +     +
Sbjct: 157 ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENI---K 213

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
                 G I  +    +    A         A                    + +     
Sbjct: 214 RLIVTAGSINAQKIKAARRDFASEDWGKLSMAIG------EISNSNINIFDKAGQSVNYI 267

Query: 143 SQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM--AILRQLRDRGHTVIIV 200
              +   +++    R ++    + L +         +    +   + +  R+    VI +
Sbjct: 268 WSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIAL 327

Query: 201 THDP-LIAAQAERIIEIHDGKIVH---NPPAEEKKREQG 235
           +     +  + ++   + D +            +   + 
Sbjct: 328 SQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRD 366



 Score = 60.7 bits (145), Expect = 1e-11
 Identities = 5/68 (7%), Positives = 10/68 (14%)

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
            +    P     G         + L   GQ +        +     +             
Sbjct: 20  KECPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAAS 79

Query: 195 HTVIIVTH 202
                   
Sbjct: 80  VASTTTFK 87


>3bjdB [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
          Length = 318

 Score = 78.7 bits (193), Expect = 4e-17
 Identities = 23/213 (10%), Positives = 41/213 (19%), Gaps = 35/213 (16%)

Query: 49  TLMNILGCLDKPTSGTYRVAGRDVSTLDPDA-----------LAQLRREHFGFIFQRYHL 97
              ++   L        R+       L   A           LA L         Q Y  
Sbjct: 3   RNFSLPQ-LQNLPIEEARIVADA---LAVHATSRQIDSAASKLAALAEAGLKGDRQAYAA 58

Query: 98  LSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG--------- 148
              L              +                       +P + LS           
Sbjct: 59  YQQLL---------YVLSLSDDVATAQTRRWLARAIYRVEERFPAADLSRALSEEDFQKR 109

Query: 149 QQQRVSIARALMNG-GQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIA 207
            +Q ++      +    V         L      +     R  R     +++   D   A
Sbjct: 110 LEQEIAAQSRERHPSQYVFSGSASRAQLQVFLRHQWFRTFRLYR-DAADLLVNLTDVDEA 168

Query: 208 AQAERIIEIHDGKIVHNPPAEEKKREQGVDAAV 240
           A   R +    G+            +      +
Sbjct: 169 AALARYLYGELGEEDEKGSHPRLLAKLLEAIGL 201


>2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
          Length = 220

 Score = 78.6 bits (192), Expect = 5e-17
 Identities = 19/222 (8%), Positives = 41/222 (18%), Gaps = 24/222 (10%)

Query: 14  YPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVS 73
             +G + +     +      G +  + G   SGK+TL    G L           G    
Sbjct: 2   LSTGTKSL--DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSP 59

Query: 74  TLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV---------------EIPAVYAGIXX 118
                     +      +     L   +    +                +       +  
Sbjct: 60  ERLV------QMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDS 113

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                                         +     I    ++        +P       
Sbjct: 114 ITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLG 173

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDPLIA-AQAERIIEIHDG 219
              + +  L +L   G  V ++                   G
Sbjct: 174 YRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERG 215


>3cnlA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 233

 Score = 78.6 bits (192), Expect = 5e-17
 Identities = 22/155 (14%), Positives = 35/155 (22%), Gaps = 8/155 (5%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
            +    L       V IVGV  +GKST++N L          + +         P     
Sbjct: 80  KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDTPG---I 136

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
           L +  F        LL      + +E   ++                      D      
Sbjct: 137 LYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRG 196

Query: 143 SQLSGGQQQRVSIARALMNGGQ-----VILADEPT 172
               GG                      +  + P 
Sbjct: 197 LLKKGGVPDIERALMLFFTEVAQGKAGRVSFERPE 231


>2bv7A [x.x.x] GLYCOLIPID TRANSFER PROTEIN
          Length = 202

 Score = 78.4 bits (192), Expect = 5e-17
 Identities = 24/218 (11%), Positives = 50/218 (22%), Gaps = 34/218 (15%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGE-------MVAIVGVSGSGKSTLMNILGCLD 58
           E      +          L          +       + A+   + +   TL NIL    
Sbjct: 12  ETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPTKFRTLQNILEVEK 71

Query: 59  KPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXX 118
           +     +   G  ++               G  F +  L S     ++   P +      
Sbjct: 72  EMYGAEWPKVGATLAL---------MWLKRGLRFIQVFLQSICDGERDENHPNLIRVNAT 122

Query: 119 XXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                               +    +  G    +     AL          +      + 
Sbjct: 123 -----------------KAYEMALKKYHG-WIVQKIFQAALYAAPYKSDFLKALSKGQNV 164

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEI 216
           + EE +  +R         I V ++      AE   ++
Sbjct: 165 TEEECLEKVRLFLVNYTATIDVIYEMYTRMNAELNYKV 202


>3be4A [x.x.x] ADENYLATE KINASE
          Length = 215

 Score = 78.2 bits (191), Expect = 6e-17
 Identities = 11/206 (5%), Positives = 29/206 (14%), Gaps = 18/206 (8%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
                 + ++G  GSGK T    +         +     R+             +     
Sbjct: 2   NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIG---LEAKSIIES 58

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLS---- 146
                  +      +  ++     G                      +    + +     
Sbjct: 59  GNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEI 118

Query: 147 ---------GGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHT 196
                     G+    +  R                                ++ R    
Sbjct: 119 DDSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVF 178

Query: 197 VIIVTHDP-LIAAQAERIIEIHDGKI 221
                                     
Sbjct: 179 HKQTAPLVKFYEDLGILKRVNAKLPP 204


>3bczC [x.x.x] PROTEIN MEMO1
          Length = 284

 Score = 78.0 bits (190), Expect = 7e-17
 Identities = 15/223 (6%), Positives = 42/223 (18%), Gaps = 14/223 (6%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
           +   +    +    +   ++   +  L  +        +     AG            + 
Sbjct: 1   VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQ 60

Query: 84  RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPS 143
                           H+  ++                                      
Sbjct: 61  VDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTD 120

Query: 144 QLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH- 202
           +     +     A+A  +  +  +     GAL     +E   +  +       + +V+  
Sbjct: 121 EDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSD 180

Query: 203 -------------DPLIAAQAERIIEIHDGKIVHNPPAEEKKR 232
                        D         I  +  G I+          
Sbjct: 181 FCHWGQRFRYSYYDESQGEIYRSIEHLDKGSIIEQLDPVSFSN 223


>3czjA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 78.0 bits (190), Expect = 7e-17
 Identities = 6/122 (4%), Positives = 23/122 (18%), Gaps = 2/122 (1%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRGHTV 197
                 +S   +   +             A+       + +  + + I            
Sbjct: 777 LDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKT 836

Query: 198 IIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFRE 256
           + ++          +  I +        P          +                ++ +
Sbjct: 837 LFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPD 896

Query: 257 AL 258
            L
Sbjct: 897 RL 898



 Score = 38.0 bits (86), Expect = 8e-05
 Identities = 8/87 (9%), Positives = 17/87 (19%), Gaps = 12/87 (13%)

Query: 23   VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY------------RVAGR 70
            V    +        +        G            +    ++             + G 
Sbjct: 918  VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGF 977

Query: 71   DVSTLDPDALAQLRREHFGFIFQRYHL 97
             +     D+ +      F     RYH 
Sbjct: 978  HMGIGGDDSWSPSVSAEFQLSAGRYHY 1004


>2dr3D [x.x.x] UPF0273 PROTEIN PH0284
          Length = 242

 Score = 77.8 bits (190), Expect = 8e-17
 Identities = 25/231 (10%), Positives = 56/231 (24%), Gaps = 30/231 (12%)

Query: 11  SRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR 70
           +R   +G   V   + +   I    +V + G  G+GK+                      
Sbjct: 1   TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL 58

Query: 71  DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXX 130
           +   +      +     FG+  + Y                  +                
Sbjct: 59  EEHPVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKE-------------- 100

Query: 131 XXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD---SHSGEEVMAIL 187
                             +   V          + ++ D  T       + +   ++ + 
Sbjct: 101 -----YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLK 155

Query: 188 RQLRDRGHTVIIVTHDP-LIAAQAERIIE-IHDGKIVHNPPAEEKKREQGV 236
           R L   G T I V+             +E   DG I  +    + + ++ +
Sbjct: 156 RVLAGTGCTSIFVSQVSVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSL 206


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 77.6 bits (189), Expect = 9e-17
 Identities = 73/236 (30%), Positives = 110/236 (46%), Gaps = 12/236 (5%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           A ++L+NV++++        V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TS
Sbjct: 1   ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G   +  + ++   P           G +FQ Y L  HL+ A+N+      AG       
Sbjct: 57  GDLFIGEKRMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVIN 110

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                       +  +D  P  LSGGQ+QRV+I R L+    V L DEP   LD+    +
Sbjct: 111 QRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQ 170

Query: 183 VM-AILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGV 236
           +   I R  +  G T+I VTHD + A   A++I+ +  G++       E       
Sbjct: 171 MRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD 226


>2bhvA [x.x.x] COMB10
          Length = 191

 Score = 77.5 bits (190), Expect = 1e-16
 Identities = 14/162 (8%), Positives = 32/162 (19%), Gaps = 22/162 (13%)

Query: 89  GFIFQRYHLLSH-LTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSG 147
                   ++   L    + +I                         S  + Y  +    
Sbjct: 4   LRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM 63

Query: 148 GQQQ-RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILR-----------------Q 189
           G+ +  +  +R +   G  I+       L     E                         
Sbjct: 64  GEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITS 123

Query: 190 LRDRGHTVIIVTHDPLIAAQ-AERIIE--IHDGKIVHNPPAE 228
                  + ++    +   Q   +I+        IV      
Sbjct: 124 AFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGS 165


>1dw9A [a.35.1 - d.72.1] CYANATE LYASE
          Length = 152

 Score = 77.2 bits (189), Expect = 1e-16
 Identities = 9/130 (6%), Positives = 23/130 (17%), Gaps = 6/130 (4%)

Query: 25  KDISLQIHAGE-MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
             +  +         I   +G  ++ +   L       +   R+ G  +   +   L   
Sbjct: 16  AILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ 75

Query: 84  RREH-----FGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV 138
                           Y           ++                           +  
Sbjct: 76  IPLRGCIDDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGG 135

Query: 139 DYPPSQLSGG 148
           +     L G 
Sbjct: 136 ERAVITLDGK 145


>3dlbB [x.x.x] ARGONAUTE
          Length = 614

 Score = 77.2 bits (189), Expect = 1e-16
 Identities = 13/196 (6%), Positives = 29/196 (14%), Gaps = 18/196 (9%)

Query: 29  LQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHF 88
           + +    +       G G   L   +  L    SG + +                     
Sbjct: 122 VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLE-------------VDPAYRI 168

Query: 89  GFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG 148
                    L+           A                          +    +     
Sbjct: 169 LCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRL 228

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR-DRGHTVIIVTHDPLIA 207
           Q +       + +        +P   L           L     +R      +       
Sbjct: 229 QGREGGRVAWVAD---PKDPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRR 285

Query: 208 AQ-AERIIEIHDGKIV 222
                          +
Sbjct: 286 LGLGTPEAVRAQAYRL 301


>1culC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 328

 Score = 77.1 bits (189), Expect = 1e-16
 Identities = 10/75 (13%), Positives = 22/75 (29%), Gaps = 4/75 (5%)

Query: 33  AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
           A   + ++G   SGKST++  +  L      T     ++      +            + 
Sbjct: 1   ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIET----IVAAMSNLV 56

Query: 93  QRYHLLSHLTAAQNV 107
               L +     +  
Sbjct: 57  PPVELANPENQFRVD 71


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score = 77.1 bits (188), Expect = 1e-16
 Identities = 72/245 (29%), Positives = 108/245 (44%), Gaps = 16/245 (6%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
            L + ++ + Y   E    VLK +SLQ  AG++++I+G SGSGKST +  +  L+KP+ G
Sbjct: 2   KLHVIDLHKRYGGHE----VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEG 57

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSH---------LTAAQNVEIPAVYA 114
              V G++++ +          +       R  L            +T  +NV    +  
Sbjct: 58  AIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV 117

Query: 115 GIXXXXXXXXXXXXXXXXXXS--DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPT 172
                                        P  LSGGQQQRVSIARAL     V+L DEPT
Sbjct: 118 LGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT 177

Query: 173 GALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQAERIIEIHDGKIVHNPPAEEKK 231
            ALD     EV+ I++QL + G T+++VTH+       +  +I +H GKI      E+  
Sbjct: 178 SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVF 237

Query: 232 REQGV 236
                
Sbjct: 238 GNPQS 242


>3cm0A [x.x.x] ADENYLATE KINASE
          Length = 184

 Score = 76.6 bits (188), Expect = 2e-16
 Identities = 25/195 (12%), Positives = 46/195 (23%), Gaps = 24/195 (12%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G+ V  +G  G+GK T  + L         +     RD              E    I +
Sbjct: 2   GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTP-----LGERVRPIME 56

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV----------DYPPS 143
           R  L+      + +        I                                + P  
Sbjct: 57  RGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLL-SETGTRLLGVVLVEVPEE 115

Query: 144 QLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG-HTVIIVTH 202
           +L     +R  +             +E          E+   ++     RG    +    
Sbjct: 116 ELVRRILRRAELEGRSD------DNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLG 169

Query: 203 DP-LIAAQAERIIEI 216
            P  + A+    + I
Sbjct: 170 TPDEVYARIRAALGI 184


>3dymA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 76.2 bits (185), Expect = 2e-16
 Identities = 4/90 (4%), Positives = 22/90 (24%), Gaps = 3/90 (3%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGG--QVILADEPTGALDSHSGEEVMAILRQL-RD 192
                  + +   +  R+     +          A+       + +  + + I       
Sbjct: 772 FTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQ 831

Query: 193 RGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
                + ++        + ++    D ++ 
Sbjct: 832 HQGKTLFISRKTYRIDGSGQMAITVDVEVA 861


>1cjaA [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
          Length = 327

 Score = 76.0 bits (185), Expect = 3e-16
 Identities = 13/182 (7%), Positives = 41/182 (22%), Gaps = 9/182 (4%)

Query: 30  QIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALA-QLRREHF 88
            I   E+V  + ++    ++   +L        G+       V+  D   +A        
Sbjct: 142 NILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLPIAWTNEGNLD 201

Query: 89  GFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG 148
             +            ++ + + A +                     S         ++  
Sbjct: 202 NIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRD-IITLY 260

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-------RDRGHTVIIVT 201
               V    ++      +       + D  + E  +   ++              +  + 
Sbjct: 261 TGYDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESLQKCHNLSISPQAIPFIL 320

Query: 202 HD 203
             
Sbjct: 321 RM 322


>1ak2A [x.x.x] ADENYLATE KINASE ISOENZYME-2
          Length = 220

 Score = 75.6 bits (184), Expect = 4e-16
 Identities = 23/229 (10%), Positives = 51/229 (22%), Gaps = 14/229 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G    ++G  G+GK T    L               R +     +   +L+         
Sbjct: 3   GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV 62

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
              ++  L        P     +                    R +   S +       +
Sbjct: 63  SDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSL 122

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL--RDRGHTVIIVTHDP-LIAAQA 210
            I R                  +         I  +   R        +         Q 
Sbjct: 123 LIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQT 182

Query: 211 ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALS 259
             ++E +  + +H+     +  +             +    ++F +A S
Sbjct: 183 TPLVEYYSKRGIHSAIDASQTPDV-----------VFASILAAFSKATS 220


>1dekB [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
          Length = 230

 Score = 75.6 bits (184), Expect = 4e-16
 Identities = 15/189 (7%), Positives = 43/189 (22%), Gaps = 25/189 (13%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRY 95
           ++ + GV  SGK T  + +               +               +   + +  +
Sbjct: 3   LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIK---------------DALAYAWGVF 47

Query: 96  HLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSI 155
              +     +       Y                        ++     L+G    +   
Sbjct: 48  AANTDYPLTRKEFEGIDYDRETNLNLTKLEVI--------TIMEQAFCYLNGKSPIKGVF 99

Query: 156 ARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH-TVIIVTHDPLIAAQAERII 214
                   + +         D  +  E    +R+L       +I+   D +   +   + 
Sbjct: 100 VFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALD 158

