RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACF68340.1 sent8 ACF68340.1 GIB00763CH01 "fimbrial subunit"
         (172 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00419 Fimbrial "Fimbrial protein"                                    87   2e-20

>PF00419 Fimbrial "Fimbrial protein"
          Length = 152

 Score = 87.2 bits (215), Expect = 2e-20
 Identities = 65/147 (44%), Positives = 86/147 (58%), Gaps = 2/147 (1%)

Query: 28  SGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTA--SGVTV 85
           +GT+ D TC+++ GS++  V +G VS      AGD S  +PF I L NC +T   S V V
Sbjct: 6   TGTVVDATCTVNTGSKDQTVDLGTVSASDLSAAGDTSGPKPFTIKLTNCPATTAKSKVKV 65

Query: 86  SFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQF 145
           +FSG AD+ N +LLALTA    A+G+GI L D + T I L   +          SA L F
Sbjct: 66  TFSGTADTTNNNLLALTATSGAATGVGIQLLDADGTPIKLNGATVSTVTLLANGSATLPF 125

Query: 146 YARYLADGGAVTPGDANASATFILAYE 172
            ARY+A G AVT G  NA+ATF + Y+
Sbjct: 126 TARYVATGAAVTAGKVNATATFTVTYQ 152


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.325    0.139    0.416 

Gapped
Lambda     K      H
   0.267   0.0526    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,735,601
Number of extensions: 813215
Number of successful extensions: 117957
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1646
Number of HSP's successfully gapped: 221
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)