RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF69636.1 sent8 ACF69636.1 GIB00763CH01 "2,5-diketo-D-gluconic
acid reductase A"
         (289 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3b3dB [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE                         236   5e-65
3b3dA [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE                         223   7e-61
1a80A [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A                  218   2e-59
2alrA [x.x.x] ALDEHYDE REDUCTASE                                      207   4e-56
2bgsA [x.x.x] ALDOSE REDUCTASE                                        201   2e-54
2acuA [x.x.x] ALDOSE REDUCTASE                                        201   2e-54
1az1A [x.x.x] ALDOSE REDUCTASE                                        200   6e-54
2dv0A [x.x.x] ALDOSE REDUCTASE                                        198   2e-53
3c3uA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1                  196   8e-53
1afsA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE                    195   1e-52
1c9wA [c.1.7] CHO REDUCTASE                                           195   1e-52
2acsA [x.x.x] ALDOSE REDUCTASE                                        195   2e-52
3d3fA [x.x.x] YVGN PROTEIN                                            193   5e-52
3cv6A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21                 193   7e-52
1ah3A [c.1.7 (1ekoA)] ALDOSE REDUCTASE                                188   2e-50
1adsA [c.1.7 (1ef3A)] ALDOSE REDUCTASE                                186   9e-50
3eauA [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2          185   2e-49
3burA [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE                    184   2e-49
2bgqA [x.x.x] ALDOSE REDUCTASE                                        183   4e-49
3caqB [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE                    181   3e-48
2agtA [x.x.x] ALDOSE REDUCTASE                                        179   8e-48
1ah0A [x.x.x] ALDOSE REDUCTASE                                        179   1e-47
3cv7A [x.x.x] ALCOHOL DEHYDROGENASE                                   174   3e-46
3eb4A [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2          170   5e-45
2bp1B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                168   2e-44
2c91A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                167   3e-44
3eb3A [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2          167   4e-44
2c91B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                161   3e-42
2clpA [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3                161   3e-42
3cd5C [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         160   4e-42
2bp1A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2                159   8e-42
1dq8D [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 158   3e-41
1dqaD [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 155   2e-40
1dq8B [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 154   4e-40
1dq9C [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 152   1e-39
2ao0A [x.x.x] ALDEHYDE DEHYDROGENASE                                  152   2e-39
1dq9B [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 148   2e-38
1dqaB [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 148   3e-38
2clpI [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3                144   2e-37
3cdbC [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         144   3e-37
3cdaA [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         143   8e-37
3bglD [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         142   1e-36
3cctC [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         139   7e-36
1dq8A [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 134   2e-34
1dq8C [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 134   3e-34
3cd5D [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         129   9e-33
2aicA [x.x.x] GUANINE NUCLEOTIDE EXCHANGE FACTOR BOPE                 121   3e-30
3cdaD [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE         113   9e-28
1dq9D [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                 111   3e-27
1dy1A [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN                          106   7e-26
2d4cA [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2                      103   9e-25
3cd0D [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE          99   2e-23
1dy0A [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN                           98   4e-23
2d4cB [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2                       97   7e-23
3ee8B [x.x.x] NON-STRUCTURAL PROTEIN 1                                 93   7e-22
3ee8A [x.x.x] NON-STRUCTURAL PROTEIN 1                                 87   7e-20
2d4cC [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2                       82   2e-18
1dqaC [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)                  58   3e-11
3bmaF [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE                    56   2e-10

>3b3dB [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
          Length = 277

 Score =  236 bits (604), Expect = 5e-65
 Identities = 118/265 (44%), Positives = 170/265 (64%), Gaps = 5/265 (1%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
           ++     +N ++MP  G GVF+V +  E   +V +AI  GYR IDTAA+YGNE  VG+ +
Sbjct: 2   LQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGI 61

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH-QAMGDY 118
           R+ I     +RE+LFITSK+W  D+  Y+   A  E SL K GLDY DLYL+H    G Y
Sbjct: 62  REGIEEAGISREDLFITSKVWNADL-GYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKY 120

Query: 119 FSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETM 178
             AWRALE  Y+ G++KAIGVSNF  H L +      I PM+NQVE HP   Q   +   
Sbjct: 121 KEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYC 180

Query: 179 KHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQE 238
           ++  +Q EAW+PL  G+    ++ +L  IA  + K++AQ++LRW++Q G+  IPKST++ 
Sbjct: 181 QNQGIQMEAWSPLMQGQL--LDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEH 238

Query: 239 RIEENFAIWDFSLTDNEMAQINALD 263
           RI+EN +++DF LT ++M +I+AL+
Sbjct: 239 RIKENASVFDFELTQDDMNRIDALN 263


>3b3dA [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
          Length = 280

 Score =  223 bits (568), Expect = 7e-61
 Identities = 117/265 (44%), Positives = 171/265 (64%), Gaps = 5/265 (1%)

Query: 1   MEY-SILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
           ++  + L N ++MP  G GVF+V +  E   +V +AI  GYR IDTAA+YGNE  VG+ +
Sbjct: 5   LQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGI 64

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF 119
           R+ I     +RE+LFITSK+W  D+  Y+   A  E SL K GLDY DLYL+H  +   +
Sbjct: 65  REGIEEAGISREDLFITSKVWNADL-GYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKY 123

Query: 120 -SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETM 178
             AWRALE  Y+ G++KAIGVSNF  H L +      I PM+NQVE HP   Q   +   
Sbjct: 124 KEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYC 183

Query: 179 KHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQE 238
           ++  +Q EAW+PL  G+    ++ +L  IA  + K++AQ++LRW++Q G+  IPKST++ 
Sbjct: 184 QNQGIQMEAWSPLMQGQL--LDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEH 241

Query: 239 RIEENFAIWDFSLTDNEMAQINALD 263
           RI+EN +++DF LT ++M +I+AL+
Sbjct: 242 RIKENASVFDFELTQDDMNRIDALN 266


>1a80A [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
          Length = 277

 Score =  218 bits (556), Expect = 2e-59
 Identities = 110/269 (40%), Positives = 155/269 (57%), Gaps = 9/269 (3%)

Query: 1   MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVR 60
           +   +L++   +P +G+GVFKV    + Q++V  A+  GYR IDTAA+YGNE+ VG    
Sbjct: 2   VPSIVLNDGNSIPQLGYGVFKV-PPADTQRAVEEALEVGYRHIDTAAIYGNEEGVG---- 56

Query: 61  KAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG---D 117
            AIA     R++LFIT+KLW     + D   A I  SL K  LD  DLYL+H       +
Sbjct: 57  AAIAASGIARDDLFITTKLWNDRH-DGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADN 115

Query: 118 YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALET 177
           Y  AW  + +   AG  ++IGVSN     L        + P VNQ+ELHP + Q    + 
Sbjct: 116 YVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDW 175

Query: 178 MKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQ 237
              ++V+ E+W PLG G++  +    +   A AH KT AQ VLRW++Q+G  V PKS R+
Sbjct: 176 AAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRR 235

Query: 238 ERIEENFAIWDFSLTDNEMAQINALDLGY 266
           ER+EEN  ++DF LTD E+A I+A+D G 
Sbjct: 236 ERLEENLDVFDFDLTDTEIAAIDAMDPGD 264


>2alrA [x.x.x] ALDEHYDE REDUCTASE
          Length = 312

 Score =  207 bits (527), Expect = 4e-56
 Identities = 92/284 (32%), Positives = 148/284 (52%), Gaps = 28/284 (9%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K     + + +V  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 6   LLHTGQKMPLIGLGTWKSEP-GQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVG 64

Query: 65  TG-LCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------- 116
            G    REELF+TSKLW     + +  +  +  +L    L+Y DLYL+H           
Sbjct: 65  PGKAVPREELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNP 123

Query: 117 --------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 124 FPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRW 222
           VE HPY AQ   +   +   ++  A++PLG    +P    ++  +A+ + ++ AQ++LRW
Sbjct: 184 VECHPYLAQNELIAHCQARGLEVTAYSPLGVLLEEP----VVLALAEKYGRSPAQILLRW 239