Query: 215 EIHDGKIVH 223
            +      +
Sbjct: 159 YLDKFNSGY 167


>3bv4A [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 341

 Score = 75.3 bits (184), Expect = 5e-16
 Identities = 11/83 (13%), Positives = 30/83 (36%), Gaps = 1/83 (1%)

Query: 142 PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVT 201
           P+     +++   IA  ++  G+ ILA + +    +   + +     +   R +  +++T
Sbjct: 2   PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLT 61

Query: 202 HDP-LIAAQAERIIEIHDGKIVH 223
            D  +       I+         
Sbjct: 62  ADDRVNPCIGGVILFHETLYQKA 84


>1dhiA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 75.3 bits (184), Expect = 5e-16
 Identities = 16/135 (11%), Positives = 31/135 (22%), Gaps = 12/135 (8%)

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           +      A +  I                           + +     +  G+    SI 
Sbjct: 2   ISLIAALAVDRVIGM----------ENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIG 51

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRGHTVIIVTHDP-LIAAQAERII 214
           R L     +IL+ +P         + V   +          VI           +A+++ 
Sbjct: 52  RPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLY 111

Query: 215 EIHDGKIVHNPPAEE 229
             H    V       
Sbjct: 112 LTHIDAEVEGDTHFP 126


>1eilA [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
          Length = 289

 Score = 75.2 bits (183), Expect = 5e-16
 Identities = 11/96 (11%), Positives = 23/96 (23%), Gaps = 3/96 (3%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM--AILRQLRDR 193
             +      ++ G     ++ RA     ++ +       L     E     A+ R     
Sbjct: 20  HFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADKL 79

Query: 194 GHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
               +  T     A   +R +              E
Sbjct: 80  RQAGVAFTRGD-EALMQQRKVMGLLCLQDPFGLPLE 114


>1e2gA [c.37.1] THYMIDYLATE KINASE
          Length = 205

 Score = 75.1 bits (183), Expect = 5e-16
 Identities = 14/190 (7%), Positives = 33/190 (17%), Gaps = 16/190 (8%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G ++ + GV  +GKST    L            +      +           +      Q
Sbjct: 3   GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-------TEIGKLLSSYLQ 55

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
           +   +   +                                   V +  ++ +       
Sbjct: 56  KKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQAER 212
                L     V+                                 +     L+      
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQLMKDTTLN 167

Query: 213 IIEIHDGKIV 222
              +   K +
Sbjct: 168 WKMVDASKSI 177


>3crmA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 236

 Score = 75.1 bits (183), Expect = 5e-16
 Identities = 18/208 (8%), Positives = 42/208 (20%), Gaps = 14/208 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              + ++G + +GK+ L   L         +   A          A    +         
Sbjct: 3   PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIGTA----KPSRELLARY 58

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
            + L+     A++       A                             +         
Sbjct: 59  PHRLIDIRDPAESYSAAEFRADALAAMAKATARGRIPLL---VGGTMLYYKALLEGLPYT 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG--HTVIIVTHDPLIAAQAE 211
               A+    + +L             +  +A +  L  R   H  +            +
Sbjct: 116 VAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWD 175

Query: 212 RIIEIHDGKIVHNPPAEEKKREQGVDAA 239
            +        +      E+        A
Sbjct: 176 YLDGKLSYAEM-----TERGIIATRQLA 198


>1c9kC [c.37.1] ADENOSYLCOBINAMIDE KINASE
          Length = 165

 Score = 74.8 bits (182), Expect = 7e-16
 Identities = 17/187 (9%), Positives = 38/187 (20%), Gaps = 25/187 (13%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRY 95
           M+ + G + SGKS     L                             R  H+       
Sbjct: 1   MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHK--------DGRPAHWRTARHLD 52

Query: 96  HLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSI 155
            L++   A  +  +      +                          +       +   +
Sbjct: 53  TLITADLAPDDAILLECITTMVTNLLFALGD---------PEQWDYAAMERAIDDEIQIL 103

Query: 156 ARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIE 215
             A       ++       +       +    R +  R +  +    D         +  
Sbjct: 104 IAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD--------EVWL 155

Query: 216 IHDGKIV 222
           +  G  V
Sbjct: 156 VVSGIGV 162


>3c14C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 329

 Score = 74.4 bits (181), Expect = 9e-16
 Identities = 9/64 (14%), Positives = 21/64 (32%)

Query: 33 AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
          A   + ++G   SGKST++  +  L        +V     +  +          +     
Sbjct: 1  ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVPPV 60

Query: 93 QRYH 96
          +  +
Sbjct: 61 ELAN 64


>2ck3C [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
          Length = 490

 Score = 74.3 bits (181), Expect = 9e-16
 Identities = 21/230 (9%), Positives = 54/230 (23%), Gaps = 34/230 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
              ++   +V     +G        D  + I  G+   I+G   +GK+++        K 
Sbjct: 113 APGIIPRISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKR 168

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
            +       +             ++        +    +       V             
Sbjct: 169 FNDGTDEKKKLYCIYVAIG----QKRSTVAQLVKRLTDADAMKYTIVVSATASD------ 218

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                               P   L+      +           +I+ D+ +    ++  
Sbjct: 219 ------------------AAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR- 259

Query: 181 EEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
           +  + + R      +   +      L+   A+       G +   P  E 
Sbjct: 260 QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIET 309


>1e9sL [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 426

 Score = 74.0 bits (180), Expect = 1e-15
 Identities = 22/225 (9%), Positives = 49/225 (21%), Gaps = 12/225 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 27  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 82

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   +   L               I   Y   +   +  N                  
Sbjct: 83  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR 136

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     S                     R L +   +   D+  G L+    E + 
Sbjct: 137 GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF 196

Query: 185 AILRQL-RDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAE 228
           A   +  +       +++                   +       
Sbjct: 197 AGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGN 241


>1bglA [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
          Length = 1021

 Score = 73.9 bits (179), Expect = 1e-15
 Identities = 4/80 (5%), Positives = 20/80 (25%), Gaps = 1/80 (1%)

Query: 145 LSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRGHTVIIVTHD 203
           +S   +   +             A+       + +  + + I            + ++  
Sbjct: 793 VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRK 852

Query: 204 PLIAAQAERIIEIHDGKIVH 223
                 + ++    D ++  
Sbjct: 853 TYRIDGSGQMAITVDVEVAS 872


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 73.7 bits (179), Expect = 1e-15
 Identities = 45/246 (18%), Positives = 81/246 (32%), Gaps = 14/246 (5%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +L ++++  S         +L+ +SL +H GE+ AI+G +GSGKSTL   L   +     
Sbjct: 1   MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVT 56

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
              V  +    L      +     F        +                          
Sbjct: 57  GGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLD 116

Query: 124 XXXXXXXXXXX--------SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL 175
                                         SGG+++R  I +  +   ++ + DE    L
Sbjct: 117 RFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGL 176

Query: 176 DSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ--AERIIEIHDGKIVHNPPAEEKKRE 233
           D  + + V   +  LRD   + IIVTH   I      + +  ++ G+IV +      K+ 
Sbjct: 177 DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQL 236

Query: 234 QGVDAA 239
           +     
Sbjct: 237 EEQGYG 242


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 73.7 bits (179), Expect = 1e-15
 Identities = 46/239 (19%), Positives = 87/239 (36%), Gaps = 7/239 (2%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           + LE+R++  S         +LK ++L +  GE+ A++G +G+GKSTL  IL    + T 
Sbjct: 1   SQLEIRDLWASIDGET----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTV 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
               +     + L+     +  R+     FQ   +     A           G       
Sbjct: 57  ERGEILLDGENILELSP-DERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAE 115

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                            Y    L+ G+++R  I + L+      + DE    LD  + + 
Sbjct: 116 FWTKVKKALELLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKV 175

Query: 183 VMAILRQLRDRGHTVIIVTHDP--LIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
           V   +  +R      +++TH    L   Q +++  + DG++V     E     +     
Sbjct: 176 VARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYE 234


>3brwA [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
          Length = 336

 Score = 73.3 bits (178), Expect = 2e-15
 Identities = 24/247 (9%), Positives = 44/247 (17%), Gaps = 39/247 (15%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
             LE    +R Y             SL    G +V  +     G    + +L      T 
Sbjct: 4   VKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTY 63

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
                        +   +A+L  E          L    +                    
Sbjct: 64  HDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDE------------ 111

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                           ++    +               N  +     E    L      +
Sbjct: 112 -----------HVISNNFKFGVIYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQ 159

Query: 183 VMAILRQ-----LRDRGHTVIIVTHDP----------LIAAQAERIIEIHDGKIVHNPPA 227
                R          G   +                L   + +         I ++  A
Sbjct: 160 DFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVA 219

Query: 228 EEKKREQ 234
              + E 
Sbjct: 220 VVFQDEN 226


>3bb1G [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 251

 Score = 73.3 bits (178), Expect = 2e-15
 Identities = 15/228 (6%), Positives = 50/228 (21%), Gaps = 6/228 (2%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 9   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 66

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
             ++  G     +                      ++ +                     
Sbjct: 67  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVD 126

Query: 123 XXXXXXXXXXXXSDRVDY-PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                                       +  V++  A  +    +  DE          +
Sbjct: 127 RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ 186

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
            V             V+++ +             + +G        + 
Sbjct: 187 VVR---SGASLSDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQT 231


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 73.0 bits (177), Expect = 2e-15
 Identities = 46/247 (18%), Positives = 85/247 (34%), Gaps = 17/247 (6%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +L ++++  S         +L+ +SL +H GE+ AI+G +GSGKSTL   L   +     
Sbjct: 1   MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVT 56

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV---------EIPAVYA 114
              V  +    L   +      E     FQ    +  ++    +                
Sbjct: 57  GGTVEFKGK-DLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETL 115

Query: 115 GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                          SGG+++R  I +  +   ++ + DE  G 
Sbjct: 116 DRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGL 175

Query: 175 LDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ--AERIIEIHDGKIVHNPPAEEKKR 232
               + + V   +  LRD   + IIVTH   I      + +  ++ G+IV +      K+
Sbjct: 176 DI-DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ 234

Query: 233 EQGVDAA 239
            +     
Sbjct: 235 LEEQGYG 241


>2ccjA [x.x.x] THYMIDYLATE KINASE
          Length = 196

 Score = 73.0 bits (177), Expect = 2e-15
 Identities = 21/199 (10%), Positives = 44/199 (22%), Gaps = 14/199 (7%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQR 94
             +   G  GSGK+T++N +                                    I + 
Sbjct: 2   AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPG------------GVPTGEEIRKI 49

Query: 95  YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
               + +       + A                          +D   +     +   V 
Sbjct: 50  VLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVE 109

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDRGHTVIIVTHDPLIAAQ-AER 212
             RAL       L  + T  L+  +       I    R     +           +   R
Sbjct: 110 EVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHR 169

Query: 213 IIEIHDGKIVHNPPAEEKK 231
              ++  + + N   +  +
Sbjct: 170 FKSVNADQPLENVVEDTYQ 188


>1e2hB [c.37.1] THYMIDINE KINASE
          Length = 311

 Score = 72.9 bits (177), Expect = 2e-15
 Identities = 26/257 (10%), Positives = 54/257 (21%), Gaps = 11/257 (4%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALA------QLR 84
           +     V I G  G GK+T   +L  L       Y         +   +           
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 85  REHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXX---SDRVDYP 141
           R   G I      +   +A   + +P                                  
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAA 120

Query: 142 PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHTVIIV 200
                  +    S+    +     ++     G             + +L  R    ++  
Sbjct: 121 LLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA 180

Query: 201 THDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALSM 260
               +    A  +  +  G        +    +             +  F +    A + 
Sbjct: 181 IRR-VYGLLANTVRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRAPELLAPNG 239

Query: 261 AWLAMAANKMRTLLTML 277
               + A  +  L   L
Sbjct: 240 DLYNVFAWALDVLAKRL 256


>3c15C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 334

 Score = 72.9 bits (177), Expect = 2e-15
 Identities = 9/70 (12%), Positives = 22/70 (31%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
             A   + ++G   SGKST++  +  L        +V     +  +          +   
Sbjct: 2   YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVP 61

Query: 91  IFQRYHLLSH 100
             +  +  + 
Sbjct: 62  PVELANPENQ 71


>2aunA [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 72.6 bits (177), Expect = 3e-15
 Identities = 12/137 (8%), Positives = 28/137 (20%), Gaps = 1/137 (0%)

Query: 95  YHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVS 154
                       +   +  A                       V+     L+G  +QR+ 
Sbjct: 5   QTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLE 64

Query: 155 IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT-VIIVTHDPLIAAQAERI 213
                 +   +       G          +   R         +       L++A     
Sbjct: 65  DLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHG 124

Query: 214 IEIHDGKIVHNPPAEEK 230
           +    G +      +E+
Sbjct: 125 LPAIHGPVATGLGLQER 141


>1e2iA [c.37.1] THYMIDINE KINASE
          Length = 300

 Score = 72.5 bits (176), Expect = 3e-15
 Identities = 15/207 (7%), Positives = 38/207 (18%), Gaps = 15/207 (7%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRR-EHFG 89
           +     V I G  G GK+  +  +                         L Q        
Sbjct: 1   MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDA 60

Query: 90  FIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
            +      ++        +                          +  + YP ++   G 
Sbjct: 61  AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGS 120

Query: 150 QQRVSIARALMNGGQVILADEPTGALDS-------------HSGEEVMAILRQLRDRGHT 196
               ++   +      +                              +A+L  +R     
Sbjct: 121 MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL 180

Query: 197 VIIVTH-DPLIAAQAERIIEIHDGKIV 222
           +           +  E   ++      
Sbjct: 181 LANTVRYLQCGGSWREDWGQLSGTGPR 207


>3cueF [x.x.x] GTP-BINDING PROTEIN YPT1
          Length = 166

 Score = 72.1 bits (175), Expect = 4e-15
 Identities = 20/167 (11%), Positives = 41/167 (24%), Gaps = 1/167 (0%)

Query: 30  QIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFG 89
           +      + ++G SG GKS L+         T G                L         
Sbjct: 1   EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTVKLQI-WDTAGQ 59

Query: 90  FIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQ 149
             F+      +  +   + +  V                      +       ++     
Sbjct: 60  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKD 119

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
           ++ V    A        +    T ALDS + E+    + +      +
Sbjct: 120 KRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS 166


>1akeA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score = 71.5 bits (173), Expect = 7e-15
 Identities = 19/215 (8%), Positives = 43/215 (20%), Gaps = 22/215 (10%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRY 95
            + ++G  G+GK T    +         +     R       +   Q +           
Sbjct: 2   RIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTD 61

Query: 96  HLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSI 155
            L+         E  A                        +        L       + +
Sbjct: 62  ELVIA----LVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIV 117

Query: 156 ARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD-----------------RGHTVI 198
            R +                +    E    +  +                       T  
Sbjct: 118 DRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAP 177

Query: 199 IVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKR 232
           ++ +      A   +  ++   K V    A+ +K 
Sbjct: 178 LIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKI 212


>3ec1A [x.x.x] YQEH GTPASE
          Length = 311

 Score = 71.4 bits (173), Expect = 7e-15
 Identities = 24/208 (11%), Positives = 54/208 (25%), Gaps = 8/208 (3%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
            + +   +   G  V +VG +  GKST +N +             +    +TLD   +  
Sbjct: 93  KVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTLDMIEIPL 152

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXX-SDRVDYP 141
                 G        + +     +         I                          
Sbjct: 153 ----ESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLAR 208

Query: 142 PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVT 201
              + GG++  V      +   +    ++      +  GE +    ++         +V 
Sbjct: 209 LDYIKGGRRSFVCYMANELTVHRTK-LEKADSLYANQLGELLSPPSKRYAA--EFPPLVP 265

Query: 202 HDPLIAAQAERIIEIHDGKIVHNPPAEE 229
               +  +   I+    G +  N P  +
Sbjct: 266 RSLSVKERKTDIVFSGLGWVTCNDPGAQ 293


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 71.1 bits (172), Expect = 9e-15
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 3  ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
          A ++L+NV++++        V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TS
Sbjct: 1  ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS 56

Query: 63 GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
          G   +  + ++   P             +     
Sbjct: 57 GDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQ 90



