RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF65897.1 sent8 ACF65897.1 GIB00763CH01 "conserved domain
protein"
         (73 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2ra2A1 [b.38.1.6] PUTATIVE LIPOPROTEIN A:4 -- 56                       72   5e-16

>2ra2A1 [b.38.1.6] PUTATIVE LIPOPROTEIN A:4 -- 56
          Length = 53

 Score = 72.1 bits (177), Expect = 5e-16
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 23 NYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKAD 73
          NYV  T +G++IVT GKPQ D +TG  SY D  GN+++IN  DV + +  +
Sbjct: 2  NYVXHTNDGRSIVTDGKPQTDNDTGXISYKDANGNKQQINRTDVKEXVALE 52


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.331    0.142    0.469 

Gapped
Lambda     K      H
   0.267   0.0482    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 13,824,387
Number of extensions: 979836
Number of successful extensions: 3868
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 3717
Number of HSP's successfully gapped: 116
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)