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
            VQR V  IPKS    RI +N  ++DF+ +  EM Q+NAL+  +
Sbjct: 240 QVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNW 283


>2bgsA [x.x.x] ALDOSE REDUCTASE
          Length = 308

 Score =  201 bits (513), Expect = 2e-54
 Identities = 79/276 (28%), Positives = 141/276 (51%), Gaps = 20/276 (7%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L +   MP VG G ++    +       +   +GYR +DTAA YG E  VG  ++ A+ 
Sbjct: 5   VLKSGHAMPAVGLGTWRAGS-DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAME 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
            G+  R++LF+TSK+W  ++   +  +  +E +LK   LDY DLY +H            
Sbjct: 64  AGID-RKDLFVTSKIWCTNL-APERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMP 121

Query: 117 ---------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHP 167
                    D    W+ +E+  + G +K IGV N+    L     + +I P V Q+E+HP
Sbjct: 122 PEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHP 181

Query: 168 YFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRG 227
            +      E  K + +   A++PLG        + +++++A+   KT  QV+++W +QRG
Sbjct: 182 GWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWALQRG 241

Query: 228 VTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            +VIPKS++ ERI+EN  ++ + + + +   + ++ 
Sbjct: 242 TSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK 277


>2acuA [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  201 bits (512), Expect = 2e-54
 Identities = 91/290 (31%), Positives = 142/290 (48%), Gaps = 33/290 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K     +  ++V  AI  GYR ID A V+ NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASL------------------KKSGLDYF 106
             +  REELFI SKLW        L K   + +L                   K G ++F
Sbjct: 64  EQVVKREELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 122

Query: 107 DLYLLHQ---AMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCE--TVRITPMVN 161
            L        +  +    W A+E+  + G +KAIG+SNF    +        ++  P VN
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 182

Query: 162 QVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK--------PYENVMLQRIADAHQK 213
           Q+E HPY  Q   ++  +   +   A++PLG               E+  ++ IA  H K
Sbjct: 183 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNK 242

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +
Sbjct: 243 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN 292


>1az1A [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  200 bits (508), Expect = 6e-54
 Identities = 88/293 (30%), Positives = 137/293 (46%), Gaps = 33/293 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASL------------------KKSGLDYF 106
             +  REELFI SKLW        L K   + +L                   K G ++F
Sbjct: 63  EQVVKREELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 121

Query: 107 DLYLLHQ---AMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV 163
            L        +  +    W A+E+  + G +KAIG+SNF    +        +       
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 181

Query: 164 --ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHK--------PYENVMLQRIADAHQK 213
             E HPY  Q   ++  +   +   A++PLG               E+  ++ IA  H K
Sbjct: 182 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNK 241

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +  +
Sbjct: 242 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW 294


>2dv0A [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  198 bits (504), Expect = 2e-53
 Identities = 88/293 (30%), Positives = 137/293 (46%), Gaps = 33/293 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASL------------------KKSGLDYF 106
             +  REELFI SKLW        L K   + +L                   K G ++F
Sbjct: 63  EQVVKREELFIVSKLW-CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 121

Query: 107 DLYLLH---QAMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV 163
            L        +  +    W A+E+  + G +KAIG+SNF    +        +       
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 181

Query: 164 --ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAHQK 213
             E HPY  Q   ++  +   +   A++PLG               E+  ++ IA  H K
Sbjct: 182 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNK 241

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +  +
Sbjct: 242 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW 294


>3c3uA [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
          Length = 320

 Score =  196 bits (498), Expect = 8e-53
 Identities = 97/297 (32%), Positives = 148/297 (49%), Gaps = 35/297 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFKV--TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDA 58
            +   L++   MP++GFG +      K +  ++   AI +G+R ID+A +Y NE+ VG A
Sbjct: 2   YQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLA 61

Query: 59  VRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-- 116
           +R  IA G   RE++F TSKLW       +L +  +E SLK   LDY DLYL+H  +   
Sbjct: 62  IRSKIADGSVKREDIFYTSKLWCNSH-RPELVRPALERSLKNLQLDYVDLYLIHFPVSVK 120

Query: 117 -------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRIT 157
                              D  + W A+E   +AG  K+IGVSNF    L        + 
Sbjct: 121 PGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLK 180

Query: 158 PMVNQV--ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQR 206
                   E HPYF Q   L+  K  ++   A++ LG  R +P+         E+ +L  
Sbjct: 181 YKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCA 240

Query: 207 IADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           +A  H++T A + LR+ +QRGV V+ KS  ++RI +N  +++F LT  EM  I+ L+
Sbjct: 241 LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN 297


>1afsA [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
          Length = 319

 Score =  195 bits (497), Expect = 1e-52
 Identities = 88/301 (29%), Positives = 143/301 (47%), Gaps = 36/301 (11%)

Query: 1   MEYS-ILSNNLKMPMVGFGVFKV--TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
           +     L++   +P++GFG        K+E  ++   AI +G+R  D+A +Y  E+ VG 
Sbjct: 4   ISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQ 63

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
           A+R  I  G   RE++F TSKLW       +L +  +E +LK + LDY DLY++H  M  
Sbjct: 64  AIRSKIEDGTVKREDIFYTSKLWSTFH-RPELVRTCLEKTLKSTQLDYVDLYIIHFPMAL 122

Query: 117 --------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--V 154
                               D    W A+E   +AG  K+IGVSNF    L        +
Sbjct: 123 QPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGL 182

Query: 155 RITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGR---------HKPYENVMLQ 205
           +  P+ NQVE H Y  Q   L+  K  ++   ++  LG  R             ++ +L 
Sbjct: 183 KYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLC 242

Query: 206 RIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLG 265
            IA  +++T A V LR+ +QRGV  + +S   +RI+E   +++F L   +M  ++ L+  
Sbjct: 243 AIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRN 302

Query: 266 Y 266
           +
Sbjct: 303 F 303


>1c9wA [c.1.7] CHO REDUCTASE
          Length = 315

 Score =  195 bits (496), Expect = 1e-52
 Identities = 92/295 (31%), Positives = 138/295 (46%), Gaps = 33/295 (11%)

Query: 3   YSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           +  LS   KMP+VG G ++     + +++V  AI +GYR ID A  Y NE  VG+A+++ 
Sbjct: 3   FVELSTKAKMPIVGLGTWQS-PPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQEK 61

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGI-------------------EASLKKSGL 103
           I      RE+LFI SKLW        L K                         L+    
Sbjct: 62  IKEKAVRREDLFIVSKLW-PTCFERKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKE 120

Query: 104 DYFDLYLLHQ--AMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET--VRITPM 159
            +      +   +   +  AW  +E+  + G +KA+GVSNF    +        ++  P+
Sbjct: 121 LFPKDDQGNVLTSKITFLDAWEVMEELVDEGLVKALGVSNFNHFQIERILNKPGLKHKPV 180

Query: 160 VNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAH 211
            NQVE HPY  Q   +E      +   A++PLG               E+  ++ IA  H
Sbjct: 181 TNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRPWAKPEDPSLLEDPKIKEIAAKH 240

Query: 212 QKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           +KT AQV++R+++QR V VIPKS    RI ENF ++DF L+D EMA I   +  +
Sbjct: 241 KKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATILGFNRNW 295


>2acsA [x.x.x] ALDOSE REDUCTASE
          Length = 314

 Score =  195 bits (495), Expect = 2e-52
 Identities = 88/293 (30%), Positives = 137/293 (46%), Gaps = 33/293 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 4   LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 62

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASL------------------KKSGLDYF 106
             +  REELFI SKLW        L K   + +L                   K G ++F
Sbjct: 63  EQVVKREELFIVSKLW-CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 121

Query: 107 DLYLLHQAMGDYFS---AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV 163
            L      +    +    W A+E+  + G +KAIG+SNF    +        +       
Sbjct: 122 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 181

Query: 164 --ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAHQK 213
             E HPY  Q   ++  +   +   A++PLG               E+  ++ IA  H K
Sbjct: 182 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNK 241