 Score = 42.6 bits (98), Expect = 3e-06
 Identities = 6/65 (9%), Positives = 13/65 (20%), Gaps = 3/65 (4%)

Query: 29  LQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHF 88
           +    G    I     S +  L+     +     G     G            +      
Sbjct: 263 VVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPE--RCHLFREDGT-AC 319

Query: 89  GFIFQ 93
             + +
Sbjct: 320 RRLHK 324


>2aumA [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 71.0 bits (173), Expect = 9e-15
 Identities = 13/142 (9%), Positives = 25/142 (17%), Gaps = 6/142 (4%)

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                        +   +  A                       V+     L+G  +QR+
Sbjct: 4   DQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRL 63

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
                  +   +       G          +   R        +I               
Sbjct: 64  EDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI-----SVLLS 118

Query: 214 IEIHDGKIV-HNPPAEEKKREQ 234
                G    H P A     ++
Sbjct: 119 AFHRHGLPAIHGPVATGLGLQE 140


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 71.0 bits (172), Expect = 9e-15
 Identities = 38/245 (15%), Positives = 77/245 (31%), Gaps = 15/245 (6%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +L ++++  S         +L+ +SL +H GE+ AI+G +GSGKSTL   L   +     
Sbjct: 1   MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVT 56

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQN---------VEIPAVYA 114
              V  +        +      E     FQ    +  ++                     
Sbjct: 57  GGTVEFKGKDL-LALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETL 115

Query: 115 GIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGA 174
                                          SGG+++R  I +  +   ++ + DE    
Sbjct: 116 DRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDI 175

Query: 175 LDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
                  + +  LR    R   ++      L   + + +  ++ G+IV +      K+ +
Sbjct: 176 DALKVVADGVNSLRD-GKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLE 234

Query: 235 GVDAA 239
                
Sbjct: 235 EQGYG 239


>2boeX [x.x.x] ENDOGLUCANASE E-2
          Length = 281

 Score = 70.9 bits (173), Expect = 1e-14
 Identities = 13/103 (12%), Positives = 38/103 (36%), Gaps = 7/103 (6%)

Query: 139 DYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG------EEVMAILRQLRD 192
            + P Q++G     +S A+A      +++++ P       +         +      L++
Sbjct: 43  HHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSHSAYRSWIDEFAAGLKN 102

Query: 193 RGHTVIIVTHD-PLIAAQAERIIEIHDGKIVHNPPAEEKKREQ 234
           R   +I+      L+++  + + +     + +   A +    Q
Sbjct: 103 RPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQ 145


>1e9sI [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 26/230 (11%), Positives = 57/230 (24%), Gaps = 34/230 (14%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDK 59
           + +  +L+ ++R           +  + +   A    + + G +G+GKS L+  L     
Sbjct: 22  IVSGGKLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGL 77

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
                  +   +   L               I   Y   +   +  N             
Sbjct: 78  LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ---- 127

Query: 120 XXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHS 179
                             +   P   +   ++  S  R L+      LA   T ++    
Sbjct: 128 ---------------RYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF 172

Query: 180 GEEVMAILRQLRDRGHTVIIVTHDPLIAAQAE----RIIEIHDGKIVHNP 225
               +A    LR      +  +        ++        + D    H  
Sbjct: 173 HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT 222


>3dauA [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 70.6 bits (172), Expect = 1e-14
 Identities = 17/135 (12%), Positives = 32/135 (23%), Gaps = 12/135 (8%)

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           +      A +  I    A                      + +     +  G+    SI 
Sbjct: 2   ISLIAALAVDRVIGMENAMPWNLPADLAW----------FKRNTLNKPVIMGRHTWESIG 51

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILR-QLRDRGHTVIIVTHDP-LIAAQAERII 214
           R L     +IL+ +P         + V   +          VI           +A+++ 
Sbjct: 52  RPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLY 111

Query: 215 EIHDGKIVHNPPAEE 229
             H    V       
Sbjct: 112 LTHIDAEVEGDTHFP 126


>2aunB [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 70.6 bits (172), Expect = 1e-14
 Identities = 14/101 (13%), Positives = 24/101 (23%), Gaps = 4/101 (3%)

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
              V+     L+G  +QR+       +   +       G          +   R      
Sbjct: 43  GRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASP 102

Query: 195 HTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
             +I  +               H    +H P A     EQ 
Sbjct: 103 RPLIGFSDIS----VLLSAFHRHGLPAIHGPVATGLGLEQQ 139


>2bofX [x.x.x] ENDOGLUCANASE E-2
          Length = 278

 Score = 70.2 bits (171), Expect = 2e-14
 Identities = 16/205 (7%), Positives = 43/205 (20%), Gaps = 35/205 (17%)

Query: 60  PTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXX 119
           P   +      + +      +             R   +   T   +     +   +   
Sbjct: 7   PNMSSAEWVRNNPNDPRTPVI-----------RDRIASVPQGTWFAHHNPGQITGQVDAL 55

Query: 120 XXXXXXXXXXXXXXXSDRVDY-PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                          S+       +      +  +    A +      +  EP       
Sbjct: 56  MSAAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMS 115

Query: 179 SGEEVMAILRQLRDR--------GHTVIIVTHDPLIA---AQAERIIEIHDGKIV----- 222
           S  + +                 G +   +  D   +   + A+    +    I      
Sbjct: 116 SCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHG 175

Query: 223 -------HNPPAEEKKREQGVDAAV 240
                  +   A+E    + V +A+
Sbjct: 176 IATNTSNYRWTADEVAYAKAVLSAI 200


>3bb1H [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 248

 Score = 69.8 bits (169), Expect = 2e-14
 Identities = 14/235 (5%), Positives = 49/235 (20%), Gaps = 20/235 (8%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
               +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      + 
Sbjct: 3   GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI 60

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
             ++  G     +                      ++ +                     
Sbjct: 61  SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDK--------- 111

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                                ++    +            G    A            + 
Sbjct: 112 -------TIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDG 164

Query: 183 VMAILRQ--LRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
           +          +    V+         +    ++  + G+   N   E+      
Sbjct: 165 LPYDEFFSKRSEALLQVVRSGASLKKDSDIPVVLIENSGRCNKNDSDEKVLPNGI 219


>3cmvB [x.x.x] PROTEIN RECA
          Length = 1163

 Score = 69.4 bits (168), Expect = 3e-14
 Identities = 23/250 (9%), Positives = 52/250 (20%), Gaps = 35/250 (14%)

Query: 7   LRNVSRSYPSGEEQVAVLKDISL--QIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +  +S            L        +  G +V I G   SGK+TL   +    +    T
Sbjct: 1   VETISTGSL-------SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 53

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
                 + +               G            T  Q +EI    A          
Sbjct: 54  CAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-----GAV 102

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH------ 178
                              ++S        +++A+      +          +       
Sbjct: 103 DVIVVDSVAALTPKAEIEGEISHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALK 162

Query: 179 ---------SGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
                         +     +      V +V +      +      ++   I       +
Sbjct: 163 FYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVD 222

Query: 230 KKREQGVDAA 239
              ++ +   
Sbjct: 223 LGVKEKLIEK 232



 Score = 65.6 bits (158), Expect = 4e-13
 Identities = 21/227 (9%), Positives = 50/227 (22%), Gaps = 30/227 (13%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
               +V             +   +  +  G +V I G   SGK+TL   +    +    T
Sbjct: 301 DRSMDVETISTGSLSLD--IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 358

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLT---------AAQNVEIPAVYAG 115
                 + +     A             Q       L          A   + + +V A 
Sbjct: 359 CAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAAL 418

Query: 116 IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL 175
                                      +++     ++++      N   + +        
Sbjct: 419 T------------------PKAEIGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALK 460

Query: 176 DSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
              S    +  +  ++  G  V+       +               +
Sbjct: 461 FYASVRLDIRRIGAVK-EGENVVGSETRVKVVKNKIAAPFKQAEFQI 506



 Score = 61.3 bits (147), Expect = 7e-12
 Identities = 25/225 (11%), Positives = 53/225 (23%), Gaps = 11/225 (4%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
           E R++     S       +   +  +  G +V I G   SGK+TL   +    +    T 
Sbjct: 598 EDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTC 657

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXX 125
                + +               G            T  Q +EI    A           
Sbjct: 658 AFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALAR--SGAVDVIV 709

Query: 126 XXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMA 185
                       +      +S   ++     +   N   + +           S    + 
Sbjct: 710 VDSVAALTPKAEIGLAARMMSQAMRKLAGNLKQ-SNTLLIFINQGGNALKFYASVRLDIR 768

Query: 186 ILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHD-GKIVHNPPAEE 229
            +  ++  G  V+       +              +I++      
Sbjct: 769 RIGAVK-EGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINF 812


>2dpyB [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
          Length = 426

 Score = 69.4 bits (169), Expect = 3e-14
 Identities = 18/197 (9%), Positives = 46/197 (23%), Gaps = 7/197 (3%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
               L+   +     +G        +  L +  G+ + +   SG GKS L+ ++    + 
Sbjct: 116 PFNPLQRTPIEHVLDTGV----RAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRA 171

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                 + G     +                       + ++    ++  A    I    
Sbjct: 172 DVIVVGLIGERGREVKDFIENI-LGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDF 230

Query: 121 XXXXXXXXXXXXXXSDRVD-YP-PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSH 178
                         +         +   G          ++      ++     G     
Sbjct: 231 RDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGG 290

Query: 179 SGEEVMAILRQLRDRGH 195
           S      +L +  D+  
Sbjct: 291 SITAFYTVLTEGDDQQD 307


>3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
          Length = 483

 Score = 69.1 bits (168), Expect = 3e-14
 Identities = 27/240 (11%), Positives = 55/240 (22%), Gaps = 40/240 (16%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
           E + +++   +  E           +  G    + G SG+GK+                 
Sbjct: 1   EHQAIAK-MRTMIE--GFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEP 57

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXX 125
            V      T             FG+   +      L        P               
Sbjct: 58  GVFVTFEETPQDI---IKNARSFGWDLAKLVDEGKLFILDASPDP--------------- 99

Query: 126 XXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL-----DSHSG 180
                                                 + +  D  T         S   
Sbjct: 100 -----------EGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVR 148

Query: 181 EEVMAILRQLRDRGHTVIIVTHD-PLIAAQAERIIEIH--DGKIVHNPPAEEKKREQGVD 237
            E+  ++ +L+  G T ++ T         A   +E    D  ++     E ++R + ++
Sbjct: 149 RELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLE 208


>2d4uB [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
          Length = 155

 Score = 69.1 bits (169), Expect = 4e-14
 Identities = 13/112 (11%), Positives = 30/112 (26%), Gaps = 6/112 (5%)

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEI---PAVYAGIXXXXXXXXXXXXXXXXXXSDRVD 139
           L R    ++  + ++ S  T A+ +E        A                    +  + 
Sbjct: 37  LNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIK 96

Query: 140 YPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR 191
                      + + +  A          D+PT        ++ +A + Q  
Sbjct: 97  RNYDIYHNALAELIQLLGAGK---INEFFDQPTQGYQDGFEKQYVAYMEQND 145


>1e9rG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 417

 Score = 69.0 bits (167), Expect = 4e-14
 Identities = 14/102 (13%), Positives = 30/102 (29%), Gaps = 11/102 (10%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 23  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 78

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQN 106
             +   +   L               I   Y   +   +  N
Sbjct: 79  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFN 114


>2bhvD [x.x.x] COMB10
          Length = 189

 Score = 68.7 bits (167), Expect = 4e-14
 Identities = 15/169 (8%), Positives = 32/169 (18%), Gaps = 28/169 (16%)

Query: 89  GFIFQRYHLLSHLTAAQNV-EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVD-YPPSQLS 146
                   ++          +I                         S  +  Y  +   
Sbjct: 4   LRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM 63

Query: 147 GGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL---------------R 191
           G  +  +  +R +   G  I+       L     E                         
Sbjct: 64  GEYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITF 123

Query: 192 DRGHTVIIVTHDPLIAAQ-----------AERIIEIHDGKIVHNPPAEE 229
                + ++    +   Q              I+ I +G  V   P  +
Sbjct: 124 GDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTD 172


>3a00B [x.x.x] GUANYLATE KINASE
          Length = 151

 Score = 68.7 bits (166), Expect = 5e-14
 Identities = 22/171 (12%), Positives = 39/171 (22%), Gaps = 25/171 (14%)

Query: 35  EMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL---RREHFGFI 91
             + I G SG+GKSTL+  L      + G    +                    + F  +
Sbjct: 2   RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSM 61

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQ 151
            +    +     + N     V +                            + +     Q
Sbjct: 62  IKNNEFIEWAQFSGNYYGSTVAS-------------------VKQVSKSGKTCILDIDMQ 102

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
            V   +A+       L   P           V   L +   +     I   
Sbjct: 103 GVKSVKAIPELNARFLFIAPPSGAHDK--VIVNDDLDKAY-KELKDFIFAE 150


>2dpyA [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
          Length = 422

 Score = 68.6 bits (167), Expect = 5e-14
 Identities = 11/110 (10%), Positives = 30/110 (27%), Gaps = 5/110 (4%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
               L+   +     +G        +  L +  G+ + +   SG GKS L+ ++    + 
Sbjct: 112 PFNPLQRTPIEHVLDTGV----RAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRA 167

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIP 110
                 + G     +                       + ++    ++  
Sbjct: 168 DVIVVGLIGERGREVKDFIENI-LGPDGRARSVVIAAPADVSPLLRMQGA 216


>2drcA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 68.4 bits (166), Expect = 6e-14
 Identities = 17/135 (12%), Positives = 32/135 (23%), Gaps = 12/135 (8%)

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           +      A +  I                           + +     +  G+    SI 
Sbjct: 2   ISLIAALAVDRVIGM----------ENAMPFNLPADLAWFKRNTLDKPVIMGRHTWESIG 51

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG-HTVIIVTHDP-LIAAQAERII 214
           R L     +IL+ +P         + V   +    D     VI           +A+++ 
Sbjct: 52  RPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLY 111

Query: 215 EIHDGKIVHNPPAEE 229
             H    V       
Sbjct: 112 LTHIDAEVEGDTHFP 126


>3dffA [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
          Length = 263

 Score = 68.2 bits (165), Expect = 7e-14
 Identities = 16/198 (8%), Positives = 36/198 (18%), Gaps = 21/198 (10%)

Query: 48  STLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRRE--HFGFIFQRYHLLSH---LT 102
           + L+ I                          LAQ  ++  +                  
Sbjct: 1   TRLLAIS---PHLDDAVLSFGA---------GLAQAAQDGANVLVYTVFAGAAQPPYSPA 48

Query: 103 AAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSD-RVDYPPSQLSGGQQQRVSIARALMN 161
           A ++                            +     +  S        R   A     
Sbjct: 49  AQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHVEGR 108

Query: 162 GGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKI 221
               +    P    D    E    I   + +   T+++      I    +          
Sbjct: 109 QKLAVNDHSPDSDHDLVG-EVADDIRSIIDEFDPTLVVTCAA--IGEHPDHEATRDAALF 165

Query: 222 VHNPPAEEKKREQGVDAA 239
             +      +  + +  A
Sbjct: 166 ATHEKNVPVRLWEDLPYA 183


>4atjA [a.93.1] PROTEIN (PEROXIDASE C1A)
          Length = 308

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 14/148 (9%), Positives = 23/148 (15%), Gaps = 6/148 (4%)

Query: 88  FGFIFQRYHLLSHLTAAQNVEIPAVY--AGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQL 145
              +       +   A  N      +                                 L
Sbjct: 53  SILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTL 112

Query: 146 SGGQQQRVSIARALMNGGQ----VILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVT 201
           +GG   RV + R                 P   L           L +  D        T
Sbjct: 113 AGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHT 172

Query: 202 HDPLIAAQAERIIEIHDGKIVHNPPAEE 229
                       +       + +P    
Sbjct: 173 FGKNQCRFIMDRLYNFSNTGLPDPTLNT 200


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 67.8 bits (164), Expect = 9e-14
 Identities = 49/261 (18%), Positives = 98/261 (37%), Gaps = 27/261 (10%)

Query: 4   LLELRNVSRSYPSGEEQVA-------VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGC 56
            + + NV+  +  G  ++        VLKDI+ +I  G+++A+ G +G+GK++L+ ++  
Sbjct: 2   EVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMG 61

