RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF67339.1 sent8 gloA GIB00763CH01 "lactoylglutathione lyase"
         (135 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1f9zA [d.32.1.1] GLYOXALASE I                                         118   5e-30
1sqiA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVIC ACID DIOXYGENASE A:8 --...   112   3e-28
1twuA [d.32.1.8] HYPOTHETICAL PROTEIN YYCE                            103   2e-25
1r9cA [d.32.1.2] GLUTATHIONE TRANSFERASE                              102   5e-25
1kllA [d.32.1.2] MITOMYCIN-BINDING PROTEIN                            101   6e-25
1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144               101   1e-24
1sp9A [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE                   98   9e-24
1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147       96   3e-23
1u6lA [d.32.1.7] HYPOTHETICAL PROTEIN                                  96   3e-23
1bylA [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)                96   4e-23
1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145                  94   2e-22
2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113           94   2e-22
1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153       92   5e-22
1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356     91   1e-21
1bh5A [d.32.1.1] LACTOYLGLUTATHIONE LYASE                              90   2e-21
1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --...    90   3e-21
1jc4A [d.32.1.4] METHYLMALONYL-COA EPIMERASE                           89   4e-21
1ss4A [d.32.1.6] GLYOXALASE FAMILY PROTEIN                             88   9e-21
1xqaA [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN               88   1e-20
1tsjA [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN                        85   1e-19
1lqkA [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN                77   2e-17
1ecsA [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN                          71   9e-16
1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323     70   3e-15
1sp8A1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:36 -- 207      65   9e-14
1mpyA2 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:146 -- 307                44   2e-07
2i7rA1 [d.32.1.2] CONSERVED DOMAIN PROTEIN A:1 -- 115                  34   1e-04
1zswA2 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:145 -- 314              34   2e-04

>1f9zA [d.32.1.1] GLYOXALASE I
          Length = 128

 Score =  118 bits (297), Expect = 5e-30
 Identities = 115/128 (89%), Positives = 122/128 (95%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           MRLLHTMLRVGDLQRSI FYT VLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN
Sbjct: 1   MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
           WGV+ Y++G AYGHIALSVDNAAEACE+IRQNGGNVTREAGPVKGG+T+IAFVEDPDGYK
Sbjct: 61  WGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYK 120

Query: 121 IELIEAKD 128
           IELIE  +
Sbjct: 121 IELIEEGN 128


>1sqiA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVIC ACID DIOXYGENASE A:8 --
           156
          Length = 149

 Score =  112 bits (282), Expect = 3e-28
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 7/135 (5%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPE-YKYSLAFVGYGPETEEAVIELTY 59
           +        VG+ +++ +FY N +G + L         +  ++ V    +    +     
Sbjct: 10  LHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQGKIVFVLCSALN 69

Query: 60  NWGVESYD----MGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPV--KGGSTIIAFV 113
            W  E  D     G+    IA  V++     ++ R+ G  + RE      K G    A +
Sbjct: 70  PWNKEMGDHLVKHGDGVKDIAFEVEDCEHIVQKARERGAKIVREPWVEEDKFGKVKFAVL 129

Query: 114 EDPDGYKIELIEAKD 128
           +        L+E  +
Sbjct: 130 QTYGDTTHTLVEKIN 144


>1twuA [d.32.1.8] HYPOTHETICAL PROTEIN YYCE
          Length = 137

 Score =  103 bits (258), Expect = 2e-25
 Identities = 18/129 (13%), Positives = 34/129 (26%), Gaps = 2/129 (1%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
              +      G L   I FY   L +K +           + F     +      +    
Sbjct: 8   AAQIRIARPTGQLDEIIRFYEEGLCLKRIGEFSQHNGYDGVMFGLPHADYHLEFTQYEGG 67

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                    +       +    A    +++  G        P          +EDPDG++
Sbjct: 68  STAPVPHPDSLLVFYVPNAVELAAITSKLKHMGYQEVESENPYWSNGG--VTIEDPDGWR 125