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +  +
Sbjct: 242 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW 294


>3d3fA [x.x.x] YVGN PROTEIN
          Length = 275

 Score =  193 bits (491), Expect = 5e-52
 Identities = 119/268 (44%), Positives = 168/268 (62%), Gaps = 9/268 (3%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
           ++ ++  +N ++MP  G GVFKV +  E  +SV +AI++GYR IDTAA+Y NE+ VG  +
Sbjct: 4   LKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGI 63

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-DY 118
           +++       REELFITSK+W +D   Y+   A  E SL++  LDY DLYL+H      Y
Sbjct: 64  KESGVA----REELFITSKVWNEDQ-GYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKY 118

Query: 119 FSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETM 178
              WRALE  Y+ GK++AIGVSNF  H L    +   I PMVNQVE HP   Q    +  
Sbjct: 119 KDTWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYC 178

Query: 179 KHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQE 238
           K   +Q EAW+PL  G+    +N +L +IA+ H K++AQV+LRW++Q GV  IPKS ++ 
Sbjct: 179 KGQGIQLEAWSPLMQGQL--LDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEH 236

Query: 239 RIEENFAIWDFSLTDNEMAQINALDLGY 266
           RI EN  I+DF L+  +M +I+AL+   
Sbjct: 237 RIIENADIFDFELSQEDMDKIDALNKDE 264


>3cv6A [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
          Length = 323

 Score =  193 bits (490), Expect = 7e-52
 Identities = 90/297 (30%), Positives = 146/297 (49%), Gaps = 35/297 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFKV--TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDA 58
               IL++   +P++GFG        K + ++    AI +G+   D+A+VY  ED VG+A
Sbjct: 5   CHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEA 64

Query: 59  VRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-- 116
           +R  IA G   RE++F TSK+W   + + +L +A +E SL+K   DY DLYL+H  M   
Sbjct: 65  IRSKIADGTVRREDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMALK 123

Query: 117 -------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRIT 157
                              D  + W A+E   +AG  K+IGVSNF    L        + 
Sbjct: 124 PGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLK 183

Query: 158 PMVNQV--ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVMLQR 206
                   E HPY  Q   L+  K  ++   A+  LG  R+ P+         +  +L  
Sbjct: 184 YKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYPPWVDQNSPVLLDEPVLGS 243

Query: 207 IADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           +A  + +T A + LR+ +QRG+ V+  S ++ERI+EN  +++F L+  +M  ++ L+
Sbjct: 244 MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN 300


>1ah3A [c.1.7 (1ekoA)] ALDOSE REDUCTASE
          Length = 314

 Score =  188 bits (477), Expect = 2e-50
 Identities = 84/289 (29%), Positives = 128/289 (44%), Gaps = 31/289 (10%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG  +++ + 
Sbjct: 4   VLYTGAKMPILGLGTWKSPP-GKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQ 62

Query: 65  TGLCTREELFITSKLWVQDMAN------------------YDLAKAGIEASLKKSGLDYF 106
             +  RE+LFI SKLW  D                      DL         K     + 
Sbjct: 63  GQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFP 122

Query: 107 DLYLLHQAMGDYFSA--WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQV- 163
                +    +      W A+E+  + G +KAIGVSNF    +        +        
Sbjct: 123 LDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQ 182

Query: 164 -ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAHQKT 214
            E+HPY  Q   +E  K   +   A++PLG               E+  ++ IA  + KT
Sbjct: 183 IEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKT 242

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +
Sbjct: 243 TAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN 291


>1adsA [c.1.7 (1ef3A)] ALDOSE REDUCTASE
          Length = 315

 Score =  186 bits (472), Expect = 9e-50
 Identities = 97/290 (33%), Positives = 145/290 (50%), Gaps = 33/290 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L+N  KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG A+++ + 
Sbjct: 5   LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 63

Query: 65  TGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
             +  REELFI SKLW        L K   + +L    LDY DLYL+H   G        
Sbjct: 64  EQVVKREELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 122

Query: 117 -------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVL--ANFCETVRITPMVN 161
                        +    W A+E+  + G +KAIG+SNF    +        ++  P VN
Sbjct: 123 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 182

Query: 162 QVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAHQK 213
           Q+E HPY  Q   ++  +   +   A++PLG               E+  ++ IA  H K
Sbjct: 183 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNK 242

Query: 214 TIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
           T AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +
Sbjct: 243 TTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN 292


>3eauA [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
          Length = 327

 Score =  185 bits (469), Expect = 2e-49
 Identities = 59/323 (18%), Positives = 108/323 (33%), Gaps = 58/323 (17%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKV----TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAV 55
             Y  L  + L++  +G G +         E  +  +  A  +G  L DTA VY    A 
Sbjct: 3   QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA- 61

Query: 56  GDAVRKAIATGLCTREELFITSKLWVQDMA------NYDLAKAGIEASLKKSGLDYFDLY 109
              +   I      R  L IT+K++    A      +      G++ASL++  L+Y D+ 
Sbjct: 62  EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVV 121

Query: 110 LLHQAMG--DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQV 163
             ++           RA+      G     G S + +  +       R    I P+  Q 
Sbjct: 122 FANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQA 181

Query: 164 ELHPYFAQPAA---LETMKHYNVQPEAWAPLGGGRHKPYENVM----------------- 203
           E H +  +       E      V    W+PL  G      +                   
Sbjct: 182 EYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKD 241

Query: 204 ----------------LQRIADAHQKTIAQVVLRWNVQR--GVTVIPKSTRQERIEENFA 245
                           LQ IA+    T+ Q+ + W ++     +V+  ++  E++ EN  
Sbjct: 242 KILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG 301

Query: 246 I--WDFSLTDNEMAQINALDLGY 266
                  L+ + + +I+++    
Sbjct: 302 AIQVLPKLSSSIVHEIDSILGNK 324


>3burA [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
          Length = 325

 Score =  184 bits (468), Expect = 2e-49
 Identities = 100/299 (33%), Positives = 153/299 (51%), Gaps = 37/299 (12%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVG 56
             + I  ++   +P++G G +     T K  C  SV  AI +GYR ID A +Y NE  VG
Sbjct: 5   ASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVG 64

Query: 57  DAVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLH---- 112
           +A+R+ IA G   RE++F   KLW  +    ++ +  +E +L+   LDY DLY++     
Sbjct: 65  EAIREKIAEGKVRREDIFYCGKLWATNH-VPEMVRPTLERTLRVLQLDYVDLYIIEVPMA 123

Query: 113 -----------------QAMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR 155
                                +  + W A+E   +AG +K++GVSNF    L        
Sbjct: 124 FKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPG 183

Query: 156 ITPMVNQVE--LHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVML 204
           +       +   HPYF QP  L+  + +++   A++PLG  R+  +         ++ +L
Sbjct: 184 LKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALL 243

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
             +   + KT AQ+VLR+N+QRGV VIPKS   ERI+ENF I+DFSLT+ EM  I AL+
Sbjct: 244 NSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN 302


>2bgqA [x.x.x] ALDOSE REDUCTASE
          Length = 305

 Score =  183 bits (466), Expect = 4e-49
 Identities = 78/281 (27%), Positives = 140/281 (49%), Gaps = 28/281 (9%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
            +   +  +   MP VG G +     +       +   +GYR +DTAA YG E  VG  +
Sbjct: 4   EQDHFVLKSGHAMPAVGLGTW-----DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGL 58

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--- 116
           + A+  G+  R++LF+TSK+W  ++   +  +  +E +LK   LDY DLY +H       
Sbjct: 59  KAAMEAGID-RKDLFVTSKIWCTNL-APERVRPALENTLKDLQLDYIDLYHIHWPFRLKD 116

Query: 117 --------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                         D    W+ +E+  + G +K IGV N+    L     + +I P V Q
Sbjct: 117 GAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQ 176

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRW 222
           +E+HP +      E  K + +   A++PLG        + +++++A+   KT  QV+++W
Sbjct: 177 MEMHPGWKNDKIFEACKKHGIHITAYSPLGKNL---AHDPVVEKVANKLNKTPGQVLIKW 233