Query: 57  LDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI 116
             +P+ G  + +GR         +     +                         +    
Sbjct: 62  ELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA 121

Query: 117 XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD 176
                              D +      LSGGQ+ R+S+ARA+     + L D P G LD
Sbjct: 122 -----------------EKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLD 164

Query: 177 SHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV-HNPPAE--EKKRE 233
             + +E+            T I+VT       +A++I+ +H+G    +   +E    + +
Sbjct: 165 VLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPD 224

Query: 234 QGVDAAVVNTAPGWRQFASSF 254
              D+    +A       +  
Sbjct: 225 FSSDSFDQFSAERRNSILTET 245


>1e9sE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 425

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 15/198 (7%), Positives = 40/198 (20%), Gaps = 14/198 (7%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGE-MVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 26  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 81

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   +   L               I   Y   +   +  N                  
Sbjct: 82  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNE---IRNDYDWQRYALSV 132

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                                   ++  +    ++                    G    
Sbjct: 133 VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAE 192

Query: 185 AILRQLRDRGHTVIIVTH 202
           ++     +    +     
Sbjct: 193 SLFAGSNEASKALTSARF 210


>3dfdA [x.x.x] PROTEIN YQBN
          Length = 120

 Score = 67.1 bits (163), Expect = 1e-13
 Identities = 7/105 (6%), Positives = 16/105 (15%), Gaps = 12/105 (11%)

Query: 5   LELRNVSRSYPSGEEQVAVLK-DISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           ++   V                    +    + +  +    + K                
Sbjct: 14  IDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTKELDSQR-------FYA 66

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVE 108
              V      T          RE +            L+      
Sbjct: 67  RIAVETTVYPTFKAKE----LREAYKTEDPVEVAKRVLSVGGEYA 107


>2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 289

 Score = 66.7 bits (161), Expect = 2e-13
 Identities = 24/223 (10%), Positives = 59/223 (26%), Gaps = 29/223 (13%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
              + + RNV +           L  +             G  GSGK+ L + L    + 
Sbjct: 67  ALEVKKERNVKKISTG----SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQL 122

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                 ++G+ V           R E+   +      ++++   + +             
Sbjct: 123 PPEKGGLSGKAVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQI------- 175

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                            VD     +S     ++ +  ++ +  +         A+     
Sbjct: 176 ---------------AIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKL 220

Query: 181 EEVMAILRQL-RDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
            + +  L +L       VII            ++ +    + +
Sbjct: 221 NKHLHQLTRLAEVYDIAVIITNQVVPGIRI--QLKKSRGNRRI 261


>1cfrA [x.x.x] RESTRICTION ENDONUCLEASE
          Length = 283

 Score = 66.6 bits (162), Expect = 2e-13
 Identities = 23/218 (10%), Positives = 52/218 (23%), Gaps = 22/218 (10%)

Query: 38  AIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP------DALAQLRREHFGFI 91
            I+  SG G    +N         S            L        D   +L  +     
Sbjct: 2   DIISKSGEGNKYTINSAIAFVAYASHIDINTTEFSKVLSGLRDFINDEAIRLGGKISDGS 61

Query: 92  FQRYH--LLSHLTAAQNVEI----PAVYAGIXXXXXXXXXXXXXXXXXXSDRVD------ 139
           F + +      L   + +E        +  +                  S+ +       
Sbjct: 62  FNKCNGDWYEWLIGIRAIEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKL 121

Query: 140 --YPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHT 196
                + ++      +   R      + +L D     +   +  E+  + +   D     
Sbjct: 122 SLNNVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELE 181

Query: 197 VIIVTHDPLIAAQA-ERIIEIHDGKIVHNPPAEEKKRE 233
            I          +   R+   H+G ++       + R 
Sbjct: 182 HIKSFLSVKTTFRPDRRLQLAHEGSLMKALYTHLQTRT 219


>1ckvA [x.x.x] PROTEIN (PROTEIN B)
          Length = 141

 Score = 66.4 bits (161), Expect = 2e-13
 Identities = 14/117 (11%), Positives = 32/117 (27%), Gaps = 22/117 (18%)

Query: 1   MTALLELR----NVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGC 56
           M+             +     ++      D +  +H  + V +V       +T +  +  
Sbjct: 1   MSVNSNAYDAGIMGLKGKDFADQ---FFADENQVVHESDTVVLVLKKSDEINTFIEEILL 57

Query: 57  LDKPTSG-----------TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLT 102
            D   +             + +       +D D +     E  G  F  Y  L  ++
Sbjct: 58  TDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEI----SELLGRQFNVYDFLVDVS 110


>1eamA [c.66.1] PROTEIN (VP39)
          Length = 285

 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 24/228 (10%), Positives = 49/228 (21%), Gaps = 17/228 (7%)

Query: 8   RNVSRSYPSGEEQVAVLKDI----SLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
                 Y  G+ ++ +L ++     LQ H     A V   GS   T +  L         
Sbjct: 24  PAKKLPY-QGQLKL-LLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGV 81

Query: 64  TYRVAGRDVSTLDPDAL-AQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
             +    D    DP     +       F+ + Y          +  I             
Sbjct: 82  IIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISD--------- 132

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                           +   S L+                 +          L   +   
Sbjct: 133 VRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSY 192

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
              +       G  + +       A   A+++  ++           +
Sbjct: 193 SAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYYLNKIVRNKVVVNFD 240


>5dfrA [x.x.x] DIHYDROFOLATE REDUCTASE
          Length = 154

 Score = 66.1 bits (160), Expect = 3e-13
 Identities = 16/108 (14%), Positives = 32/108 (29%), Gaps = 3/108 (2%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEV-MAILRQLRDRG 194
            + +     +  G+    SI R L     +IL+ +P         + V  AI        
Sbjct: 26  FKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPE 85

Query: 195 HTVIIVTHDP-LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGVDAAV 240
             VI           +A+++   H    V  +    + + +       
Sbjct: 86  IMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS 133


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 65.8 bits (158), Expect = 3e-13
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 138 VDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTV 197
           +D    QLSGG+ QRV+IA AL+        DEP+  LD     +V  ++R+L + G  V
Sbjct: 208 LDRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAV 267

Query: 198 IIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEE 229
           ++V HD  +    ++ I  ++    V+   ++ 
Sbjct: 268 LVVEHDLAVLDYLSDVIHVVYGEPGVYGIFSKP 300



 Score = 63.1 bits (151), Expect = 2e-12
 Identities = 47/200 (23%), Positives = 75/200 (37%), Gaps = 22/200 (11%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQL 83
           L+    +I  GE++ IVG +G GK+T + +L  +++PT G                    
Sbjct: 358 LEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIKA--- 414

Query: 84  RREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPS 143
             E   +        S L +           GI                   D  D    
Sbjct: 415 EYEGTVYELLSKIDSSKLNSNFYKTELLKPLGI------------------IDLYDRNVE 456

Query: 144 QLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHTVIIVTH 202
            LSGG+ QRV+IA  L+    + L DEP+  LD      V   +R L ++   T ++V H
Sbjct: 457 DLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEH 516

Query: 203 DPLIAAQAERIIEIHDGKIV 222
           D L+       + + +G+  
Sbjct: 517 DVLMIDYVSDRLIVFEGEPG 536


>3d1mB [x.x.x] SONIC HEDGEHOG PROTEIN
          Length = 150

 Score = 65.8 bits (159), Expect = 3e-13
 Identities = 11/101 (10%), Positives = 25/101 (24%), Gaps = 7/101 (6%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALM--NGGQVILADEPTGALDSHSGEEVMAILRQ---- 189
           ++      +  G   +     + L       +I  DE     D    +     L      
Sbjct: 15  EKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAIS 74

Query: 190 -LRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
            +       + VT               ++G+ V    ++ 
Sbjct: 75  VMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDR 115


>4dfrA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 65.2 bits (158), Expect = 5e-13
 Identities = 22/141 (15%), Positives = 35/141 (24%), Gaps = 16/141 (11%)

Query: 100 HLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARAL 159
               A +  I    A                      + +     +  G+    SI R L
Sbjct: 5   IAALAVDRVIGMENAMPWNLPADLAW----------FKRNTLDKPVIMGRHTWESIGRPL 54

Query: 160 MNGGQVILADEPTGALD-SHSGEEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIH 217
                +IL+ +P      +       AI          VI           +A+++   H
Sbjct: 55  PGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTH 114

Query: 218 DGKIV----HNPPAEEKKREQ 234
               V    H P  E    E 
Sbjct: 115 IDAEVEGDTHFPDYEPDDWES 135


>3d1mA [x.x.x] SONIC HEDGEHOG PROTEIN
          Length = 148

 Score = 65.0 bits (157), Expect = 6e-13
 Identities = 12/103 (11%), Positives = 29/103 (28%), Gaps = 9/103 (8%)

Query: 135 SDRVDYPPSQLSGGQQQRVSIARALM--NGGQVILADEPTGALDSHSGEEVMAILRQLRD 192
           +++      +  G   +     + L       +I  DE     D    +     L  L  
Sbjct: 13  AEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAI 72

Query: 193 ------RGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEE 229
                  G  + +          +E  +  ++G+ V    ++ 
Sbjct: 73  SVMNQWPGVKLRVTEGWDEDGHHSEESL-HYEGRAVDITTSDR 114


>3dyoA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 64.9 bits (156), Expect = 6e-13
 Identities = 6/124 (4%), Positives = 23/124 (18%), Gaps = 2/124 (1%)

Query: 137 RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR-DRGH 195
                   +S   +   +             A+       + +  + + I          
Sbjct: 775 APLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQG 834

Query: 196 TVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSF 254
             + ++          +  I +        P          +                ++
Sbjct: 835 KTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENY 894

Query: 255 REAL 258
            + L
Sbjct: 895 PDRL 898


>3cr7B [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 181

 Score = 64.7 bits (156), Expect = 7e-13
 Identities = 19/186 (10%), Positives = 37/186 (19%), Gaps = 14/186 (7%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G  + + G+S SGKSTL   L          +       +            E       
Sbjct: 2   GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENI 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP---PSQL--SGG 148
           R         A +  I                            V+     P ++     
Sbjct: 62  RRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVPVEVAEQRD 121

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAA 208
            +     AR  +      ++       +     +              V       +   
Sbjct: 122 PKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY---------ELPVQDAVKQIIDYL 172

Query: 209 QAERII 214
             +  +
Sbjct: 173 DTKGYL 178


>2a1fD [x.x.x] URIDYLATE KINASE
          Length = 236

 Score = 64.7 bits (156), Expect = 7e-13
 Identities = 11/79 (13%), Positives = 23/79 (29%), Gaps = 1/79 (1%)

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-PLIAAQA 210
           +    R L+      L  E    +D    + +   +++L + G  V +V     L     
Sbjct: 2   QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAK 61

Query: 211 ERIIEIHDGKIVHNPPAEE 229
                ++     H      
Sbjct: 62  LAKAGMNRVVGDHMGMLAT 80


>2ancF [x.x.x] GUANYLATE KINASE
          Length = 153

 Score = 64.5 bits (155), Expect = 8e-13
 Identities = 16/151 (10%), Positives = 33/151 (21%), Gaps = 7/151 (4%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  +   SG+GKS+L+  L            +     + +D       +         
Sbjct: 3   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKM 62

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVD-------YPPSQLS 146
            +     +     +E+     G                                     +
Sbjct: 63  PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA 122

Query: 147 GGQQQRVSIARALMNGGQVILADEPTGALDS 177
               + +  A  L    Q    D     L +
Sbjct: 123 LTDLKTIIRAERLRMSRQKQRHDALISKLLA 153


>2dftA [x.x.x] SHIKIMATE KINASE
          Length = 156

 Score = 64.5 bits (155), Expect = 8e-13
 Identities = 22/158 (13%), Positives = 37/158 (23%), Gaps = 7/158 (4%)

Query: 36  MVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRY 95
              +VG+ GSGKST+   L            VA    +      +     E      +  
Sbjct: 3   KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEED 62

Query: 96  HLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSD---RVDYPPSQLSGGQQQR 152
            + + L     V      A                    S          +  +   +  
Sbjct: 63  VVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDRAEKYRAL 122

Query: 153 VSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
           ++    L      +  D             V  IL +L
Sbjct: 123 MAKRAPLYRRVATMRVDTNRRNPG----AVVRHILSRL 156


>1draA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 64.2 bits (155), Expect = 1e-12
 Identities = 16/141 (11%), Positives = 35/141 (24%), Gaps = 13/141 (9%)

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           +      A +  I                           + +     +  G+    SI 
Sbjct: 2   ISLIAALAVDRVIGM----------ENAMPWNLPAELAWFKRNTLDKPVIMGRHTWESIG 51

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQL-RDRGHTVIIVTHDP-LIAAQAERII 214
           R L     +IL+ +P         + V   +          VI           +A+++ 
Sbjct: 52  RPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLY 111

Query: 215 EIHDGKIV-HNPPAEEKKREQ 234
             H    V  +    + + + 
Sbjct: 112 LTHIDAEVEGDTHFPDYEPDD 132


>1dyhA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 64.1 bits (155), Expect = 1e-12
 Identities = 21/141 (14%), Positives = 35/141 (24%), Gaps = 16/141 (11%)

Query: 100 HLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARAL 159
               A +  I    A                      + +     +  G+    SI R L
Sbjct: 5   IAALAVDRVIGMENAMPWNLPADLAW----------FKRNTLDKPVIMGRHTWESIGRPL 54

Query: 160 MNGGQVILADEPTGALDSHSGEEVMAIL-RQLRDRGHTVIIVTHDP-LIAAQAERIIEIH 217
                +IL+ +P         + V   +          VI           +A+++   H
Sbjct: 55  PGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTH 114

Query: 218 DGKIV----HNPPAEEKKREQ 234
               V    H P  E    E 
Sbjct: 115 IDAEVEGDTHFPDYEPDDWES 135


>3ecpA [x.x.x] TN5 TRANSPOSASE
          Length = 458

 Score = 64.0 bits (154), Expect = 1e-12
 Identities = 19/175 (10%), Positives = 38/175 (21%), Gaps = 27/175 (15%)

Query: 57  LDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV-EIPAVYAG 115
           L +       V                R      +  +    S  +   +     A    
Sbjct: 4   LHRAADWAKSVFSSAALGDPR------RTARLVNVAAQLAKYSGKSITISSEGSKA---- 53

Query: 116 IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGAL 175
                               +      +    G  Q V +A+        +LA E T +L
Sbjct: 54  ----------AQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPE----LLAIEDTTSL 99

Query: 176 DSHSGEEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEE 229
                     + +    +  +     H   L+ A   R + +   +    P    
Sbjct: 100 SYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPA 153


>2aumB [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 64.0 bits (155), Expect = 1e-12
 Identities = 12/130 (9%), Positives = 26/130 (20%), Gaps = 1/130 (0%)

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                        +   +  A                       V+     L+G  +QR+
Sbjct: 2   DQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRL 61

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH-DPLIAAQAER 212
                  +   +       G          +   R        +I       L++A    
Sbjct: 62  EDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRH 121

Query: 213 IIEIHDGKIV 222
            +    G + 
Sbjct: 122 GLPAIHGPVA 131


>3cbnA [x.x.x] CONSERVED PROTEIN MTH639
          Length = 142

 Score = 63.7 bits (154), Expect = 1e-12
 Identities = 8/157 (5%), Positives = 25/157 (15%), Gaps = 29/157 (18%)

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
              T R  G                     +     +        +  I    +      
Sbjct: 4   LRYTLRARGHPN--------VTAGHRTTFEVTVDPEI----GETADCIIGVSSSDSISTL 51

Query: 121 XXXXXXXXXXXXXX---------SDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEP 171
                                   +   Y   +L+      +   ++     + ++  + 
Sbjct: 52  PDEKRAIARESLVRVILRTENGYDEIRGYGHPELTLDHPTDIVCRKSDYICSRTLIRADK 111

Query: 172 TGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAA 208
                  +    +        R    + V        
Sbjct: 112 AAFDLDENLVRDL--------RKGRELKVEIIVEYEG 140


>1e2nA [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 63.6 bits (153), Expect = 2e-12
 Identities = 19/191 (9%), Positives = 33/191 (17%), Gaps = 4/191 (2%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L  L              ++       ++     +  
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPEPMTYWRVLGASETIANIYTT 58