Query: 121 IELIEAKDA 129
           I  + +K  
Sbjct: 126 IVFMNSKGI 134


>1r9cA [d.32.1.2] GLUTATHIONE TRANSFERASE
          Length = 125

 Score =  102 bits (254), Expect = 5e-25
 Identities = 18/125 (14%), Positives = 37/125 (29%), Gaps = 11/125 (8%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
             L H    V DL+R       V   + +  S+  ++  S        +     I +   
Sbjct: 3   EGLSHMTFIVRDLERMTRILEGVFDAREVYASDTEQFSLSREKFFLIGD-----IWVAIM 57

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
            G +  +    +    +   +     ER+ + G ++               +  D D + 
Sbjct: 58  QGEKLAERSYNHIAFKIDDADFDRYAERVGKLGLDMRPPRP------GRSIYFYDDDNHM 111

Query: 121 IELIE 125
            EL  
Sbjct: 112 FELHT 116


>1kllA [d.32.1.2] MITOMYCIN-BINDING PROTEIN
          Length = 128

 Score =  101 bits (253), Expect = 6e-25
 Identities = 22/125 (17%), Positives = 35/125 (28%), Gaps = 2/125 (1%)

Query: 2   RLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYG-PETEEAVIELTYN 60
           R+    + V D  +S  FY              P  +  L        +T E V      
Sbjct: 2   RISLFAVVVEDXAKSXEFYRKXGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPE 61

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
           W   +     A         +  +    +   G     +      G    A V+DPDG  
Sbjct: 62  WQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQR-YAIVKDPDGNV 120

Query: 121 IELIE 125
           ++L  
Sbjct: 121 VDLFA 125


>1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144
          Length = 144

 Score =  101 bits (251), Expect = 1e-24
 Identities = 18/130 (13%), Positives = 38/130 (29%), Gaps = 2/130 (1%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAV--IELT 58
               H  +   +   +  FY NVLG++ ++ + N +                        
Sbjct: 5   KGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELSFFE 64

Query: 59  YNWGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDG 118
                 +Y   NA   I L V +         +      + +      +      ED +G
Sbjct: 65  IPLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFEDAEG 124

Query: 119 YKIELIEAKD 128
            ++ L+ +  
Sbjct: 125 LRLVLLVSNG 134


>1sp9A [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
          Length = 362

 Score = 98.1 bits (243), Expect = 9e-24
 Identities = 17/137 (12%), Positives = 38/137 (27%), Gaps = 13/137 (9%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
            RL H +  V +L  ++ +     G     +  N                   + E  + 
Sbjct: 167 RRLDHAVGNVPELGPALTYVAGFTGFHQFASGLNSA-----VLASNDEMVLLPINEPVHG 221

Query: 61  WGVES-------YDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTI-IAF 112
              +S       ++ G    H+AL  ++       +R+       +  P    +      
Sbjct: 222 TKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLK 281

Query: 113 VEDPDGYKIELIEAKDA 129
               D    + I+  + 
Sbjct: 282 KRVGDVLSDDQIKECEE 298



 Score = 86.5 bits (213), Expect = 3e-20
 Identities = 17/136 (12%), Positives = 34/136 (25%), Gaps = 14/136 (10%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYG------------P 48
            R  H     GD       ++  LGM+    S+        A                  
Sbjct: 13  KRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYS 72

Query: 49  ETEEAVIELTYNWGVESYDMG-NAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGS 107
            +  ++    +      +         +A+ V++A  A      NG   +     +    
Sbjct: 73  PSTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAV 132

Query: 108 TIIAFVEDPDGYKIEL 123
           TI    +      +  
Sbjct: 133 TIAEV-KLYGDVVLRY 147


>1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147
          Length = 145

 Score = 96.4 bits (239), Expect = 3e-23
 Identities = 26/128 (20%), Positives = 42/128 (32%), Gaps = 10/128 (7%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           +R  +  + V DL +S  FY +VLG+ +    EN        ++    E     + L   
Sbjct: 14  VRCAYMEIVVTDLAKSREFYVDVLGLHVTEEDENT------IYLRSLEEFIHHNLVLRQG 67