Query: 223 NVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            +QRG +VIPKS++ ERI+EN  ++ + + + +   + ++ 
Sbjct: 234 ALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK 274


>3caqB [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
          Length = 324

 Score =  181 bits (459), Expect = 3e-48
 Identities = 108/302 (35%), Positives = 161/302 (53%), Gaps = 37/302 (12%)

Query: 1   MEYSI-LSNNLKMPMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVG 56
             + I LS+   +P++G G +     T K  C  SV  AI +GYR ID A +Y NE  VG
Sbjct: 4   ASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVG 63

Query: 57  DAVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG 116
           +A+R+ IA G   RE++F   KLW  +    ++ +  +E +L+   LDY DLY++   M 
Sbjct: 64  EAIREKIAEGKVRREDIFYCGKLWATNH-VPEMVRPTLERTLRVLQLDYVDLYIIEVPMA 122

Query: 117 ---------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCET-- 153
                                +  + W A+E   +AG +K++GVSNF    L        
Sbjct: 123 FKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPG 182

Query: 154 VRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY---------ENVML 204
           ++  P+ NQVE HPYF QP  L+  + +++   A++PLG  R+  +         ++ +L
Sbjct: 183 LKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALL 242

Query: 205 QRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
             +   + KT AQ+VLR+N+QRGV VIPKS   ERI+ENF I+DFSLT+ EM  I AL+ 
Sbjct: 243 NSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNK 302

Query: 265 GY 266
             
Sbjct: 303 NV 304


>2agtA [x.x.x] ALDOSE REDUCTASE
          Length = 316

 Score =  179 bits (455), Expect = 8e-48
 Identities = 100/295 (33%), Positives = 145/295 (49%), Gaps = 34/295 (11%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
           M   IL NN  KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG A+
Sbjct: 1   MASRILLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAI 59

Query: 60  RKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG--- 116
           ++ +   +  REELFI SKLW        L K   + +L    LDY DLYL+H   G   
Sbjct: 60  QEKLREQVVKREELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKP 118

Query: 117 ------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRI-- 156
                             +    W A+E+  + G +KAIG+SNF    +        +  
Sbjct: 119 GKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKY 178

Query: 157 TPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIA 208
            P VNQ+E HPY  Q   ++  +   +   A++PLG               E+  ++ IA
Sbjct: 179 KPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIA 238

Query: 209 DAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
             H KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +
Sbjct: 239 AKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN 293


>1ah0A [x.x.x] ALDOSE REDUCTASE
          Length = 315

 Score =  179 bits (454), Expect = 1e-47
 Identities = 93/292 (31%), Positives = 141/292 (48%), Gaps = 33/292 (11%)

Query: 3   YSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKA 62
           + +L    KMP++G G +K     +  ++V  AI  GYR ID A VY NE+ VG  +++ 
Sbjct: 3   HLVLYTGAKMPILGLGTWKS-PPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEK 61

Query: 63  IATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------ 116
           +   +  RE+LFI SKLW       +L K   + +L+   LDY DLYL+H   G      
Sbjct: 62  LQGQVVKREDLFIVSKLW-CTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKD 120

Query: 117 ---------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVN 161
                          D+   W A+E+  + G +KAIGVSNF    +        +     
Sbjct: 121 PFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA 180

Query: 162 QV--ELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPY--------ENVMLQRIADAH 211
               E+HPY  Q   +E  K   +   A++PLG               E+  ++ IA  +
Sbjct: 181 VNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKY 240

Query: 212 QKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            KT AQV++R+ +QR + VIPKS   ERI ENF ++DF L+  +M  + + +
Sbjct: 241 NKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN 292


>3cv7A [x.x.x] ALCOHOL DEHYDROGENASE
          Length = 322

 Score =  174 bits (441), Expect = 3e-46
 Identities = 91/294 (30%), Positives = 149/294 (50%), Gaps = 33/294 (11%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAV 59
               +L +   KMP++G G +K  +  + + ++  A+  GYR ID AA+YGNE  +G+A+
Sbjct: 2   AASCVLLHTGQKMPLIGLGTWKS-EPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEAL 60

Query: 60  RKAIATGLC-TREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-- 116
           ++ +  G    REELF+TSKLW     + +  +  +  +L    L+Y DLYL+H      
Sbjct: 61  QETVGPGKAVPREELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAFE 119

Query: 117 -------------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRIT 157
                               Y   W+ALE     G ++A+G+SNF +  + +      + 
Sbjct: 120 RGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVR 179

Query: 158 PMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGR--------HKPYENVMLQRIAD 209
           P V QVE HPY AQ   +   +   ++  A++PLG               E  ++Q +A+
Sbjct: 180 PAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAE 239

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALD 263
            + ++ AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL+
Sbjct: 240 KYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN 293


>3eb4A [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
          Length = 327

 Score =  170 bits (431), Expect = 5e-45
 Identities = 57/323 (17%), Positives = 106/323 (32%), Gaps = 58/323 (17%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKV----TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAV 55
             Y  L  + L++  +G G +         E  +  +  A  +G  L DTA VY    A 
Sbjct: 3   QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAE 62

Query: 56  GDAVRKAIATGLCTREELFITSKLWVQDMA------NYDLAKAGIEASLKKSGLDYFDLY 109
              +   I      R  L IT+K++    A      +      G++ASL++  L+Y D+ 
Sbjct: 63  V-VLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVV 121

Query: 110 LLHQAMG--DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPM----VNQV 163
             ++           RA+      G     G S + +  +       R   +      Q 
Sbjct: 122 FANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQA 181

Query: 164 ELHPYFAQPA---ALETMKHYNVQPEAWAPLGGGRHKPY--------------------- 199
           E H +  +       E      V    W+PL  G                          
Sbjct: 182 EYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKD 241

Query: 200 ------------ENVMLQRIADAHQKTIAQVVLRWNVQRGV--TVIPKSTRQERIEENFA 245
                       +   LQ IA+    T+ Q+ + W ++     +V+  ++  E++ EN  
Sbjct: 242 KILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG 301

Query: 246 IWDF--SLTDNEMAQINALDLGY 266
                  L+ + + +I+++    
Sbjct: 302 AIQVLPKLSSSIVHEIDSILGNK 324


>2bp1B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 320

 Score =  168 bits (425), Expect = 2e-44
 Identities = 60/326 (18%), Positives = 106/326 (32%), Gaps = 65/326 (19%)

Query: 13  PMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
                G  ++    D      +V + +  G+  +DTA +Y +  +    +   +  GL  
Sbjct: 2   VASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSET--ILGGLGLGLGC 59

Query: 70  REELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQ--AMGDYFSAWRALED 127
           R ++   +  W       D  ++ +E SLK+      DL+ LH             A + 
Sbjct: 60  RVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQR 119

Query: 128 AYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAA--LETMKHY 181
            ++ GK   +G+SN+ +  +A  C   +    I P V Q   +    Q        ++H+
Sbjct: 120 LHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHF 179

Query: 182 NVQPEAWAPLGGGR---------------------HKPYENVM----------------- 203
            ++  A+ PL GG                      +   E                    
Sbjct: 180 GLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEK 239

Query: 204 -LQRIADAHQKTIAQVVLRWNVQR-------GVTVIPKSTRQERIEENFAIWD-FSLTDN 254
            LQ    A   ++    LRW           G  VI   +  E++E+N A  +   L   
Sbjct: 240 ALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPA 299

Query: 255 EMAQINALDLGYVGEAVKHFNPEFVR 280
            +   N          V H  P + R
Sbjct: 300 VVDAFNQAW-----HLVAHECPNYFR 320


>2c91A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 325

 Score =  167 bits (424), Expect = 3e-44
 Identities = 54/330 (16%), Positives = 101/330 (30%), Gaps = 68/330 (20%)

Query: 12  MPMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLC 68
            P    G  ++    D      SV + +  G+  +DTA +Y +  +    +   +  GL 
Sbjct: 3   RPATVLGTMEMGRRMDASASAASVRAFLERGHSELDTAFMYCDGQSEN--ILGGLGLGLG 60