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
             +          A  V   A                                       
Sbjct: 59  QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIA 118

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ--LRDRGHTVIIVTHDPLIAA 208
             +    A    G +                    I+      DR    +     P    
Sbjct: 119 ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERL 178

Query: 209 QAERIIEIHDG 219
               +  I   
Sbjct: 179 DLAMLAAIRRV 189


>3ed8A [x.x.x] YELLOW FLUORESCENCE PROTEIN
          Length = 228

 Score = 63.5 bits (154), Expect = 2e-12
 Identities = 11/104 (10%), Positives = 26/104 (25%), Gaps = 6/104 (5%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +EL+              +L            V I    G+ K+ +            G+
Sbjct: 119 IELKGTDFKED-----GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGS 173

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVE 108
            ++A              L  +   ++  +  L       ++  
Sbjct: 174 VQLADHYQQNTPIGDGPVLLPD-NHYLSYQTVLSKDPNEKRDHM 216


>1e4vA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score = 63.4 bits (152), Expect = 2e-12
 Identities = 16/215 (7%), Positives = 41/215 (19%), Gaps = 24/215 (11%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G   +GK T    +         +     R       +       +    I     
Sbjct: 3   IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSE-----LGKQAKDIMDAGK 57

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
           L++       V+                                    +         I 
Sbjct: 58  LVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIV 117

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQL------------------RDRGHTVI 198
             ++       +        +    E    +                          T  
Sbjct: 118 DRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAP 177

Query: 199 IVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKR 232
           ++ +    A     +  ++   K V    A+ +K 
Sbjct: 178 LIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKI 212


>1e2iB [c.37.1] THYMIDINE KINASE
          Length = 313

 Score = 62.9 bits (151), Expect = 3e-12
 Identities = 26/207 (12%), Positives = 45/207 (21%), Gaps = 22/207 (10%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L  L              ++               G 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPEPMT----------YWRVLGA 48

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
                ++ +        EI                             D   +   GG+ 
Sbjct: 49  SETIANIYTTQHRLDQGEI------SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEA 102

Query: 151 QRVSIARALMNGGQVI--LADEPTGALDSHSG--EEVMAILRQLRDRGHTVIIVTHDPLI 206
                A  L+     I  L   P       S   + V+A +  +        IV      
Sbjct: 103 HAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE 162

Query: 207 AAQAERIIEIHDGKIVHNPPAEEKKRE 233
               +R+ +     +            
Sbjct: 163 DRHIDRLAKRERLDLAMLAAIRRVYGL 189


>1d2zD [a.77.1] DEATH DOMAIN OF TUBE
          Length = 153

 Score = 62.8 bits (152), Expect = 3e-12
 Identities = 4/99 (4%), Positives = 23/99 (23%), Gaps = 13/99 (13%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVA-------IVGVSGSGKSTLMNILGCL 57
                    Y + +     + + + ++   +  +             + + T+  +L  L
Sbjct: 57  PAEIKKGFKYTAQDVFQ--IDEAANRLPPDQSKSQMMIDEWKTSGKLNERPTVGVLLQLL 114

Query: 58  ---DKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              +  ++  +        +     +             
Sbjct: 115 VQAELFSAADFVALDFLNESTPARPVDGPGA-LISLELL 152


>3b55A [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
          Length = 400

 Score = 62.8 bits (151), Expect = 3e-12
 Identities = 7/90 (7%), Positives = 25/90 (27%), Gaps = 3/90 (3%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGH 195
                  +  +        +         ++   E T        +  + +   + ++G 
Sbjct: 14  HAKPLKTTNPTASLNDLKPLKNVG--SASIVGLGEATHGAHEVFTKHRI-VKYLVSEKGF 70

Query: 196 TVIIVTHDPLIAAQAERIIEIHDGKIVHNP 225
           T +++      A + +R +    G    + 
Sbjct: 71  TNLVLEEGWDRALELDRYVLTGKGNPSQHL 100


>3bwdD [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
          Length = 156

 Score = 62.5 bits (150), Expect = 3e-12
 Identities = 18/158 (11%), Positives = 33/158 (20%), Gaps = 5/158 (3%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
                 VG    GK+ L+        P S    +   D +  D +     R     +   
Sbjct: 2   FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYN-----RLRPLSYRGA 56

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
              +L+    ++          I                   D  D     +        
Sbjct: 57  DVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITT 116

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR 191
                L          E +     +      A +R + 
Sbjct: 117 VQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVL 154


>1e1qB [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
          Length = 479

 Score = 62.3 bits (150), Expect = 4e-12
 Identities = 16/228 (7%), Positives = 42/228 (18%), Gaps = 34/228 (14%)

Query: 8   RNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRV 67
            +V     +G        D  + I  G+   I+G   +GK+++        K  +     
Sbjct: 117 ISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDE 172

Query: 68  AGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNV-------------------- 107
             +             ++        +    +       V                    
Sbjct: 173 KKKLYCIYVAIG----QKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGC 228

Query: 108 EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVIL 167
            +   +                                                      
Sbjct: 229 SMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL------ 282

Query: 168 ADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIE 215
            +      D+  G  + A+       G     +  + +     +  +E
Sbjct: 283 LERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE 330


>3cnnA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 227

 Score = 62.1 bits (149), Expect = 4e-12
 Identities = 23/155 (14%), Positives = 34/155 (21%), Gaps = 9/155 (5%)

Query: 23  VLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQ 82
            +    L       V IVGV  +GKST++N L              G        D    
Sbjct: 76  KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVK----ILDTPGI 131

Query: 83  LRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP 142
           L +  F        LL      + +E   ++                      D      
Sbjct: 132 LYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRG 191

Query: 143 SQLSGGQQQRVSIARALMNGGQ-----VILADEPT 172
               GG                      +  + P 
Sbjct: 192 LLKKGGVPDIERALMLFFTEVAQGKAGRVSFERPE 226


>3c7kA [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
          Length = 305

 Score = 61.6 bits (147), Expect = 6e-12
 Identities = 10/74 (13%), Positives = 23/74 (31%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G   SGKST++  +  +               +T+   A      +  G  +    
Sbjct: 2   LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKE 61

Query: 97  LLSHLTAAQNVEIP 110
             +      +V   
Sbjct: 62  RKTDSKMVCDVVSR 75


>2a1fC [x.x.x] URIDYLATE KINASE
          Length = 237

 Score = 61.4 bits (147), Expect = 7e-12
 Identities = 11/92 (11%), Positives = 26/92 (28%), Gaps = 6/92 (6%)

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD-P 204
           S    +R+ +  +        L  E    +D    + +   +++L + G  V +V     
Sbjct: 1   SQPIYKRILLKLSG-----EALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 205 LIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
           L          ++     H            +
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLATVMNGLAM 87


>3cqcA [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
          Length = 247

 Score = 61.2 bits (147), Expect = 8e-12
 Identities = 18/221 (8%), Positives = 52/221 (23%), Gaps = 29/221 (13%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
            AL +   + R + + ++  A  K++ ++I    +  I   +    +   ++        
Sbjct: 21  EALKQGNAIMRKFLASKKHEA-AKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEA 79

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXX 121
             T+    + ++++        +      +   +    +       +             
Sbjct: 80  HETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTA----- 134

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                         D  +   + L       +   R                        
Sbjct: 135 --------------DVKEKMYNVLLFVDGGWMVDVREDAKEDH---------ERTHQMVL 171

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
                L  L    HT++  T       Q   ++     K+ 
Sbjct: 172 LRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLY 212


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 61.1 bits (146), Expect = 9e-12
 Identities = 40/255 (15%), Positives = 79/255 (30%), Gaps = 5/255 (1%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           A ++L+NV++++        V KDI+L IH GE V  VG SG GKSTL+ ++  L+  TS
Sbjct: 1   ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G   +  + ++   P        E   F+       +     +                 
Sbjct: 57  GDLFIGEKRMNDTPPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYV 116

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                          V         G+   +    A       I + +        +   
Sbjct: 117 THDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA 176

Query: 183 VMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVV 241
           +  +  +L       + +  +   +   A   + I    ++ +  A+     +      +
Sbjct: 177 IDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQL 236

Query: 242 NTAPGWRQFASSFRE 256
                      S R+
Sbjct: 237 GNETQIHIQIPSIRQ 251


>2b8tD [x.x.x] THYMIDINE KINASE
          Length = 204

 Score = 61.1 bits (146), Expect = 9e-12
 Identities = 15/203 (7%), Positives = 46/203 (22%), Gaps = 11/203 (5%)

Query: 34  GEMVAIVGVSGSGKSTLMNIL-GCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
           G +  I G   +GK+  +      L+           + +  +       L         
Sbjct: 1   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIRNIQSRTGTSLPSVEVESAP 60

Query: 93  QRYHLLSHLTAAQNVEIPAVY----AGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG 148
           +  + +   +     ++  +                          S        +  G 
Sbjct: 61  EILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGP 120

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAA 208
             +  + A  +     +                    I  +  D    ++ +      +A
Sbjct: 121 IAKLFTYADKITKLTAICNECGAEATHSLRK------IDGKHADYNDDIVKIGCQEFYSA 174

Query: 209 QAERIIEIHDGKIVHNPPAEEKK 231
                 ++ +   +++   E  K
Sbjct: 175 VCRHHHKVPNRPYLNSNSEEFIK 197


>1e2mB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 60.9 bits (146), Expect = 1e-11
 Identities = 21/198 (10%), Positives = 43/198 (21%), Gaps = 10/198 (5%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKP----TSGTYRVAGRDVSTLDPDALAQLRRE 86
           +     V I G  G GK+T   +L  L                R +   +  A     + 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 87  HFGFIFQRYHLLSHLTAAQNVEIPAVYAGI---XXXXXXXXXXXXXXXXXXSDRVDYPPS 143
                       + +  +  + +   YA                        DR      
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL 120

Query: 144 -QLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHTVIIVT 201
                 +    S+    +     ++     G             + +L  R    ++   
Sbjct: 121 LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAI 180

Query: 202 HDPLIA-AQAERIIEIHD 218
                  A   R ++   
Sbjct: 181 RRVYGLLANTVRYLQCGG 198


>3cmuA [x.x.x] PROTEIN RECA
          Length = 1937

 Score = 60.3 bits (144), Expect = 2e-11
 Identities = 15/85 (17%), Positives = 24/85 (28%), Gaps = 6/85 (7%)

Query: 25  KDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLR 84
              +  +  G +V I G   SGK+TL   +    +    T      + +           
Sbjct: 14  ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI------Y 67

Query: 85  REHFGFIFQRYHLLSHLTAAQNVEI 109
               G            T  Q +EI
Sbjct: 68  ARKLGVDIDNLLCSQPDTGEQALEI 92



 Score = 44.1 bits (102), Expect = 1e-06
 Identities = 15/79 (18%), Positives = 23/79 (29%), Gaps = 6/79 (7%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +  G +V I G   SGK+TL   +    +    T      + +               G 
Sbjct: 348 LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI------YARKLGV 401

Query: 91  IFQRYHLLSHLTAAQNVEI 109
                      T  Q +EI
Sbjct: 402 DIDNLLCSQPDTGEQALEI 420


>3cphA [x.x.x] RAS-RELATED PROTEIN SEC4
          Length = 175

 Score = 60.2 bits (144), Expect = 2e-11
 Identities = 16/169 (9%), Positives = 44/169 (26%), Gaps = 3/169 (1%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G SG GKS L+          S    +              +++ + +    Q   
Sbjct: 4   ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERF 63

Query: 97  LL---SHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                ++   A  + +                          +         S  + + V
Sbjct: 64  RTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVV 123

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTH 202
           +  +      ++ +    + A +  +  E+   L +L         +  
Sbjct: 124 TADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVG 172


>2d7vA [x.x.x] HYPOTHETICAL PROTEIN VCA0330
          Length = 152

 Score = 60.1 bits (145), Expect = 2e-11
 Identities = 13/90 (14%), Positives = 31/90 (34%), Gaps = 11/90 (12%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +  L +    + S    +A  +   ++ +    V I+G +  GK+++  ++       SG
Sbjct: 63  VAALSSCHLVFLS----IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSG 118

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           T +   + +                 FI  
Sbjct: 119 TSKPTLQQLEKHH-------LAHENCFIAN 141


>1dp0A [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
          Length = 1011

 Score = 60.0 bits (143), Expect = 2e-11
 Identities = 3/86 (3%), Positives = 16/86 (18%), Gaps = 2/86 (2%)

Query: 140 YPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEV-MAILRQLRDRGHTVI 198
                +S   +   +             A+       + +  +  +             +
Sbjct: 778 DNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTL 837

Query: 199 IVTHDPLIAAQ-AERIIEIHDGKIVH 223
            ++          +  I +       
Sbjct: 838 FISRKTYRIDGSGQMAITVDVEVASD 863


>3bb1D [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 247

 Score = 59.5 bits (142), Expect = 3e-11
 Identities = 17/243 (6%), Positives = 56/243 (23%), Gaps = 36/243 (14%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
             +   + +  +   ++  L ++  +      + ++G  G GKS+ +N +      +   
Sbjct: 6   SGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISP 63

Query: 65  YRVAGRDVSTLDPDAL-AQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXX 123
           ++  G     +        L       + +  ++           +      +       
Sbjct: 64  FQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRL 123

Query: 124 XXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGG-------------------- 163
                        +            +  V++  A  +                      
Sbjct: 124 DAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVV 183

Query: 164 -------QVILADEPTGALDSHSGEEVMAILRQLRD------RGHTVIIVTHDPLIAAQA 210
                  +   +D P   +++        +L           +  T + +     I    
Sbjct: 184 RSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDK 243

Query: 211 ERI 213
             I
Sbjct: 244 NLI 246


>2anbA [x.x.x] GUANYLATE KINASE
          Length = 206

 Score = 59.1 bits (141), Expect = 4e-11
 Identities = 25/202 (12%), Positives = 48/202 (23%), Gaps = 13/202 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  +   SG+GKS+L+  L            V+             +    H    F 
Sbjct: 3   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQP-------RPGEVHGEHYFF 55

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
             H       +++  +                            +D         +Q+  
Sbjct: 56  VNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMP 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL-----RDRGHTVIIVTHDPLIAA 208
                 +     I  D         S E +   + Q          +  +IV  D   A 
Sbjct: 116 HARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL 175

Query: 209 Q-AERIIEIHDGKIVHNPPAEE 229
              + II     ++       +
Sbjct: 176 TDLKTIIRAERLRMSRQKQRHD 197


>3bjqB [x.x.x] PHAGE-RELATED PROTEIN
          Length = 297

 Score = 58.8 bits (140), Expect = 4e-11
 Identities = 12/84 (14%), Positives = 24/84 (28%), Gaps = 13/84 (15%)

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ 209
           Q RV            IL+    G   S    + +  +  +   G  ++    +      
Sbjct: 1   QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYN 51

Query: 210 A----ERIIEIHDGKIVHNPPAEE 229
                +RI   ++G      P+  
Sbjct: 52  TKRNTKRIDFGYEGDPYSIVPSAL 75


>1afrA [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
          Length = 345

 Score = 58.7 bits (140), Expect = 5e-11
 Identities = 3/51 (5%), Positives = 15/51 (29%)

Query: 21 VAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRD 71
            V   ++  +   ++     +    +  ++  L  ++K       +    
Sbjct: 4  REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPA 54



 Score = 56.0 bits (133), Expect = 3e-10
 Identities = 6/86 (6%), Positives = 15/86 (17%), Gaps = 7/86 (8%)

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ- 209
                A  + +G     A E      +     +        D        T       + 
Sbjct: 175 SFQERATFISHGNTARQAKEHGDIKLAQICGTIA------ADEKRHETAYTKIVEKLFEI 228

Query: 210 AERIIEIHDGKIVHNPPAEEKKREQG 235
                 +    ++    +        
Sbjct: 229 DPDGTVLAFADMMRKKISMPAHLMYD 254



 Score = 42.9 bits (99), Expect = 3e-06
 Identities = 6/44 (13%), Positives = 10/44 (22%)

Query: 43  SGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRRE 86
           S  G+     +     +      R  GR              R+
Sbjct: 299 SAEGQKAQDYVCRLPPRIRRLEERAQGRAKEAPTMPFSWIFDRQ 342


