RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF69590.1 sent8 glpB GIB00763CH01 "glycerol-3-phosphate
dehydrogenase, anaerobic, B.."
         (419 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1e39A [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3                   43   2e-06
2b7rA [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT                  41   5e-06
2b7sA [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT                  38   6e-05
1d4cA [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE RED...    36   3e-04

>1e39A [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
          Length = 568

 Score = 42.9 bits (99), Expect = 2e-06
 Identities = 10/93 (10%), Positives = 24/93 (25%), Gaps = 8/93 (8%)

Query: 331 LGLDVQQTATRAEWYQQHFFDPQP------WQQFGVVTDDAFRPSLAGNTVENLYAIGSV 384
              D ++        + +++  +            ++   A   +     +  LY  G V
Sbjct: 476 KDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEV 535

Query: 385 LAGFDPIAEGCGGGV--CAVSALQAAHHIAERA 415
             G        G  +         A    A+ +
Sbjct: 536 TGGVHGANRLGGNAISDIITFGRLAGEEAAKYS 568


>2b7rA [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
          Length = 568

 Score = 41.5 bits (95), Expect = 5e-06
 Identities = 12/60 (20%), Positives = 18/60 (30%), Gaps = 3/60 (5%)

Query: 359 GVVTD-DAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGV--CAVSALQAAHHIAERA 415
           GV+ D  A   +     +  LY  G V  G        G  +         A    A+ +
Sbjct: 509 GVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS 568


>2b7sA [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
          Length = 568

 Score = 37.7 bits (85), Expect = 6e-05
 Identities = 13/90 (14%), Positives = 26/90 (28%), Gaps = 8/90 (8%)

Query: 334 DVQQTATRAEWYQQHFFDPQPWQ-----QFGVVTD-DAFRPSLAGNTVENLYAIGSVLAG 387
           D ++        + +++  +          GV+ D  A   +     +  LY  G V  G
Sbjct: 479 DFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGG 538

Query: 388 FDPIAEGCGGGV--CAVSALQAAHHIAERA 415
                   G  +         A    A+ +
Sbjct: 539 VHGANRLGGNAISDIITFGRLAGEEAAKYS 568


>1d4cA [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
           REDUCTASE
          Length = 570

 Score = 35.6 bits (80), Expect = 3e-04
 Identities = 12/76 (15%), Positives = 19/76 (25%), Gaps = 2/76 (2%)

Query: 344 WYQQHFFDPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGV--CA 401
             +             + T    +    G  +  LYA G V  G        G  +    
Sbjct: 495 ALEIAPAVHHTMGGLVIDTKAEVKSEKTGKPITGLYAAGEVTGGVHGANRLGGNAISDIV 554

Query: 402 VSALQAAHHIAERAGE 417
                A    A+ A +
Sbjct: 555 TYGRIAGASAAKFAKD 570


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0341    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 32,469,486
Number of extensions: 2074120
Number of successful extensions: 21852
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9532
Number of HSP's successfully gapped: 509
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)