Query: 69  T-REELFITSKLWVQDM--ANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSA--WR 123
           +    + I +K    +      D  ++ +E SLK+      DL+ LH             
Sbjct: 61  SGDCTVKIATKANPWEGKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLC 120

Query: 124 ALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYF------AQPAALET 177
           A    ++ GK   +G+SN+ +  +A  C   +    +        +       +   L  
Sbjct: 121 ACHQLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPC 180

Query: 178 MKHYNVQPEAWAPLGGGR---------------------------------------HKP 198
           ++H+ ++  A+ PL GG                                           
Sbjct: 181 LRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFEAIA 240

Query: 199 YENVMLQRIADAHQKTIAQVVLRWNVQR-------GVTVIPKSTRQERIEENFAIWD-FS 250
                LQ     +   +    LRW           G  VI   +  E++E+N A  +   
Sbjct: 241 LVEKALQTTYGTNAPRMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGP 300

Query: 251 LTDNEMAQINALDLGYVGEAVKHFNPEFVR 280
           L    +   +            H  P + R
Sbjct: 301 LEPAVVEAFDQAWNMV-----AHECPNYFR 325


>3eb3A [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
          Length = 326

 Score =  167 bits (423), Expect = 4e-44
 Identities = 57/323 (17%), Positives = 108/323 (33%), Gaps = 58/323 (17%)

Query: 1   MEYSILSNN-LKMPMVGFGVFKV----TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAV 55
             Y  L  + L++  +G G +         E  +  +  A  +G  L DTA VY      
Sbjct: 3   QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGK-A 61

Query: 56  GDAVRKAIATGLCTREELFITSKLWVQDMANY------DLAKAGIEASLKKSGLDYFDLY 109
              +   I      R  L IT+K++    A             G++ASL++  L+Y D+ 
Sbjct: 62  EVVLGNIIKKKGWRRSSLVITTKIFAGGKAETERGLSRKHIIEGLKASLERLQLEYVDVV 121

Query: 110 LLHQ--AMGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQV 163
             ++           RA+      G     G S + +  +       R    I P+  Q 
Sbjct: 122 FANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQA 181

Query: 164 ELHPYFAQPAALETM---KHYNVQPEAWAPLGGGR------------------------- 195
           E H +  +   ++         V    W+PL  G                          
Sbjct: 182 EYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKD 241

Query: 196 --------HKPYENVMLQRIADAHQKTIAQVVLRWNVQR--GVTVIPKSTRQERIEENFA 245
                    +  +   LQ IA+    T+ Q+ + W ++     +V+  ++  E++ EN  
Sbjct: 242 KILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG 301

Query: 246 I--WDFSLTDNEMAQINALDLGY 266
                  L+ + + +I+++    
Sbjct: 302 AIQVLPKLSSSIVHEIDSILGNK 324


>2c91B [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 324

 Score =  161 bits (407), Expect = 3e-42
 Identities = 62/330 (18%), Positives = 108/330 (32%), Gaps = 68/330 (20%)

Query: 12  MPMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLC 68
            P    G  ++    D      SV + +  G+  +DTA +Y +  +    +   +  GL 
Sbjct: 2   RPATVLGTMEMGRRMDASASAASVRAFLERGHSELDTAFMYCDGQSEN--ILGGLGLGLG 59

Query: 69  T-REELFITSKLWVQDMANY--DLAKAGIEASLKKSGLDYFDLYLLHQ--AMGDYFSAWR 123
           +    + I +K    +  +   D  ++ +E SLK+      DL+ LH             
Sbjct: 60  SGDCTVKIATKANPWEGKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLC 119

Query: 124 ALEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAA--LET 177
           A    ++ GK   +G+SN+ +  +A  C   +    I P V Q   +    Q  A  L  
Sbjct: 120 ACHQLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPC 179

Query: 178 MKHYNVQPEAWAPLGGGRH--KPYENVM-------------------------------- 203
           ++H+ ++  A+ PL GG    K                                      
Sbjct: 180 LRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFEAIA 239

Query: 204 -----LQRIADAHQKTIAQVVLRWNVQR-------GVTVIPKSTRQERIEENFAIWD-FS 250
                LQ     +   +    LRW           G  VI   +  E++E+N A  +   
Sbjct: 240 LVEKALQTTYGTNAPRMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGP 299

Query: 251 LTDNEMAQINALDLGYVGEAVKHFNPEFVR 280
           L    +   +          V H  P + R
Sbjct: 300 LEPAVVEAFDQAW-----NMVAHECPNYFR 324


>2clpA [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
          Length = 323

 Score =  161 bits (407), Expect = 3e-42
 Identities = 47/272 (17%), Positives = 85/272 (31%), Gaps = 21/272 (7%)

Query: 13  PMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           P    G  ++    D         + +  G+  IDTA VY    +        +  G  +
Sbjct: 2   PATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLG-GS 60

Query: 70  REELFITSKLWVQ--DMANYDLAKAGIEASLKKSGLDYFDLYLLH--QAMGDYFSAWRAL 125
              + I +K      +    D  +  +E SLK+      DL+ LH            RA 
Sbjct: 61  DCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRAC 120

Query: 126 EDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQP--AALETMK 179
              ++ GK   +G+SN+ A  +A  C   +    I P V Q   +    Q        ++
Sbjct: 121 HQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLR 180

Query: 180 HYNVQPEAWAPLGGGRH----KPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKST 235
           H+ ++  A+ PL GG      K  +    Q +      T A++      +          
Sbjct: 181 HFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALV 240

Query: 236 RQERIEENFAIWDFSLTDNEMAQINALDLGYV 267
            +            + +              +
Sbjct: 241 EKALQAAYG---ASAPSMTSATLRWMYHHSQL 269


>3cd5C [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 418

 Score =  160 bits (406), Expect = 4e-42
 Identities = 30/295 (10%), Positives = 65/295 (22%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 124 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 183

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 184 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 241

Query: 117 DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALE 176
                  A+      GK            V      T      VN  +     A   ++ 
Sbjct: 242 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 301

Query: 177 TM---KHYNVQPEAWAPLGGGRHKPYE------------------------NVMLQRIAD 209
                    V     A                                   ++ +  +  
Sbjct: 302 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 361

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 362 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 416


>2bp1A [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
          Length = 323

 Score =  159 bits (403), Expect = 8e-42
 Identities = 60/329 (18%), Positives = 106/329 (32%), Gaps = 68/329 (20%)

Query: 13  PMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
                G  ++    D      +V + +  G+  +DTA +Y +  +    +   +  GL  
Sbjct: 2   VASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSET--ILGGLGLGLGG 59

Query: 70  -REELFITSKLWVQDMANYD--LAKAGIEASLKKSGLDYFDLYLLHQAMG--DYFSAWRA 124
               + I +K    D  +      ++ +E SLK+      DL+ LH             A
Sbjct: 60  GDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHA 119

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQPAA--LETM 178
            +  ++ GK   +G+SN+ +  +A  C   +    I P V Q   +    Q        +
Sbjct: 120 CQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCL 179

Query: 179 KHYNVQPEAWAPLGGG---------------------RHKPYENVM-------------- 203
           +H+ ++  A+ PL GG                      +   E                 
Sbjct: 180 RHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIAL 239

Query: 204 ----LQRIADAHQKTIAQVVLRWNVQR-------GVTVIPKSTRQERIEENFAIWD-FSL 251
               LQ    A   ++    LRW           G  VI   +  E++E+N A  +   L
Sbjct: 240 VEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPL 299

Query: 252 TDNEMAQINALDLGYVGEAVKHFNPEFVR 280
               +   N          V H  P + R
Sbjct: 300 EPAVVDAFNQAW-----HLVAHECPNYFR 323


>1dq8D [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 407

 Score =  158 bits (399), Expect = 3e-41
 Identities = 29/295 (9%), Positives = 65/295 (22%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 113 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 172

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 173 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 230

Query: 117 DYFSAWRALEDAYEAGK-LKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                  A+      GK +    V             T  +  +     L       +  
Sbjct: 231 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 290