>2d7vB [x.x.x] HYPOTHETICAL PROTEIN VCA0330
          Length = 151

 Score = 58.6 bits (141), Expect = 5e-11
 Identities = 13/90 (14%), Positives = 31/90 (34%), Gaps = 11/90 (12%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +  L +    + S    +A  +   ++ +    V I+G +  GK+++  ++       SG
Sbjct: 62  VAALSSCHLVFLS----IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSG 117

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           T +   + +                 FI  
Sbjct: 118 TSKPTLQQLEKHH-------LAHENCFIAN 140


>1cjuC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 331

 Score = 58.3 bits (139), Expect = 6e-11
 Identities = 9/64 (14%), Positives = 21/64 (32%)

Query: 33 AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
          A   + ++G   SGKST++  +  L        +V     +  +          +     
Sbjct: 1  ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVPPV 60

Query: 93 QRYH 96
          +  +
Sbjct: 61 ELAN 64


>1cjvC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 329

 Score = 58.1 bits (138), Expect = 7e-11
 Identities = 9/64 (14%), Positives = 21/64 (32%)

Query: 33 AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
          A   + ++G   SGKST++  +  L    +   +    ++       +A +         
Sbjct: 1  ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL 60

Query: 93 QRYH 96
              
Sbjct: 61 ANPE 64


>1drbA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 58.0 bits (139), Expect = 8e-11
 Identities = 16/108 (14%), Positives = 32/108 (29%), Gaps = 3/108 (2%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDRG 194
            + +     +  G+    SI R L     +IL+ +P         + V  AI        
Sbjct: 31  FKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPE 90

Query: 195 HTVIIVTHDP-LIAAQAERIIEIHDGKIV-HNPPAEEKKREQGVDAAV 240
             VI           +A+++   H    V  +    + + +       
Sbjct: 91  IMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS 138


>2dftC [x.x.x] SHIKIMATE KINASE
          Length = 155

 Score = 57.9 bits (138), Expect = 8e-11
 Identities = 19/157 (12%), Positives = 36/157 (22%), Gaps = 8/157 (5%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
             +VG+ GSGKST+   L            VA    +      +         F      
Sbjct: 4   AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFA-TDGEQEFRRIEED 62

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP---PSQLSGGQQQRV 153
           ++    A  +  +      +                      +         +   +  +
Sbjct: 63  VVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEKYRALM 122

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQL 190
           +    L      +  D             V  IL +L
Sbjct: 123 AKRAPLYRRVATMRVDTNRRNPG----AVVRHILSRL 155


>3e8aC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 328

 Score = 57.8 bits (137), Expect = 9e-11
 Identities = 9/74 (12%), Positives = 20/74 (27%), Gaps = 6/74 (8%)

Query: 33  AGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIF 92
           A   + ++G   SGKST++  +  L        +V     +  +              + 
Sbjct: 1   ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA------IETIVAAMS 54

Query: 93  QRYHLLSHLTAAQN 106
                +        
Sbjct: 55  NLVPPVELANPENQ 68


>1e9sA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score = 57.5 bits (137), Expect = 1e-10
 Identities = 22/225 (9%), Positives = 49/225 (21%), Gaps = 12/225 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 27  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 82

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXX 124
             +   +   L               I   Y   +   +  N                  
Sbjct: 83  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR 136

Query: 125 XXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVM 184
                     S                     R L +   +   D+  G L+    E + 
Sbjct: 137 GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF 196

Query: 185 AILRQ-LRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAE 228
           A   +  +       +++                   +       
Sbjct: 197 AGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGN 241


>1accA [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
          Length = 665

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 20/220 (9%), Positives = 52/220 (23%), Gaps = 33/220 (15%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLD---KPTS 62
               V         ++  + +          +A V  S +     +     +       +
Sbjct: 410 NWSEVLPQIQETTARI--IFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFGFNEPN 467

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXX 122
           G  +  G+D++  D +             F +         +QN++              
Sbjct: 468 GNLQYQGKDITEFDFN-------------FDQ-------QTSQNIKNQLAELNATNIYTV 507

Query: 123 XXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEE 182
                         R               V    +++      + +  T  L  +  ++
Sbjct: 508 LDKIKLNAKMNILIR---DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKD 564

Query: 183 VMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
           +  IL           I   + L     +R   ++   + 
Sbjct: 565 IRKILSGYIV-----EIEDTEGLKEVINDRYDMLNISSLR 599


>2ancD [x.x.x] GUANYLATE KINASE
          Length = 204

 Score = 56.8 bits (135), Expect = 2e-10
 Identities = 23/202 (11%), Positives = 48/202 (23%), Gaps = 13/202 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  +   SG+GKS+L+  L            V+         +   +         F+
Sbjct: 2   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK 61

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                     +++  +                            +D         +Q+  
Sbjct: 62  EMI-------SRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMP 114

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ-----LRDRGHTVIIVTHDPLIAA 208
                 +     I  D         S E +   + Q          +  +IV  D   A 
Sbjct: 115 HARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL 174

Query: 209 Q-AERIIEIHDGKIVHNPPAEE 229
              + II     ++       +
Sbjct: 175 TDLKTIIRAERLRMSRQKQRHD 196


>1bccF [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
          Length = 100

 Score = 56.7 bits (136), Expect = 2e-10
 Identities = 10/91 (10%), Positives = 26/91 (28%), Gaps = 4/91 (4%)

Query: 78  DALAQLRREHFGF-IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSD 136
             L  +R+ ++    F +Y L+   T  +N ++      +                  + 
Sbjct: 2   RWLEGIRKWYYNAAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNM 61

Query: 137 RVDYPPSQLSGGQQQRVSIARALMNGGQVIL 167
           R    P +      +       L    + ++
Sbjct: 62  RQQILPKE---QWTKYEEDVPYLEPYLKEVI 89


>3b85B [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
          Length = 180

 Score = 56.3 bits (134), Expect = 2e-10
 Identities = 22/187 (11%), Positives = 38/187 (20%), Gaps = 15/187 (8%)

Query: 18  EEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDP 77
             +    K     I    +V  +G +GSGK+ L        +    +  +  R       
Sbjct: 3   RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVE--- 59

Query: 78  DALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDR 137
                   E  GF+   Y    H                                     
Sbjct: 60  ------AGEKLGFLPDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRT-----LN 108

Query: 138 VDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDR-GHT 196
             +     +            L  G +V+  D     +             +L       
Sbjct: 109 DAFVILDEAQNTTPAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVR 168

Query: 197 VIIVTHD 203
             +V H 
Sbjct: 169 HQLVGHI 175


>2e85B [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
          Length = 157

 Score = 55.7 bits (134), Expect = 4e-10
 Identities = 14/86 (16%), Positives = 26/86 (30%), Gaps = 11/86 (12%)

Query: 145 LSGGQQQRVSIAR-ALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD 203
           + GG      I     +   ++++ D     L+      +        D     ++ TH+
Sbjct: 40  IDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHN 94

Query: 204 P----LIAAQAERIIEI-HDGKIVHN 224
                LI    E I E+   G     
Sbjct: 95  MPLNYLIDQLKEDIGEVIFLGIQPDI 120


>1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 220

 Score = 55.6 bits (132), Expect = 4e-10
 Identities = 13/194 (6%), Positives = 36/194 (18%), Gaps = 19/194 (9%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              + ++G  G+GK T    L               R                    I  
Sbjct: 4   SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQ-----LGLEAKKIMD 58

Query: 94  RYHLLSHLTAAQNVEIPAVYAG------IXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSG 147
           +  L+S       ++             I                   ++       +  
Sbjct: 59  QGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIEL 118

Query: 148 GQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIA 207
                + +AR                  +    +    +  +   +              
Sbjct: 119 KVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADAL----- 173

Query: 208 AQAERIIEIHDGKI 221
              ++ +  +  + 
Sbjct: 174 ---KKRLAAYHAQT 184


>2a1fE [x.x.x] URIDYLATE KINASE
          Length = 235

 Score = 55.5 bits (132), Expect = 4e-10
 Identities = 10/79 (12%), Positives = 23/79 (29%), Gaps = 1/79 (1%)

Query: 152 RVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-A 210
           +    R L+      L  E    +D    + +   +++L + G  V +V     +     
Sbjct: 2   QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAK 61

Query: 211 ERIIEIHDGKIVHNPPAEE 229
                ++     H      
Sbjct: 62  LAKAGMNRVVGDHMGMLAT 80


>3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
          Length = 530

 Score = 55.4 bits (132), Expect = 5e-10
 Identities = 9/75 (12%), Positives = 19/75 (25%), Gaps = 7/75 (9%)

Query: 1  MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIV---GVSGSGKSTLMNILGCL 57
             +L       +          LK +        ++        +G GK+T    L  L
Sbjct: 14 KDDILYPYGHYIAKI----DHRFLKSLENHEDGKLILVTAVTPTPAGEGKTTTSIGLSSL 69

Query: 58 DKPTSGTYRVAGRDV 72
          ++    +        
Sbjct: 70 NRIGKKSIVTLREPS 84


>1azsC [c.37.1 - a.66.1] GS-ALPHA
          Length = 339

 Score = 55.1 bits (130), Expect = 6e-10
 Identities = 9/72 (12%), Positives = 22/72 (30%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
             A   + ++G   SGKST++  +  L        +V     +  +          +   
Sbjct: 2   YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVP 61

Query: 91  IFQRYHLLSHLT 102
             +  +  +   
Sbjct: 62  PVELANPENQFR 73


>3dm5B [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
          Length = 413

 Score = 55.0 bits (131), Expect = 6e-10
 Identities = 23/235 (9%), Positives = 49/235 (20%), Gaps = 26/235 (11%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
           ++    +  +     +                   ++ +VG+ GSGK+T +  L    + 
Sbjct: 69  ISKKEHIIKIVYEELTKFLGT--EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQK 126

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                 V   D          +   + +                    +           
Sbjct: 127 RGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK------- 179

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALD-SHS 179
                           +        + G+ +       +     VI   E    +D +  
Sbjct: 180 ---------------SKGVDIIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIG 224

Query: 180 GEEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKRE 233
            +     L          IIVT                  G  +      EK  +
Sbjct: 225 QQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDD 279


>2a5vB [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
          Length = 210

 Score = 55.0 bits (132), Expect = 6e-10
 Identities = 8/105 (7%), Positives = 24/105 (22%), Gaps = 15/105 (14%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +  +R       S    +  + + ++ +    ++ ++G    G                G
Sbjct: 73  MFVVRTAGHVIDSAV--LGSI-EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGG 129

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVE 108
                   V  + P               +           ++V 
Sbjct: 130 Y---VRDVVERVAPS---------VLLGRRDGLSRVDEFEQRHVH 162


>2c9gA [x.x.x] PENTON PROTEIN
          Length = 447

 Score = 54.8 bits (129), Expect = 7e-10
 Identities = 3/65 (4%), Positives = 18/65 (27%), Gaps = 4/65 (6%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
              ++  R++++            + +   +  G     + +     + + + L    + 
Sbjct: 96  KARVMVSRSLTKDKQ----VELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQN 151

Query: 61  TSGTY 65
                
Sbjct: 152 GVLES 156


>2cdnA [x.x.x] ADENYLATE KINASE
          Length = 186

 Score = 54.7 bits (130), Expect = 7e-10
 Identities = 24/188 (12%), Positives = 48/188 (25%), Gaps = 11/188 (5%)

Query: 33  AGEMVAIVGVSGSGKSTLMNILGCLDK----PTSGTYRVAGRDVSTLDPDALAQLRREHF 88
           +   V ++G  G+GK T    L          T   +R    +        L    + + 
Sbjct: 4   SHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEG-----TKLGVEAKRYL 58

Query: 89  GFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG 148
                    L++      +  P    G                    +R       +   
Sbjct: 59  DAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEF 118

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDP-LIA 207
           +     +   L   G+    D+          +E   +L   RD+    +        + 
Sbjct: 119 RVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQ-LKTVDAVGTMDEVF 177

Query: 208 AQAERIIE 215
           A+A R + 
Sbjct: 178 ARALRALG 185


>2a5vA [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
          Length = 210

 Score = 54.2 bits (130), Expect = 1e-09
 Identities = 8/105 (7%), Positives = 24/105 (22%), Gaps = 15/105 (14%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
           +  +R       S    +  + + ++ +    ++ ++G    G                G
Sbjct: 75  MFVVRTAGHVIDSAV--LGSI-EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGG 131

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVE 108
                   V  + P               +           ++V 
Sbjct: 132 YV---RDVVERVAPS---------VLLGRRDGLSRVDEFEQRHVH 164


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 54.1 bits (128), Expect = 1e-09
 Identities = 44/244 (18%), Positives = 89/244 (36%), Gaps = 12/244 (4%)

Query: 3   ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTS 62
           + LE+R++  S         +LK ++L +  GE+ A++G +G+GKSTL  IL    + T 
Sbjct: 1   SQLEIRDLWASIDGET----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTV 56

Query: 63  GTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYA-----GIX 117
               +     +     +  +  R+     FQ    +  +T A  + +          G+ 
Sbjct: 57  ERGEILLDGENI-LELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVA 115

Query: 118 XXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDS 177
                            S    Y     SGG+++R  I + L+      + DE    LD 
Sbjct: 116 EFWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDI 175

Query: 178 HSGEEVMAIL-RQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIVHNPPAEEKKREQG 235
            + + V   +          ++I  +  ++     +++  + DG++V     E     + 
Sbjct: 176 DALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELEA 235

Query: 236 VDAA 239
               
Sbjct: 236 KGYE 239


>3c7kC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
          Length = 311

 Score = 54.1 bits (127), Expect = 1e-09
 Identities = 17/195 (8%), Positives = 38/195 (19%), Gaps = 19/195 (9%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G   SGKST++  +  + +                         +++   ++    
Sbjct: 2   LLLLGAGESGKSTIVKQMKIIHEDGFSGED-----------------VKQYKPVVYSNTI 44

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIA 156
                       +   Y                     ++                  I 
Sbjct: 45  QSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQ 104

Query: 157 RALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVT--HDPLIAAQAERII 214
                  +  L D     LDS             +D   T +  T   +     +     
Sbjct: 105 ECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFR 164

Query: 215 EIHDGKIVHNPPAEE 229
               G          
Sbjct: 165 LFDVGGQRSERKKWI 179


>3c85A [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
          Length = 148

 Score = 53.9 bits (128), Expect = 1e-09
 Identities = 17/150 (11%), Positives = 36/150 (24%), Gaps = 11/150 (7%)

Query: 57  LDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGI 116
           L  P      + G  + T   D L     +      +     +    ++   + +  A  
Sbjct: 2   LINPGHAQVLILGGRIGTGAYDELRARYGKIS-LGIEIREEAAQQHRSEGRNVISGDATD 60

Query: 117 XXXXXXXXXXXXXXXXXXSDRVDYPPSQLSG-----GQQQRVSIARALMNGGQVILADEP 171
                             +       + L        + Q  +IA       + +L    
Sbjct: 61  PDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQL-EGLLESGV 119

Query: 172 TGALDSH---SGEEVMAILRQLRDRGHTVI 198
             A + +          + +QL     T I
Sbjct: 120 DAAFNIYSEAGSGFARHVCKQLE-PQFTSI 148


>3bm2B [x.x.x] PROTEIN YDJA
          Length = 160

 Score = 53.7 bits (128), Expect = 1e-09
 Identities = 9/137 (6%), Positives = 30/137 (21%), Gaps = 8/137 (5%)

Query: 92  FQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPP------SQL 145
                + +  +A++  E       +                   +  +         +  
Sbjct: 2   ALELLI-NRRSASRLAEPAPTGEQLQNILRAGRAPDWHFFVIEGEGRERFSAVLEQGAIA 60

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPL 205
           +G   + +  AR       +I+                 A+ +    +G   I  +    
Sbjct: 61  AGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQE-SAGCAVAQAAVAQGFGGIWRSGALT 119

Query: 206 IAAQAERIIEIHDGKIV 222
            +          +   +
Sbjct: 120 ESPVVREAFGCREQDKI 136


>2b0lC [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
          Length = 94

 Score = 53.6 bits (128), Expect = 2e-09
 Identities = 8/86 (9%), Positives = 19/86 (22%), Gaps = 7/86 (8%)