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                     A+ +   S      A    ++ G    R       G      VEDP G+ 
Sbjct: 68  PIAA----VAAFAYRVKSPAEVDAAEAYYKELGCRTERRKEGFTKGIGDSVRVEDPLGFP 123

Query: 121 IELIEAKD 128
            E     +
Sbjct: 124 YEFFYETE 131


>1u6lA [d.32.1.7] HYPOTHETICAL PROTEIN
          Length = 133

 Score = 96.2 bits (238), Expect = 3e-23
 Identities = 18/133 (13%), Positives = 40/133 (30%), Gaps = 6/133 (4%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYG----PETEEAVIE 56
           ++++  ++  G+ + + + Y   LG  L       +      +               + 
Sbjct: 2   LQIVPYLIFNGNCREAFSCYHQHLGGTLEAXLPFGDSPEPADWKDKIXHARLVVGSFALX 61

Query: 57  LTYNWGVESYDMGNAYG-HIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVED 115
            + N     Y+        + +     AE        GG+V    GP    ++   F  D
Sbjct: 62  ASDNHPAYPYEGIKGCSISLNVDSKAEAERLFNALAEGGSVQXPLGPTFWAASFGXF-TD 120

Query: 116 PDGYKIELIEAKD 128
             G    +   +D
Sbjct: 121 RFGVAWXVNCEQD 133


>1bylA [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
          Length = 122

 Score = 96.1 bits (238), Expect = 4e-23
 Identities = 19/125 (15%), Positives = 34/125 (27%), Gaps = 8/125 (6%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           +     +L   D+  ++ F+T+ LG       ++       A V     T          
Sbjct: 5   LTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDF------AGVVRDDVTLFISAVQDQV 58

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
               +       G   L  + +       R   G    E G    G      + DP G  
Sbjct: 59  VPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGRE--FALRDPAGNC 116

Query: 121 IELIE 125
           +  + 
Sbjct: 117 VHFVA 121


>1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145
          Length = 145

 Score = 93.8 bits (232), Expect = 2e-22
 Identities = 21/128 (16%), Positives = 42/128 (32%), Gaps = 9/128 (7%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           MR  H  LRV D+ +++  Y  +LG+  +   +         ++    E ++  + L   
Sbjct: 6   MRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRV-----YLKAWTEVDKFSLVLREA 60

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                    +  G   +  D   +    +   G  V +               + P G+ 
Sbjct: 61  DE----PGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHH 116

Query: 121 IELIEAKD 128
            EL   K+
Sbjct: 117 FELYADKE 124


>2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113
          Length = 111

 Score = 93.7 bits (232), Expect = 2e-22
 Identities = 21/124 (16%), Positives = 40/124 (32%), Gaps = 13/124 (10%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           +R +   +   +  R+ AFY ++LG          ++ + +                   
Sbjct: 1   VRRVVANIATPEPARAQAFYGDILGXP-----VAXDHGWIVTHASPLE-------AHAQV 48

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                   G     +++ VDN  E   RI + G  +         G     F+ DP G  
Sbjct: 49  SFAREGGSGTDVPDLSIEVDNFDEVHARILKAGLPIEYGPVTEAWGVQ-RLFLRDPFGKL 107

Query: 121 IELI 124
           I ++
Sbjct: 108 INIL 111


>1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153
          Length = 150

 Score = 92.3 bits (228), Expect = 5e-22
 Identities = 13/129 (10%), Positives = 29/129 (22%), Gaps = 7/129 (5%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           M                  +  +   K+                  G        E    
Sbjct: 8   MGFEFIEFASPTPGTLEPIFEIMGFTKVATHRSKNV-----HLYRQGEINLILNNEPNSI 62

