RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF70471.1 sent8 rplY GIB00763CH01 "ribosomal L25p family"
         (94 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1dfuP [b.53.1] RIBOSOMAL PROTEIN L25                                  124   1e-31
3d5bZ [x.x.x] 50S RIBOSOMAL PROTEIN L25                                86   4e-20

>1dfuP [b.53.1] RIBOSOMAL PROTEIN L25
          Length = 94

 Score =  124 bits (313), Expect = 1e-31
 Identities = 86/94 (91%), Positives = 90/94 (95%)

Query: 1  MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEV 60
          MFTINAEVRKEQGKGASRRLRAANKFPAIIYGG EAP+AIELDHD+VMNMQAKAEFYSEV
Sbjct: 1  MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEV 60

Query: 61 LTLVVDGKEVKVKAQAVQRHAYKPKLTHIDFVRA 94
          LT+VVDGKE+KVKAQ VQRH YKPKL HIDFVRA
Sbjct: 61 LTIVVDGKEIKVKAQDVQRHPYKPKLQHIDFVRA 94


>3d5bZ [x.x.x] 50S RIBOSOMAL PROTEIN L25
          Length = 188

 Score = 86.1 bits (213), Expect = 4e-20
 Identities = 17/92 (18%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 2  FTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVL 61
          + + A  R+ +   A RR   A K P ++Y        + +D  +   +  +A  +  ++
Sbjct: 1  YRLKAYYREGEKPSALRR---AGKLPGVMYNR-HLNRKVYVDLVEFDKVFRQASIHHVIV 56

Query: 62 TLVVDGKEVKVKAQAVQRHAYKPKLTHIDFVR 93
            + DG+ +    + V     + +  H+DF  
Sbjct: 57 LELPDGQSLPTLVRQVNLDKRRRRPEHVDFFV 88


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0611    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 31,660,084
Number of extensions: 2031485
Number of successful extensions: 24191
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 11511
Number of HSP's successfully gapped: 1109
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.1 bits)