Query: 158 ALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG-------HTVIIVTHDPLIAAQA 210
             M+   V +A       +  + E +   L                 I  +       + 
Sbjct: 3   HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKL 62

Query: 211 ERIIEIHDGKIVHNPPAEEKKREQGV 236
           E    I    +       +    + +
Sbjct: 63  ESAGVIESRSLGMKGTYIKVLNNKFL 88


>1chdA [x.x.x] CHEB METHYLESTERASE
          Length = 198

 Score = 53.3 bits (128), Expect = 2e-09
 Identities = 14/66 (21%), Positives = 28/66 (42%), Gaps = 7/66 (10%)

Query: 159 LMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPL--IAAQAERIIEI 216
           L++  ++I     TG  ++     +  +L+ L      VII  H P     + AER+ ++
Sbjct: 1   LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPGFTRSFAERLNKL 55

Query: 217 HDGKIV 222
               + 
Sbjct: 56  CQISVK 61


>1e2nB [c.37.1] THYMIDINE KINASE
          Length = 309

 Score = 53.3 bits (126), Expect = 2e-09
 Identities = 15/215 (6%), Positives = 42/215 (19%), Gaps = 13/215 (6%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHF-- 88
           +     V I G  G GK+T   +L  L              ++       ++     +  
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPEPMTYWRVLGASETIANIYTT 58

Query: 89  GFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRV------DYPP 142
                +  + +   A                                  +          
Sbjct: 59  QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIA 118

Query: 143 SQLSGGQQQRVS--IARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIV 200
           + L     + +   +    +     ++     G             + +L      ++  
Sbjct: 119 ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAA 178

Query: 201 THDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQG 235
                    A  +  +  G        +    +  
Sbjct: 179 IRRVYGLL-ANTVRYLQCGGSWREDWGQLSGPQSN 212


>1e9rB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 52.8 bits (125), Expect = 3e-09
 Identities = 14/102 (13%), Positives = 30/102 (29%), Gaps = 11/102 (10%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 27  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 82

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQN 106
             +   +   L               I   Y   +   +  N
Sbjct: 83  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFN 118


>3cd9A [x.x.x] GREEN FLUORESCENT PROTEIN
          Length = 226

 Score = 52.8 bits (125), Expect = 3e-09
 Identities = 5/104 (4%), Positives = 16/104 (15%), Gaps = 9/104 (8%)

Query: 5   LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +EL+ +               + +    +   +         K+         D      
Sbjct: 118 IELKGIDFKEDGNILGH--KLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLA 175

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVE 108
                       P              +            +  +
Sbjct: 176 DHYQQNTPIGDGP-------VLLPDNHYLSTCSALSKDPNEKRD 212


>1e2jA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 52.6 bits (124), Expect = 3e-09
 Identities = 25/215 (11%), Positives = 49/215 (22%), Gaps = 20/215 (9%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNIL-GCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFG 89
           +     V I G  G GK+T   +L   +               S    +      R   G
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQG 60

Query: 90  FIFQRYHLLSHLTAAQNV--------EIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP 141
            I      +   +A   +         + A + G                   +  + YP
Sbjct: 61  EISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYP 120

Query: 142 PSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLR---------- 191
            ++   G         A +      L               +  + ++ R          
Sbjct: 121 AARYLMGSMTPQ-AVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAML 179

Query: 192 DRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPP 226
                V  +  + +   Q         G++    P
Sbjct: 180 AAIRRVYGLLANTVRYLQCGGSWREDWGQLSGPRP 214


>1d6aA [d.165.1] POKEWEED ANTIVIRAL PROTEIN
          Length = 262

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 8/108 (7%), Positives = 21/108 (19%), Gaps = 6/108 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
               V       +  +  +  +       E   ++                     +   
Sbjct: 134 SRSQVQLGIQILDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQ-VKTNFN 192

Query: 66  RVAGRDVSTLDPDAL-----AQLRREHFGFIFQRYHLLSHLTAAQNVE 108
           R    +   L+           +     G + +   L+    A   V 
Sbjct: 193 RAFNPNPKVLNLQETWGKISTAIHDAKNGVLPKPLELVDASGAKWIVL 240


>3b9qA [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
          Length = 298

 Score = 50.2 bits (118), Expect = 2e-08
 Identities = 30/237 (12%), Positives = 57/237 (24%), Gaps = 20/237 (8%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
            + + +    S      +       ++ L      ++ IVGV+G GK+T +  L    K 
Sbjct: 69  GSEIKDALKESVLEMLAK----SKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKN 124

Query: 61  TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXX 120
                 +A  D          ++  E  G            T            G     
Sbjct: 125 EGTKVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGY---- 180

Query: 121 XXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG 180
                         S R+    S +      + ++ + +      IL         +   
Sbjct: 181 -------DVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILLVLDGNTGLNM-- 231

Query: 181 EEVMAILRQLRDRGHTVIIVTHDP-LIAAQAERIIEIHDGKIVHNPPAEEKKREQGV 236
             +          G T +I+T             +    G  V      E   +   
Sbjct: 232 --LPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQP 286


>1d8jA [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
          Length = 81

 Score = 50.0 bits (119), Expect = 2e-08
 Identities = 6/45 (13%), Positives = 16/45 (35%), Gaps = 1/45 (2%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARALM-NGGQVILADEPTGALDSHS 179
           D +      L  G +Q+  +    + N  ++ + D        ++
Sbjct: 35  DEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYN 79


>2an9A [x.x.x] GUANYLATE KINASE
          Length = 205

 Score = 49.9 bits (117), Expect = 2e-08
 Identities = 24/209 (11%), Positives = 47/209 (22%), Gaps = 13/209 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  +   SG+GKS+L+  L            V+         +   +         F+
Sbjct: 3   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK 62

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                        V                              +D         +Q+  
Sbjct: 63  EMISRDAFLEHAEVFGNYYGTSR-------EAIEQVLATGVDVFLDIDWQGAQQIRQKMP 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQ-----LRDRGHTVIIVTHDPLIAA 208
                 +     I  D         S E +   + Q          +  +IV  D   A 
Sbjct: 116 HARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL 175

Query: 209 Q-AERIIEIHDGKIVHNPPAEEKKREQGV 236
              + II     ++       +    + +
Sbjct: 176 TDLKTIIRAERLRMSRQKQRHDALISKLL 204


>1e2lA [c.37.1] THYMIDINE KINASE
          Length = 304

 Score = 49.8 bits (117), Expect = 2e-08
 Identities = 33/235 (14%), Positives = 57/235 (24%), Gaps = 15/235 (6%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L  +  P   TY        T+      Q R    G 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRL-DQGE 59

Query: 91  IFQRYHLLSHLTAAQNVEIP--AVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGG 148
           I      +   +A   + +P     A +                   DR        +  
Sbjct: 60  ISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPI----AALL 115

Query: 149 QQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAI-----LRQLRDRGHTVIIVTHD 203
                      M    V+            +   + A+     + +L  R      +   
Sbjct: 116 CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLA 175

Query: 204 PLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREAL 258
            L A +    +  +  + +         RE     +      G   F       L
Sbjct: 176 MLAAIRRVYGLLANTVRYLQ---CGGSWREDWGQLSGPRPHIGDTLFTLFRAPEL 227


>1e2mA [c.37.1] THYMIDINE KINASE
          Length = 305

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 16/186 (8%), Positives = 35/186 (18%), Gaps = 20/186 (10%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              V I G  G GK+T   +L                 ++       ++     +    +
Sbjct: 4   LLRVYIDGPHGMGKTTTTQLL-------RDDIVYVPEPMTYWRVLGASETIANIYTTQHR 56

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                     A  V   A                            +   +        +
Sbjct: 57  LDQGEISAGDAAVVMTSAQITMGMPYAVTDAV-----------LAPHIGGEAGSPPALTL 105

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQAERI 213
              R  +       A        +         L      G  +++           +R+
Sbjct: 106 IFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRH--IDRL 163

Query: 214 IEIHDG 219
            +    
Sbjct: 164 AKRQRP 169


>3cbqA [x.x.x] GTP-BINDING PROTEIN REM 2
          Length = 169

 Score = 49.0 bits (115), Expect = 4e-08
 Identities = 25/164 (15%), Positives = 43/164 (26%), Gaps = 7/164 (4%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           V +VG SG GKSTL    G L   ++                   ++    +    Q   
Sbjct: 5   VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDA 64

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV--- 153
                          +                      + R  +    +  G +  +   
Sbjct: 65  GGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARS 124

Query: 154 ---SIARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLRDR 193
              S+       G +      T A   H+  E+    +RQ+R R
Sbjct: 125 REVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLR 168


>2aexA [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
          Length = 336

 Score = 48.6 bits (115), Expect = 5e-08
 Identities = 5/68 (7%), Positives = 10/68 (14%), Gaps = 13/68 (19%)

Query: 164 QVILADEPTGALDSHSGEEVMAIL------------RQLRDRGHTVIIVTHDPLIAAQ-A 210
           ++        A       E+                         +  V      +    
Sbjct: 4   ELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRW 63

Query: 211 ERIIEIHD 218
           ER      
Sbjct: 64  ERKEGGGG 71


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 48.5 bits (113), Expect = 5e-08
 Identities = 47/238 (19%), Positives = 96/238 (40%), Gaps = 15/238 (6%)

Query: 2   TALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT 61
           T  + + NV+  +  G      LKDI+ +I  G+++A+ G +G+GK++L+ ++    +P+
Sbjct: 1   TTEVVMENVTAFWEEGLGTPV-LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPS 59

Query: 62  SGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXX 121
            G  + +GR         +     +        Y    + +  +  ++    +       
Sbjct: 60  EGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKF----- 114

Query: 122 XXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGE 181
                        +  +      LS GQQ ++S+ARA+     + L D P G LD  + +
Sbjct: 115 ---------AEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEK 165

Query: 182 EVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAA 239
           E+            T I+VT       +A++I+ +H+G         E +  Q   ++
Sbjct: 166 EIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSS 223


>2ancB [x.x.x] GUANYLATE KINASE
          Length = 204

 Score = 48.4 bits (113), Expect = 6e-08
 Identities = 22/203 (10%), Positives = 43/203 (21%), Gaps = 14/203 (6%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
           G +  +   SG+GKS+L+  L            V+         +   +         F+
Sbjct: 3   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK 62

Query: 94  RYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQQRV 153
                        V                              +D         +Q+  
Sbjct: 63  EMISRDAFLEHAEVFGNYYG-------TSREAIEQVLATGVDVFLDIDWQGAQQIRQKMP 115

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVMAILR-----QLRDRGHTVIIVTHDP-LIA 207
                 +     I  D         S E +   +            +  +IV  D     
Sbjct: 116 HARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL 175

Query: 208 AQAERIIEIHDGKIVH-NPPAEE 229
              + II     ++       + 
Sbjct: 176 TDLKTIIRAERLRMSRQKQRHDA 198


>2a78A [x.x.x] RAS-RELATED PROTEIN RAL-A
          Length = 170

 Score = 48.2 bits (113), Expect = 7e-08
 Identities = 21/164 (12%), Positives = 41/164 (25%), Gaps = 4/164 (2%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           V +VG  G GKS L       +         A      +  D              + Y 
Sbjct: 5   VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA 64

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP----PSQLSGGQQQR 152
            +             V++                     +  + P     ++     +++
Sbjct: 65  AIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQ 124

Query: 153 VSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHT 196
           VS+  A     Q  +    T A    + ++V   L +       
Sbjct: 125 VSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM 168


>2c9oA [x.x.x] RUVB-LIKE 1
          Length = 398

 Score = 47.7 bits (111), Expect = 9e-08
 Identities = 23/218 (10%), Positives = 49/218 (22%), Gaps = 12/218 (5%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY 65
               +     + E    +++ I  +  AG  V + G  G+GK+ L   +           
Sbjct: 27  AASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFC 86

Query: 66  RVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXX 125
            + G +V + +      L       I  R          +  E                 
Sbjct: 87  PMVGSEVYSTEIKKTEVLMENFRRAIGLRIK-----ETKEVYEGEVTELTPCHVIIGLKT 141

Query: 126 XXXXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMA 185
                       +     +        + I        +    D      D  + E V  
Sbjct: 142 AKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPL 201

Query: 186 ILRQLRDR-GHTVIIVTHDPLIAAQAERIIEIHDGKIV 222
               +  +      +  HD       +      +  + 
Sbjct: 202 PKGDVHKKKEIIQDVTLHD------LDVANGEINKVVN 233


>2e85A [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
          Length = 156

 Score = 47.6 bits (112), Expect = 1e-07
 Identities = 10/100 (10%), Positives = 23/100 (23%), Gaps = 11/100 (11%)

Query: 136 DRVDYPPSQLSGGQQQRVSIARA-LMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG 194
                    + GG      I     +   ++++ D     L+      +        D  
Sbjct: 31  AAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDP-----DDIA 85

Query: 195 HTVIIVTHDPLIAAQ-----AERIIEIHDGKIVHNPPAEE 229
              ++ TH+  +         +    I  G          
Sbjct: 86  EMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYY 125


>1e9sK [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 46.3 bits (108), Expect = 2e-07
 Identities = 14/102 (13%), Positives = 30/102 (29%), Gaps = 11/102 (10%)

Query: 6   ELRNVSRSYPSGEEQVAVLKDISLQIHA-GEMVAIVGVSGSGKSTLMNILGCLDKPTSGT 64
           +L+ ++R           +  + +   A    + + G +G+GKS L+  L          
Sbjct: 26  KLKRMTREKAKQV----TVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDR 81

Query: 65  YRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQN 106
             +   +   L               I   Y   +   +  N
Sbjct: 82  MVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFN 117


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score = 45.4 bits (105), Expect = 5e-07
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 5  LELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP 60
          + +RN + ++   +     L  I+  I  G +VA+VG  G GKS+L++ L      
Sbjct: 3  ITVRNATFTWARSDPPT--LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDK 56


>1ckeA [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
          Length = 212

 Score = 45.0 bits (105), Expect = 6e-07
 Identities = 38/200 (19%), Positives = 56/200 (28%), Gaps = 20/200 (10%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGC---LDKPTSGT-YRVAG-----RDVSTLDPDALAQLR 84
             ++ I G SG+GK TL   +          SG  YRV         V     DAL  L 
Sbjct: 3   APVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLA 62

Query: 85  REHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQ 144
             H    F   +    +     +E   V   I                   + +      
Sbjct: 63  S-HLDVRFVSTNGNLEV----ILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRA 117

Query: 145 LSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVII-VTHD 203
                     IA     G  V         LD+ S E     + QL+ +G +V       
Sbjct: 118 FRELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLA 174

Query: 204 --PLIAAQAERIIEIHDGKI 221
              L+ A    +++     I
Sbjct: 175 EIKLVPAADALVLDSTTLSI 194


>1dwmA [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
          Length = 69

 Score = 44.8 bits (106), Expect = 7e-07
 Identities = 7/45 (15%), Positives = 16/45 (35%), Gaps = 1/45 (2%)

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIV 222
           SG    A + +     H +++     +      +R+  I +   V
Sbjct: 17  SGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGV 61


>3ci2A [x.x.x] CHYMOTRYPSIN INHIBITOR 2
          Length = 64

 Score = 44.5 bits (105), Expect = 9e-07
 Identities = 6/45 (13%), Positives = 15/45 (33%), Gaps = 1/45 (2%)

Query: 179 SGEEVMAILRQLRDRGHTVIIVTHDPLIAAQ-AERIIEIHDGKIV 222
           S EE   ++ Q +     +++     +      +R+    D    
Sbjct: 12  SVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDN 56


>1agpA [x.x.x] C-H-RAS P21 PROTEIN
          Length = 166

 Score = 44.1 bits (102), Expect = 1e-06
 Identities = 23/159 (14%), Positives = 38/159 (23%), Gaps = 4/159 (2%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + +VG  G GKS L   L            +       +  D    L         + Y 
Sbjct: 6   LVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

Query: 97  LLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP---PSQLSGGQQQRV 153
            +             V+A                     D  D P            + V
Sbjct: 66  AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTV 125

Query: 154 SIARALMNGGQVILADEPTGALDSHSGEEVM-AILRQLR 191
              +A        +    T A      E+    ++R++R
Sbjct: 126 ESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR 164