Query: 176 ETMKHYNVQPEAWAPLGGGRHKPYE--------------------------NVMLQRIAD 209
               H      A     G                                 ++ +  +  
Sbjct: 291 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 350

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 351 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 405


>1dqaD [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 396

 Score =  155 bits (391), Expect = 2e-40
 Identities = 29/295 (9%), Positives = 63/295 (21%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 94  CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 153

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQA-MG 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 154 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 211

Query: 117 DYFSAWRALEDAYEAGKLKAI-GVSNFYAHVLANFCETVRITPMVNQVEL--HPYFAQPA 173
                  A+      GK      V             T  +  +     L          
Sbjct: 212 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 271

Query: 174 ALETMKHYNVQPEAWAPLGGG---------------RHKPYENVM---------LQRIAD 209
                    V     A                         E++          +  +  
Sbjct: 272 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 331

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 332 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 386


>1dq8B [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 405

 Score =  154 bits (389), Expect = 4e-40
 Identities = 30/295 (10%), Positives = 65/295 (22%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 110 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 169

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 170 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 227

Query: 117 DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALE 176
                  A+      GK            V      T      VN  +     A   ++ 
Sbjct: 228 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 287

Query: 177 TM---KHYNVQPEAWAPLGGGRHKPY------------------------ENVMLQRIAD 209
                    V     A                                   ++ +  +  
Sbjct: 288 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 347

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 348 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 402


>1dq9C [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 407

 Score =  152 bits (384), Expect = 1e-39
 Identities = 29/295 (9%), Positives = 64/295 (21%), Gaps = 35/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 113 AIG--LGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 170

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 171 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 228

Query: 118 YFS-AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR-ITPMVNQVELHPYFAQPAAL 175
                  A+      GK            V      T   +  +     L       +  
Sbjct: 229 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 288

Query: 176 ETMKHYNVQPEAWAPLGGGRHKPYE--------------------------NVMLQRIAD 209
               H      A     G                                 ++ +  +  
Sbjct: 289 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 348

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 349 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 403


>2ao0A [x.x.x] ALDEHYDE DEHYDROGENASE
          Length = 324

 Score =  152 bits (383), Expect = 2e-39
 Identities = 90/288 (31%), Positives = 147/288 (51%), Gaps = 32/288 (11%)

Query: 5   ILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIA 64
           +L    KMP++G G +  ++  + + ++  A+  GYR ID AA+YGNE  +G+A+++ + 
Sbjct: 6   LLHTGQKMPLIGLGTW-KSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVG 64

Query: 65  TGL-CTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG------- 116
            G    REELF+TSKLW     + +  +  +  +L    L+Y DLYL+H           
Sbjct: 65  PGKAVPREELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNP 123

Query: 117 --------------DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQ 162
                          Y   W+ALE     G ++A+G+SNF +  + +      + P V Q
Sbjct: 124 FPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQ 183

Query: 163 VELHPYFAQPAALETMKHYNVQPEAWAPLGGGRH--------KPYENVMLQRIADAHQKT 214
           VE HPY AQ   +   +   ++  A++PLG               E  ++Q +A+ + ++
Sbjct: 184 VECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS 243

Query: 215 IAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAL 262
            AQ++LRW VQR V  IPKS    RI +N  ++DF+ +  EM Q++AL
Sbjct: 244 PAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDAL 291


>1dq9B [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 405

 Score =  148 bits (375), Expect = 2e-38
 Identities = 31/297 (10%), Positives = 66/297 (22%), Gaps = 36/297 (12%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 111 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 170

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 171 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 228

Query: 117 DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP---A 173
                  A+      GK            V      T      VN  +     A      
Sbjct: 229 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 288

Query: 174 ALETMKHYNVQPEAWAPLGG---------------GRHKPYE---------NVMLQRIAD 209
                    V     A                         E         ++ +  +  
Sbjct: 289 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 348

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
                  Q  L+    +G           ++         +    E++ + AL  G+
Sbjct: 349 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAG---ELSLMAALAAGH 402


>1dqaB [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 405

 Score =  148 bits (373), Expect = 3e-38
 Identities = 29/299 (9%), Positives = 61/299 (20%), Gaps = 41/299 (13%)

Query: 1   MEYSILSNNLKMPMVGFGVFKV-------TDKEECQQSVLSAIRSGYRLIDTAAVYGNED 53
                L       ++  G+ +               ++ L        + +         
Sbjct: 109 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 168

Query: 54  AVGDAVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQ 113
            +                 L+I  +    D    ++   G E +L K    + ++ +L  
Sbjct: 169 RLQ------KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAV 222

Query: 114 A-MGDYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP 172
           +          A+      GK            V      T      VN  +     A  
Sbjct: 223 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMA 282

Query: 173 AA---LETMKHYNVQPEAWAPLGGGRH-------------------KPYENVML-----Q 205
            +           V     A                            Y +  +      
Sbjct: 283 GSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIG 342

Query: 206 RIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
            +         Q  L+    +G           ++         +   + MA + A  L
Sbjct: 343 TVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 401


>2clpI [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
          Length = 322

 Score =  144 bits (365), Expect = 2e-37
 Identities = 49/263 (18%), Positives = 90/263 (34%), Gaps = 21/263 (7%)

Query: 13  PMVGFGVFKV---TDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCT 69
           P    G  ++    D         + +  G+  IDTA VY    +        +  G  +
Sbjct: 1   PATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLG-GS 59

Query: 70  REELFITSKL---WVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS--AWRA 124
              + I +K    +   +    L    +E SLK+      DL+ LH            RA
Sbjct: 60  DCRVKIDTKAIPLFGNSLKPDSLRFQ-LETSLKRLQCPRVDLFYLHMPDHSTPVEETLRA 118

Query: 125 LEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPYFAQP--AALETM 178
               ++ GK   +G+SN+ A  +A  C   +    I P V Q   +    Q        +
Sbjct: 119 CHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCL 178

Query: 179 KHYNVQPEAWAPLGGGR----HKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKS 234
           +H+ ++  A+ PL GG     +K  +    Q +      T A++      +         
Sbjct: 179 RHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIAL 238

Query: 235 TRQERIEENFAIWDFSLTDNEMA 257
              + ++  +     S+T   + 
Sbjct: 239 VE-KALQAAYGASAPSMTSATLR 260


>3cdbC [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 415

 Score =  144 bits (364), Expect = 3e-37
 Identities = 29/292 (9%), Positives = 65/292 (22%), Gaps = 33/292 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 124 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 183

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++K           L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 184 RLQKL--HTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 241

Query: 118 -YFSAWRALEDAYEAGK-LKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                  A+      GK +    V             T  +  +     L       +  
Sbjct: 242 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 301

Query: 176 ETMKHYN--VQPEAWAPLGGGRHKPYE------------------------NVMLQRIAD 209
               H    V     A                                   ++ +  +  
Sbjct: 302 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 361

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINA 261
                  Q  L+    +G           ++         +   + MA + A
Sbjct: 362 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA 413


>3cdaA [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 422

 Score =  143 bits (360), Expect = 8e-37
 Identities = 29/295 (9%), Positives = 65/295 (22%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 130 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 189

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 190 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 247

Query: 118 -YFSAWRALEDAYEAGK-LKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                  A+      GK +    V             T  +  +     L       +  
Sbjct: 248 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 307

Query: 176 ETMKHYN--VQPEAWAPLGGGRHKPY------------------------ENVMLQRIAD 209
               H    V     A                                   ++ +  +  
Sbjct: 308 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 367

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 368 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 422


>3bglD [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 410

 Score =  142 bits (359), Expect = 1e-36
 Identities = 28/292 (9%), Positives = 61/292 (20%), Gaps = 33/292 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 121 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 180

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 181 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 238

Query: 118 YFS-AWRALEDAYEAGKLKA-IGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                  A+      GK      V             T  +  +     L       +  
Sbjct: 239 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 298

Query: 176 ETMKHYNVQPEAWAPLGGGRHKPYENVM--------------------------LQRIAD 209
               H      A     G                                    +  +  
Sbjct: 299 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 358