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
               + + G +   +A  V ++ +A  R  + G                +  ++   G  
Sbjct: 63  ASYFAAEHGPSVCGMAFRVKDSQKAYNRALELG--AQPIHIDTGPMELNLPAIKGIGGAP 120

Query: 121 IELIEAKDA 129
           + LI+    
Sbjct: 121 LYLIDRFGE 129


>1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356
          Length = 202

 Score = 90.7 bits (224), Expect = 1e-21
 Identities = 15/138 (10%), Positives = 31/138 (22%), Gaps = 11/138 (7%)

Query: 1   MRLLHT--MLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIEL- 57
             + H    +  G +     FY  +   +  R  +       L             I L 
Sbjct: 4   KVIDHLTHNVYRGRMVYWANFYEKLFNFREARYFDIKGEYTGLTSKAMSAPDGMIRIPLN 63

Query: 58  -------TYNWGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTII 110
                             G    H+A   D+  +  + +++ G               + 
Sbjct: 64  EESSKGAGQIEEFLMQFNGEGIQHVAFLTDDLVKTWDALKKIGMRFMTAPPDTYYE-MLE 122

Query: 111 AFVEDPDGYKIELIEAKD 128
             + D      +L     
Sbjct: 123 GRLPDHGEPVDQLQARGI 140


>1bh5A [d.32.1.1] LACTOYLGLUTATHIONE LYASE
          Length = 177

 Score = 90.1 bits (222), Expect = 2e-21
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 26/153 (16%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYG------------- 47
             L  TMLRV D ++S+ FYT VLGM L++  + P  K+SL F+ Y              
Sbjct: 23  FLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKI 82

Query: 48  --PETEEAVIELTYNWGVESYDM---------GNAYGHIALSVDNAAEACERIRQNGGNV 96
               + +A +ELT+NWG E  +             +GHI ++V +   AC+R  + G   
Sbjct: 83  AWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKF 142

Query: 97  TREAGPVKGGSTIIAFVEDPDGYKIELIEAKDA 129
            +   P  G    +AF++DPDGY I+++     
Sbjct: 143 VK--KPDDGKMKGLAFIQDPDGYWIQILNPNKM 173


>1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --
           288
          Length = 146

 Score = 89.9 bits (222), Expect = 3e-21
 Identities = 21/128 (16%), Positives = 39/128 (30%), Gaps = 10/128 (7%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
             + H +  V D  +++AFYT VLG  L    +     +               I L   
Sbjct: 9   QGIGHFVRCVPDTAKAMAFYTEVLGFVLSDIIDIVPAHF------LHCNGRHHTIALAAF 62

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                    + +   A ++D+   A +R+   G   +   G      T+  + + P    
Sbjct: 63  PI---PKRIHHFMLQANTIDDVGYAFDRLDAAGRITSLL-GRHTNDQTLSFYADTPSPMI 118

Query: 121 IELIEAKD 128
                   
Sbjct: 119 EVEFGWGP 126


>1jc4A [d.32.1.4] METHYLMALONYL-COA EPIMERASE
          Length = 145

 Score = 89.3 bits (220), Expect = 4e-21
 Identities = 24/139 (17%), Positives = 42/139 (30%), Gaps = 12/139 (8%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIEL--- 57
           + + H      D   +  +Y    G   L   ENPE            +  E   ++   
Sbjct: 6   ICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEIXXAPAAKLTEHXTQVQVX 65

Query: 58  -------TYNWGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTII 110
                  T    +  ++      H A  VD+       +R+ G  +  +   +  G   I
Sbjct: 66  APLNDESTVAKWLAKHNGRAGLHHXAWRVDDIDAVSATLRERGVQLLYDEPKLGTGGNRI 125