>3dkvA [x.x.x] ADENYLATE KINASE
          Length = 217

 Score = 43.8 bits (102), Expect = 1e-06
 Identities = 9/79 (11%), Positives = 21/79 (26%), Gaps = 5/79 (6%)

Query: 37  VAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           + ++G+ G+GK T    +    K             + +  +    L          +  
Sbjct: 3   IVLMGLPGAGKGTQAERIVE--KYGIPHISTGDMFRAAMKEETPLGLEA---KSYIDKGE 57

Query: 97  LLSHLTAAQNVEIPAVYAG 115
           L+        V      + 
Sbjct: 58  LVPDEVTIGIVRERLSKSD 76


>1e2hA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 43.7 bits (101), Expect = 1e-06
 Identities = 11/75 (14%), Positives = 20/75 (26%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L                  ++     +   +      
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQG 60

Query: 91  IFQRYHLLSHLTAAQ 105
                     +T+AQ
Sbjct: 61  EISAGDAAVVMTSAQ 75


>1e2kB [c.37.1] THYMIDINE KINASE
          Length = 316

 Score = 43.2 bits (100), Expect = 2e-06
 Identities = 29/192 (15%), Positives = 48/192 (25%), Gaps = 26/192 (13%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTY----RVAGRDVSTLDPDALAQLRRE 86
           +     V I G  G GK+T   +L  L       Y        R +   +  A     + 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 87  HFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLS 146
                       + +  +  + +   YA                     D V    +   
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVT-------------------DAV---LAPHI 98

Query: 147 GGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLI 206
           GG+      A  L+     I A     A     G      +          +  T+  L 
Sbjct: 99  GGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLG 158

Query: 207 AAQAERIIEIHD 218
           A   +R I+   
Sbjct: 159 ALPEDRHIDRLA 170


>2bwjB [x.x.x] ADENYLATE KINASE 5
          Length = 195

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 9/39 (23%), Positives = 15/39 (38%)

Query: 28 SLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYR 66
             +   +++ I+G  GSGK T    L      T  +  
Sbjct: 2  MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG 40


>2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 195

 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 17/81 (20%), Positives = 29/81 (35%), Gaps = 1/81 (1%)

Query: 32  HAGEMVAIVGVSGSGKSTL-MNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
             G  V + G+SG+GK+T+   +   L       Y + G +V       L     +    
Sbjct: 17  FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREEN 76

Query: 91  IFQRYHLLSHLTAAQNVEIPA 111
           I +   +      A  V I +
Sbjct: 77  IRRIAEVAKLFADAGLVCITS 97


>2bhvC [x.x.x] COMB10
          Length = 188

 Score = 41.6 bits (97), Expect = 7e-06
 Identities = 10/102 (9%), Positives = 21/102 (20%), Gaps = 2/102 (1%)

Query: 89  GFIFQRYHLLSH-LTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSG 147
                   ++   L    + +I                         S  + Y  +    
Sbjct: 4   LRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM 63

Query: 148 GQQ-QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILR 188
           G+    +  +R +   G  I+       L     E       
Sbjct: 64  GEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG 105


>3bs4A [x.x.x] UNCHARACTERIZED PROTEIN PH0321
          Length = 245

 Score = 41.4 bits (96), Expect = 7e-06
 Identities = 13/194 (6%), Positives = 37/194 (19%), Gaps = 8/194 (4%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
                ++     + S    ++  +      +     +            + +     FG 
Sbjct: 17  KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYP---LQLIIR-ILSRFGV 72

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYP---PSQLSG 147
              +Y     L                                     D+          
Sbjct: 73  DVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLF 132

Query: 148 GQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIA 207
             ++    A ++    +V   +E    L++   E         +    T   +       
Sbjct: 133 EGRELYGFAISMSGYLEVFTPEETLRYLETS-AEVRYGHPAYKKYPRGTNFWLWEGVKDK 191

Query: 208 AQAERIIEIHDGKI 221
                +    D  +
Sbjct: 192 RVLLSVYRRADYVL 205


>2cfsA [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
          Length = 291

 Score = 41.2 bits (96), Expect = 8e-06
 Identities = 12/80 (15%), Positives = 30/80 (37%), Gaps = 3/80 (3%)

Query: 145 LSGGQQQRVSIARALMNGGQVILAD-EPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHD 203
           ++  ++ R +  R ++   Q +L D +        +      +L +L   G   + V+++
Sbjct: 1   MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNN 60

Query: 204 PLI--AAQAERIIEIHDGKI 221
                   A R   +  G +
Sbjct: 61  SRRARPELALRFARLGFGGL 80


>1brwA [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE
           PHOSPHORYLASE)
          Length = 433

 Score = 40.9 bits (95), Expect = 1e-05
 Identities = 10/77 (12%), Positives = 18/77 (23%), Gaps = 11/77 (14%)

Query: 33  AGEMVAIVGVSG-SGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFI 91
            G  VA +   G       ++ L  +           G  V     + +  +       I
Sbjct: 102 VGVPVAKMSGRGLGHTGGTIDKLESVP----------GFHVEISKDEFIRLVNENGIAII 151

Query: 92  FQRYHLLSHLTAAQNVE 108
            Q   L         + 
Sbjct: 152 GQTGDLTPADKKLYALR 168


>3csuA [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
          Length = 288

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 18/206 (8%), Positives = 48/206 (23%), Gaps = 29/206 (14%)

Query: 52  NILGCLDKPTSGTYRVAGRDVSTLDPDA-LAQLRREHFGFIFQRYHLLSHLTAAQNVEIP 110
           +I+  ++  +     +     + L  +     L+ +     F      + L+   ++   
Sbjct: 8   HIIS-INDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRL 66

Query: 111 AVYAGIXXXXXXXXXXXXXXXXXXSDRV---------DYPPSQLSGGQQQRVSIARALMN 161
                                   S  V         +      +        +     +
Sbjct: 67  GASVVGFSDSGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGDGS 126

Query: 162 G-------GQVILADEPTGAL---------DSHSGEEVMAILRQL-RDRGHTVIIVTHDP 204
                     +    E  G L         D   G  V ++ + L +  G+    +  D 
Sbjct: 127 NQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDA 186

Query: 205 -LIAAQAERIIEIHDGKIVHNPPAEE 229
             +      +++        +   EE
Sbjct: 187 LAMPQYILDMLDEKGIAWSLHSSIEE 212


>2c5mD [x.x.x] CTP SYNTHASE
          Length = 231

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 9/76 (11%), Positives = 20/76 (26%), Gaps = 6/76 (7%)

Query: 150 QQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILR----QLRDRGHTVIIVTHDP- 204
           +       ++      I  D      ++ +  ++   +     +    G TV +V H   
Sbjct: 28  KSCGLHVTSIKI-DPYINIDAGLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITD 86

Query: 205 LIAAQAERIIEIHDGK 220
            I     R        
Sbjct: 87  AIQEWVMRQALEPQVC 102


>3cddA [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 322

 Score = 39.7 bits (92), Expect = 2e-05
 Identities = 25/234 (10%), Positives = 52/234 (22%), Gaps = 21/234 (8%)

Query: 21  VAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRD---VSTLDP 77
             +    SL   +G             +     +            V       ++    
Sbjct: 17  TKIGITRSL-EASGAFDLETYKFLGNDAQYKAFI--EPIKQGQACTVDIGGERVITGYVD 73

Query: 78  DALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSD- 136
           D +                  + L           +                      + 
Sbjct: 74  DWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNT 133

Query: 137 RVDYPP--SQLSGGQQQRVSIARALMNGGQVILADEPTGAL--------DSHSGEEVMAI 186
            V  P    Q+  G+     +AR     G V+L  +  G L         +     +   
Sbjct: 134 DVGEPFQRIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVSLILGDN 192

Query: 187 LRQLRDRGHTVIIVTHDPLIAAQAE---RIIEIHDGKIVHNPPAEEKKREQGVD 237
           ++  R R       +   + AA+A+     I  +   I+ N     +   +   
Sbjct: 193 VKAARGRFSWRQRFSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQ 246


>2axnA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 451

 Score = 39.7 bits (90), Expect = 2e-05
 Identities = 5/49 (10%), Positives = 16/49 (32%), Gaps = 5/49 (10%)

Query: 3  ALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLM 51
              ++ +                 S   ++  ++ +VG+   GK+ + 
Sbjct: 4  TQSRVQKIWVPVD-----HRPSLPRSCGPNSPTVIVMVGLPARGKTYIS 47


>2ekbA [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
          Length = 171

 Score = 38.7 bits (89), Expect = 5e-05
 Identities = 10/83 (12%), Positives = 23/83 (27%), Gaps = 1/83 (1%)

Query: 137 RVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMA-ILRQLRDRGH 195
           R+     ++  G  +            + +L  +        S       + R L     
Sbjct: 67  RLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKA 126

Query: 196 TVIIVTHDPLIAAQAERIIEIHD 218
             ++ TH  ++ A    + E   
Sbjct: 127 PAVLFTHGGVVRAVLRALGEDGL 149


>2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 198

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 17/81 (20%), Positives = 29/81 (35%), Gaps = 1/81 (1%)

Query: 32  HAGEMVAIVGVSGSGKSTL-MNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
             G  V + G+SG+GK+T+   +   L       Y + G +V       L     +    
Sbjct: 20  FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREEN 79

Query: 91  IFQRYHLLSHLTAAQNVEIPA 111
           I +   +      A  V I +
Sbjct: 80  IRRIAEVAKLFADAGLVCITS 100


>3dmdA [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 310

 Score = 38.3 bits (87), Expect = 7e-05
 Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 4/56 (7%)

Query: 1   MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGC 56
             A+ E  +          +   L +   +     ++  VG +GSGK+T +  L  
Sbjct: 86  EEAVKEAVSEILETS----RRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLAN 137


>2c95B [x.x.x] ADENYLATE KINASE 1
          Length = 194

 Score = 38.1 bits (87), Expect = 8e-05
 Identities = 20/196 (10%), Positives = 43/196 (21%), Gaps = 16/196 (8%)

Query: 29  LQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPT---SGTYRVAGRDVSTLDPDALAQLRR 85
            ++    ++ +VG  GSGK T    +      T   +G    +     +         ++
Sbjct: 2   EKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARG------KK 55

Query: 86  EHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQL 145
                   +   L  +       + A                         R+  P   L
Sbjct: 56  LSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLL 115

Query: 146 SGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRG-----HTVIIV 200
                      R L  G      D+    +     E        +            +  
Sbjct: 116 YVDAGPETMTQRLLKRGETSGRVDDNEETIKKRL-ETYYKATEPVIAFYEKRGIVRKVNA 174

Query: 201 THDP-LIAAQAERIIE 215
                 + +Q    ++
Sbjct: 175 EGSVDSVFSQVCTHLD 190


>3e70C [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 307

 Score = 37.5 bits (85), Expect = 1e-04
 Identities = 13/93 (13%), Positives = 29/93 (31%), Gaps = 5/93 (5%)

Query: 4   LLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
              +  +  +          L +   +     ++  VG +GSGK+T +  L    K    
Sbjct: 87  KEAVSEILETS--RRI---DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGF 141

Query: 64  TYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
           +  +A  D          +   +  G    ++ 
Sbjct: 142 SVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHS 174


>1e2lB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 37.3 bits (85), Expect = 1e-04
 Identities = 23/196 (11%), Positives = 51/196 (26%), Gaps = 18/196 (9%)

Query: 31  IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGF 90
           +     V I G  G GK+T   +L            +  RD     P+ +   R    G 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLL----------VALGSRDDIVYVPEPMTYWRVL--GA 48

Query: 91  IFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDYPPSQLSGGQQ 150
                ++ +        EI A  A +                     +       +G   
Sbjct: 49  SETIANIFTTQHRLDQGEISAGDAAV--VMTSAQITMGMPYAVTDAVLAPHIGGEAGSPP 106

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRD--RGHTVIIVTHDPLIA- 207
               I         +         + S + + V+A +  +     G  +++         
Sbjct: 107 ALTLIFDRHPIAALLCY-PAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHI 165

Query: 208 AQAERIIEIHDGKIVH 223
            +  + +++     + 
Sbjct: 166 DRLAKRLDLAMLAAIR 181


>1dapA [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
          Length = 320

 Score = 37.3 bits (85), Expect = 1e-04
 Identities = 7/31 (22%), Positives = 10/31 (32%)

Query: 24  LKDISLQIHAGEMVAIVGVSGSGKSTLMNIL 54
                  +  G  V   G +G    T+  IL
Sbjct: 235 FDSEHTGMPHGGHVITTGDTGGFNHTVEYIL 265


>1e2jB [c.37.1] THYMIDINE KINASE
          Length = 314

 Score = 36.7 bits (83), Expect = 2e-04
 Identities = 12/78 (15%), Positives = 20/78 (25%), Gaps = 4/78 (5%)

Query: 34  GEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQ 93
              V I G  G GK+T   +L  L       Y         +   +          +  Q
Sbjct: 4   LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS----ETIANIYTTQ 59

Query: 94  RYHLLSHLTAAQNVEIPA 111
                  ++A     +  
Sbjct: 60  HRLDQGEISAGDAAVVMT 77


>3cddB [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 320

 Score = 36.6 bits (82), Expect = 2e-04
 Identities = 20/237 (8%), Positives = 50/237 (21%), Gaps = 15/237 (6%)

Query: 21  VAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGRDVSTLDPDAL 80
           +     I        +   +  SG+        LG   +  +    +      T+D    
Sbjct: 5   LKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDIGGE 64

Query: 81  AQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAG-------------IXXXXXXXXXXX 127
             +      ++         ++ +   +   +                +           
Sbjct: 65  RVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPF 124

Query: 128 XXXXXXXSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAIL 187
                  +D  +          +    +   L     V+L  +  G L      +  A +
Sbjct: 125 GIKVIVNTDVGEPFQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGV 184

Query: 188 RQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTA 244
             +      V           +  +       K         + R   +    V TA
Sbjct: 185 SLILG--DNVKAARGRFSWRQRFSKFTIKGGIKADVTDSEIGRYRPLIIVNEEVTTA 239


>3bb4A [x.x.x] T7I23.11 PROTEIN
          Length = 240

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 7/38 (18%), Positives = 11/38 (28%), Gaps = 2/38 (5%)

Query: 35 EMVAIVGVSGSGKSTLMNIL--GCLDKPTSGTYRVAGR 70
          E V       + +  L+            S T  V G+
Sbjct: 1  EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGK 38


>2c9oB [x.x.x] RUVB-LIKE 1
          Length = 393

 Score = 36.5 bits (82), Expect = 2e-04
 Identities = 18/98 (18%), Positives = 32/98 (32%), Gaps = 5/98 (5%)

Query: 4   LLELRNVSRSYPSGEEQV-----AVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLD 58
              L   + S   G+E        +++ I  +  AG  V + G  G+GK+ L   +    
Sbjct: 20  ESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQEL 79

Query: 59  KPTSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYH 96
                   + G +V + +      L       I  R  
Sbjct: 80  GSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIK 117


>3cr8B [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
          Length = 493

 Score = 34.6 bits (78), Expect = 8e-04
 Identities = 4/87 (4%), Positives = 16/87 (18%), Gaps = 10/87 (11%)

Query: 151 QRVSIARALMNGGQVILADEPTGALDSHSGEE-------VMAILRQLRDRGHTVIIVTHD 203
             + +        ++ L       L                 +           +     
Sbjct: 30  PSLDLDWQQQCELEM-LMTGAYSPLTGFMTRAQCARVESAQQLDDGSFWPSPITLTSRDR 88

Query: 204 PLIAAQAERIIEI--HDGKIVHNPPAE 228
            L   +    + +   +G ++      
Sbjct: 89  ALADRRPGERLALRDGEGYMLAILTLS 115


>2bwjD [x.x.x] ADENYLATE KINASE 5
          Length = 192

 Score = 34.6 bits (78), Expect = 8e-04
 Identities = 9/33 (27%), Positives = 14/33 (42%)

Query: 31 IHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSG 63
          +   +++ I+G  GSGK T    L      T  
Sbjct: 4  LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL 36


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0367    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 30,048,770
Number of extensions: 1906708
Number of successful extensions: 23800
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 11553
Number of HSP's successfully gapped: 819
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)