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINA 261
                  Q  L+    +G           ++         +   + MA + A
Sbjct: 359 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA 410


>3cctC [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 417

 Score =  139 bits (352), Expect = 7e-36
 Identities = 28/292 (9%), Positives = 61/292 (20%), Gaps = 33/292 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 127 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 186

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQA-MG 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 187 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 244

Query: 117 DYFSAWRALEDAYEAGKLKA-IGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP--A 173
                  A+      GK      V             T  +  +     L          
Sbjct: 245 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 304

Query: 174 ALETMKHYNVQPEAWAPLGGGRH-------------------KPYENVMLQ-----RIAD 209
                    V     A                            Y +  +       +  
Sbjct: 305 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 364

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINA 261
                  Q  L+    +G           ++         +   + MA + A
Sbjct: 365 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA 416


>1dq8A [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 417

 Score =  134 bits (339), Expect = 2e-34
 Identities = 28/295 (9%), Positives = 64/295 (21%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 124 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 183

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQA-MG 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 184 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 241

Query: 117 DYFSAWRALEDAYEAGK-LKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPA-- 173
                  A+      GK +    V             T  +  +     L       +  
Sbjct: 242 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 301

Query: 174 ALETMKHYNVQPEAWAPLGGGRHKPYE------------------------NVMLQRIAD 209
                    V     A                                   ++ +  +  
Sbjct: 302 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 361

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 362 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 416


>1dq8C [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 402

 Score =  134 bits (338), Expect = 3e-34
 Identities = 31/297 (10%), Positives = 67/297 (22%), Gaps = 36/297 (12%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 107 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 166

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 167 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 224

Query: 118 -YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALE 176
                  A+      GK            V      T      VN  +     A   ++ 
Sbjct: 225 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 284

Query: 177 TM---KHYNVQPEAWAPLGGGR-------------------HKPYENVM-----LQRIAD 209
                    V     A                            Y +       +  +  
Sbjct: 285 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 344

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGY 266
                  Q  L+    +G           ++         +    E++ + AL  G+
Sbjct: 345 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMA---GELSLMAALAAGH 398


>3cd5D [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 416

 Score =  129 bits (325), Expect = 9e-33
 Identities = 31/295 (10%), Positives = 66/295 (22%), Gaps = 33/295 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 122 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 181

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++K   +       L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 182 RLQKLHTSIAG--RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 239

Query: 118 -YFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALE 176
                  A+      GK            V      T      VN  +     A   ++ 
Sbjct: 240 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 299

Query: 177 TM---KHYNVQPEAWAPLGGGRHKPYENVM------------------------LQRIAD 209
                    V     A           +                          +  +  
Sbjct: 300 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 359

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDL 264
                  Q  L+    +G           ++         +   + MA + A  L
Sbjct: 360 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL 414


>2aicA [x.x.x] GUANINE NUCLEOTIDE EXCHANGE FACTOR BOPE
          Length = 184

 Score =  121 bits (304), Expect = 3e-30
 Identities = 18/175 (10%), Positives = 31/175 (17%), Gaps = 26/175 (14%)

Query: 70  REELFITSKLWVQDMAN-----YDLAKAGIEASLKKSGLDYFDLYLLHQAMG-------- 116
           R  +    K              +  +   EA+L     +  D + +  A          
Sbjct: 9   RHFVDEAVKQVAHARTPEIRQDAEFGRQVYEATLCAIFSEAKDRFCMDPATRAGNVRPAF 68

Query: 117 ----DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVR----ITPMVNQVELHPY 168
                  +    L  A + G     G      +              +       EL PY
Sbjct: 69  IEALGDAARATGLPGADKQGVFTPSGAGTNPLYTEIRLRADTLMGAELAARPEYRELQPY 128

Query: 169 FAQPAA---LETMKHYNVQPEAWAPLGGGRH--KPYENVMLQRIADAHQKTIAQV 218
             Q A       +                                +      A  
Sbjct: 129 ARQQAIDLVANALPAERSNTLVEFRQTVQTLEATYRRAAQDASRDEKGATNAADG 183


>3cdaD [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 395

 Score =  113 bits (282), Expect = 9e-28
 Identities = 27/292 (9%), Positives = 66/292 (22%), Gaps = 33/292 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 106 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 165

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG- 116
            ++            L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 166 RLQ--KLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 223

Query: 117 DYFSAWRALEDAYEAGKLKAIGVSNFY--AHVLANFCETVRITPMVNQVELHPYFAQPAA 174
                  A+      GK               +        I   +N+  +    A    
Sbjct: 224 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 283

Query: 175 LETMKHYNVQPEAWAPLGGGRHKPYE-------------------------NVMLQRIAD 209
                  N+    +   G    +                            ++ +  +  
Sbjct: 284 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 343

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINA 261
                  Q  L+    +G           ++         +   + MA + A
Sbjct: 344 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA 395


>1dq9D [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 413

 Score =  111 bits (278), Expect = 3e-27
 Identities = 30/301 (9%), Positives = 74/301 (24%), Gaps = 36/301 (11%)

Query: 1   MEYSILSNNLKMPMVGFGVF---KVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+     V     C  + + A               +  +   
Sbjct: 118 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 177

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGD 117
            ++K   +       L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 178 RLQKLHTSI--AGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 235

Query: 118 YFS-AWRALEDAYEAGK-LKAIGVSNFYAH-----------VLANFCETVRITPMVNQVE 164
                  A+      GK +    V                 +  N  + +  + M   + 
Sbjct: 236 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG 295

Query: 165 LHPY-------------FAQPAALETMKHYNVQPEAWAPLGGGRHKPYE--NVMLQRIAD 209
            +                   A      +     EA  P     +      ++ +  +  
Sbjct: 296 GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGG 355

Query: 210 AHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGE 269
                  Q  L+    +G           ++          +       + AL  G++ +
Sbjct: 356 GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVC--GTVMAGELSL-MAALAAGHLVK 412

Query: 270 A 270
           +
Sbjct: 413 S 413


>1dy1A [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
          Length = 183

 Score =  106 bits (266), Expect = 7e-26
 Identities = 16/182 (8%), Positives = 36/182 (19%), Gaps = 34/182 (18%)

Query: 109 YLLHQAMG-DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHP 167
            L H            AL      G ++ I  ++F     A                L  
Sbjct: 2   PLAHTHQDFQPVLHLVALNTPLS-GGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQD 60

Query: 168 YF--AQPAALETMKHYNVQPEAWAPLGG-----------------GRHKPYENVM----- 203
            +   + A   ++   N++ E  +P                                   
Sbjct: 61  LYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQ 120

Query: 204 ---LQRIADAHQKTIAQVVLRWNVQRGV-----TVIPKSTRQERIEENFAIWDFSLTDNE 255
                    + ++ +      W  +        + +      E+   +       L    
Sbjct: 121 KSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIEN 180

Query: 256 MA 257
             
Sbjct: 181 SF 182


>2d4cA [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
          Length = 224

 Score =  103 bits (256), Expect = 9e-25
 Identities = 19/186 (10%), Positives = 49/186 (26%), Gaps = 6/186 (3%)

Query: 4   SILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGN---EDAVGDAVR 60
            I++  ++              +       + ++ G  L D                 + 
Sbjct: 39  EIMTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELS 98

Query: 61  KAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS 120
           +   +     ++ FI     + D    ++  A ++  LKK      D     +  G    
Sbjct: 99  EVKDSLDIEVKQNFIDPLQNLHDKDLREIQSA-LQHHLKKLEGRRLDFDYKKKRQGKIPD 157

Query: 121 A--WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETM 178
               +ALE   E+ ++    + N     +    +   +     +               +
Sbjct: 158 EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL 217

Query: 179 KHYNVQ 184
           +    Q
Sbjct: 218 EERIRQ 223


>3cd0D [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
          Length = 396

 Score = 98.7 bits (245), Expect = 2e-23
 Identities = 29/277 (10%), Positives = 63/277 (22%), Gaps = 35/277 (12%)

