RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF67239.1 sent8 ACF67239.1 GIB00763CH01 "transcriptional
regulator HilD"
         (309 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1v4aA1 [a.24.16.4] GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ...    74   2e-16
1d5yA2 [a.4.1.8] ROB TRANSCRIPTION FACTOR A:57 -- 121                  62   1e-12
1bl0A2 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN...    62   1e-12
1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:...    37   3e-05
1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN...    36   7e-05

>1v4aA1 [a.24.16.4] GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE
           A:287 -- 437
          Length = 151

 Score = 74.0 bits (181), Expect = 2e-16
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 1/108 (0%)

Query: 197 EIILSSAQITLKERVYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEE-GTSFSDIYL 255
           EI        L          S S    L+ +A+   +S +  ++           +  L
Sbjct: 39  EIEFIVQVFQLIRGGREPSLQSRSLLPTLSAIAELHLLSENDAEQLRVAYLFLRRLENLL 98

Query: 256 SARMNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTF 303
            +  ++  + L     N   +A    +            +       F
Sbjct: 99  QSINDEQTQTLPSDELNRARLAWAXDFADWPQLTGALTAHXTNVRRVF 146


>1d5yA2 [a.4.1.8] ROB TRANSCRIPTION FACTOR A:57 -- 121
          Length = 65

 Score = 61.7 bits (150), Expect = 1e-12
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 258 RMNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIK 305
           R++++A  LR+    +  +AL+  +DS   F + FKK F  TP+ + +
Sbjct: 2   RLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRR 49


>1bl0A2 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
           A:63 -- 124
          Length = 62

 Score = 61.7 bits (150), Expect = 1e-12
 Identities = 12/48 (25%), Positives = 23/48 (47%)

Query: 258 RMNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIK 305
           +M + A+ L+  N  +  +A + G++S     + FK YF   P  +  
Sbjct: 2   KMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRM 49


>1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
           -- 77
          Length = 74

 Score = 37.2 bits (86), Expect = 3e-05
 Identities = 4/63 (6%), Positives = 18/63 (28%), Gaps = 3/63 (4%)

Query: 207 LKERVYNIISSSPSRQWKLTDVADHIFMSTSTLKR---KLAEEGTSFSDIYLSARMNQAA 263
              R+   + +    +     + +   ++   +++        GT      +     +  
Sbjct: 10  TYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLKRELR 69

Query: 264 KLL 266
            +L
Sbjct: 70  HIL 72


>1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
           A:9 -- 62
          Length = 54

 Score = 35.9 bits (83), Expect = 7e-05
 Identities = 8/53 (15%), Positives = 21/53 (39%), Gaps = 4/53 (7%)

Query: 256 SARMNQAAKLLRIG---NHNVNAVALKCGYDSTSYFIQCFKKYFKTTPSTFIK 305
           +  ++     +        ++  V+ + GY S  +  + FKK    +   +I+
Sbjct: 2   AITIHSILDWIEDNLESPLSLEKVSERSGY-SKWHLQRMFKKETGHSLGQYIR 53



 Score = 32.4 bits (74), Expect = 7e-04
 Identities = 10/50 (20%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 209 ERVYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEE-GTSFSDIYLSA 257
             + + I  +      L  V++    S   L+R   +E G S    Y+ +
Sbjct: 6   HSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQ-YIRS 54


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.323    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0406    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,580,614
Number of extensions: 805287
Number of successful extensions: 3085
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 3021
Number of HSP's successfully gapped: 114
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)