Query: 1   MEYSILSNNLKMPMVGFGVFK---VTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGD 57
                L       ++  G+ +   V     C  + + A               +  +   
Sbjct: 105 CRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFA 164

Query: 58  AVRKAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAM-G 116
            ++K   +       L+I  +    D    ++   G E +L K    + ++ +L  +   
Sbjct: 165 RLQKLHTS--IAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNY 222

Query: 117 DYFSAWRALEDAYEAGK-LKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAAL 175
                  A+      GK +    V             T      VN  +     A   ++
Sbjct: 223 CTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVL-KTTTEAMIEVNINKNLVGSAMAGSI 281

Query: 176 ET--MKHYN-VQPEAWAPLGG---------------GRHKPYE---------NVMLQRIA 208
                   N V     A                         E         ++ +  + 
Sbjct: 282 GGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVG 341

Query: 209 DAHQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFA 245
                   Q  L+    +G           ++     
Sbjct: 342 GGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVC 378


>1dy0A [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
          Length = 180

 Score = 97.6 bits (242), Expect = 4e-23
 Identities = 14/173 (8%), Positives = 36/173 (20%), Gaps = 33/173 (19%)

Query: 117 DYFSAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP--AA 174
                  AL      G ++ I  ++F     A                L   ++    A 
Sbjct: 8   QPVLHLVALNTPLS-GGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRAD 66

Query: 175 LETMKHYNVQPEAWAPLGGGR-------------------------HKPYENVMLQRIAD 209
             ++   N++ E  +P                                  +  +      
Sbjct: 67  RGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDP 126

Query: 210 AHQKTIAQVVLRWNVQRG-----VTVIPKSTRQERIEENFAIWDFSLTDNEMA 257
           + ++ +      W  +        + +      E+   +       L      
Sbjct: 127 SGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSF 179


>2d4cB [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
          Length = 231

 Score = 96.9 bits (240), Expect = 7e-23
 Identities = 27/184 (14%), Positives = 57/184 (30%), Gaps = 17/184 (9%)

Query: 12  MPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGN-EDAVGDAVRKAIATGLCTR 70
            P     +  +    + +  +  A+    R +     +G     VG+A+R+        +
Sbjct: 53  NPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEV----K 108

Query: 71  EELFITSKLWVQD------MANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSA--W 122
           + L I  K    D        +    ++ ++  LKK      D     +  G        
Sbjct: 109 DSLDIEVKQNFIDPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDEELR 168

Query: 123 RALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP--AALETMKH 180
           +ALE   E+ ++    + N     +    +      +  Q+E H    Q        ++ 
Sbjct: 169 QALEKFDESKEIAESSMFNLLEMDIEQVSQLSA--LVQAQLEYHKQAVQILQQVTVRLEE 226

Query: 181 YNVQ 184
              Q
Sbjct: 227 RIRQ 230


>3ee8B [x.x.x] NON-STRUCTURAL PROTEIN 1
          Length = 121

 Score = 93.5 bits (232), Expect = 7e-22
 Identities = 11/107 (10%), Positives = 23/107 (21%), Gaps = 8/107 (7%)

Query: 122 WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHY 181
                   +      + +    A +         I    N   +         L      
Sbjct: 16  RDWFMLMPKQKVEGPLCIRIDQAIMDK------NIMLKANFSVIFDRLETLILLRAFTEE 69

Query: 182 NVQPEAWAPLGGGRHKPYENV--MLQRIADAHQKTIAQVVLRWNVQR 226
                  +PL        E+V   +  +    +     V +   +QR
Sbjct: 70  GAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQR 116


>3ee8A [x.x.x] NON-STRUCTURAL PROTEIN 1
          Length = 122

 Score = 86.9 bits (215), Expect = 7e-20
 Identities = 11/107 (10%), Positives = 23/107 (21%), Gaps = 8/107 (7%)

Query: 122 WRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHY 181
                   +      + +    A +         I    N   +         L      
Sbjct: 17  RDWFMLMPKQKVEGPLCIRIDQAIMDK------NIMLKANFSVIFDRLETLILLRAFTEE 70

Query: 182 NVQPEAWAPLGGGRHKPYENV--MLQRIADAHQKTIAQVVLRWNVQR 226
                  +PL        E+V   +  +    +     V +   +QR
Sbjct: 71  GAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQR 117


>2d4cC [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
          Length = 226

 Score = 81.9 bits (201), Expect = 2e-18
 Identities = 27/189 (14%), Positives = 53/189 (28%), Gaps = 16/189 (8%)

Query: 6   LSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIAT 65
            +     P            +       + ++ G  L D          VG+A+R+    
Sbjct: 43  KTIEYLQPNPASRAKLPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEV 102

Query: 66  GLCTREELFITSKLWVQDMANY------DLAKAGIEASLKKSGLDYFDLYLLHQAMGDYF 119
               ++ L I  K    D             ++ ++  LKK      D     +  G   
Sbjct: 103 ----KDSLDIEVKQNFIDPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIP 158

Query: 120 --SAWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAA--L 175
                +ALE   E+ ++    + N     +    +      +  Q+E H    Q      
Sbjct: 159 DEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSA--LVQAQLEYHKQAVQILQQVT 216

Query: 176 ETMKHYNVQ 184
             ++    Q
Sbjct: 217 VRLEERIRQ 225


>1dqaC [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
          Length = 404

 Score = 58.2 bits (140), Expect = 3e-11
 Identities = 28/260 (10%), Positives = 58/260 (22%), Gaps = 32/260 (12%)

Query: 14  MVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTREEL 73
           M    V ++     C  + + A               +  +    ++K   +       L
Sbjct: 121 MTRGPVVRLPR--ACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSI--AGRNL 176

Query: 74  FITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMG-DYFSAWRALEDAYEAG 132
           +I  +    D    ++   G E +L K    + ++ +L  +          A+      G
Sbjct: 177 YIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRG 236

Query: 133 KLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQP-------------------- 172
           K            V      T      VN  +     A                      
Sbjct: 237 KSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA 296

Query: 173 -----AALETMKHYNVQPEAWAPLGGGRHKPYENVMLQ--RIADAHQKTIAQVVLRWNVQ 225
                A      +     EA  P     +       ++   +         Q  L+    
Sbjct: 297 CGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGV 356

Query: 226 RGVTVIPKSTRQERIEENFA 245
           +G           ++     
Sbjct: 357 QGACKDNPGENARQLARIVC 376


>3bmaF [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
          Length = 387

 Score = 55.8 bits (134), Expect = 2e-10
 Identities = 21/225 (9%), Positives = 52/225 (23%), Gaps = 63/225 (28%)

Query: 105 YFDLYLLHQAMGD--YFSAWRAL--EDAYEAGKLKAI---GVSNFYAHVLANFCE----- 152
           + +L    ++       S         A     ++ +   G S +     A+        
Sbjct: 2   HHNLGAEKRSAVATTIDSFKERSQKVRALSDPNVRFVPFFGSSEWLRFDGAHPAVLAEKY 61

Query: 153 -----TVRITPMVNQVELHPYFAQP--AALETMKHYNVQPEAWAPLGGGRHKPYEN---- 201
                   +           +  Q     LE  +   V    W    G     ++     
Sbjct: 62  NRSYRPYLLGQGGAASLNQYFGMQQMLPQLENKQVVYVISPQWFSKNGYDPAAFQQYFNG 121

Query: 202 ---------------------------------VMLQRIADAHQKTIAQVVLRWNVQRGV 228
                                             ++Q++A   + + A   +   + R  
Sbjct: 122 DQLTSFLKHQSGDQASQYAATRLLQQFPNVAMKDLVQKLASKEELSTADNEMIELLARFN 181

Query: 229 TVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKH 273
                  RQ      F+ +  +   +    +  L   +  +A++ 
Sbjct: 182 ------ERQASFFGQFSGY-VNYDKHVAKYLKILPDQFSYQAIED 219


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0513    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 23,403,694
Number of extensions: 1468630
Number of successful extensions: 15440
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6085
Number of HSP's successfully gapped: 588
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)