Query: 111 AF--VEDPDGYKIELIEAK 127
            F   +   G  IEL +  
Sbjct: 126 NFXHPKSGKGVLIELTQYP 144


>1ss4A [d.32.1.6] GLYOXALASE FAMILY PROTEIN
          Length = 149

 Score = 88.1 bits (217), Expect = 9e-21
 Identities = 24/144 (16%), Positives = 50/144 (34%), Gaps = 20/144 (13%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAV------ 54
           +R  +  + V  L  +I+F+  +      R   N E +++    G G +  E        
Sbjct: 8   LRXDNVSIVVESLDNAISFFEEIGLNLEGR--ANVEGEWAGRVTGLGSQCVEIAXXVTPD 65

Query: 55  ----IELTYNWGVES-------YDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPV 103
               IEL+      +             Y  +  +V++  E   R+ ++G  +  E    
Sbjct: 66  GHSRIELSRFLTPPTIADHRTAPVNALGYLRVXFTVEDIDEXVSRLTKHGAELVGEVVQY 125

Query: 104 KGGSTIIAFVEDPDGYKIELIEAK 127
           +     + ++   +G  I L E  
Sbjct: 126 ENSYR-LCYIRGVEGILIGLAEEL 148


>1xqaA [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN
          Length = 112

 Score = 88.0 bits (217), Expect = 1e-20
 Identities = 21/122 (17%), Positives = 37/122 (30%), Gaps = 14/122 (11%)

Query: 2   RLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61
            + H  L V D+  +  F     G+    T  N         V    +     +      
Sbjct: 3   GIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNA------FAVXRDNDGFILTLXKGKEV 56

Query: 62  GVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKI 121
               Y      G    S +   +  +R++++G  V               +VE P G+ I
Sbjct: 57  Q---YPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHAAY-----TFYVEAPGGFTI 108

Query: 122 EL 123
           E+
Sbjct: 109 EV 110


>1tsjA [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN
          Length = 117

 Score = 84.5 bits (208), Expect = 1e-19
 Identities = 11/124 (8%), Positives = 31/124 (25%), Gaps = 13/124 (10%)

Query: 2   RLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61
           ++   +      + ++  YT++     + T        +                +    
Sbjct: 5   KITTFLXFNNQAEEAVKLYTSLFEDSEIITXAKYGDPGT------------VQHSIFTLN 52

Query: 62  GVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKI 121
           G     +      + +      E      ++ G +              A+V+D  G   
Sbjct: 53  GQVFXAIDPISLFVTVKDTIEXERLFNGLKDEGAILXPKTNXPPYRE-FAWVQDKFGVSF 111

Query: 122 ELIE 125
           +L  
Sbjct: 112 QLAL 115


>1lqkA [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN
          Length = 134

 Score = 76.7 bits (188), Expect = 2e-17
 Identities = 30/123 (24%), Positives = 43/123 (34%), Gaps = 14/123 (11%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
             L H  L V DL  SIAFY ++LG +L    +        A++  G        E  Y 
Sbjct: 3   TGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQG------AYLELGSLWLCLSREPQYG 56

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK 120
                      Y H A  +  A  A    +     V         G +   +  DPDG++
Sbjct: 57  GP------AADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSF--YFLDPDGHR 108

Query: 121 IEL 123
           +E 
Sbjct: 109 LEA 111


>1ecsA [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN
          Length = 120

 Score = 71.4 bits (174), Expect = 9e-16
 Identities = 23/129 (17%), Positives = 39/129 (30%), Gaps = 20/129 (15%)

Query: 5   HTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVE 64
              L   D   + AFY   LG  ++              +  G             +   
Sbjct: 5   TPNLPSRDFDSTAAFYE-RLGFGIVFRDAG------WMILQRGDLM-------LEFFAHP 50

Query: 65  SYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGST------IIAFVEDPDG 118
             D   ++    L +D+ AE   + +  G   T    P             +A + DPDG
Sbjct: 51  GLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQGWGGTMAALVDPDG 110

Query: 119 YKIELIEAK 127
             + LI+ +
Sbjct: 111 TLLRLIQNE 119


>1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
          Length = 176

 Score = 69.9 bits (170), Expect = 3e-15
 Identities = 19/126 (15%), Positives = 44/126 (34%), Gaps = 9/126 (7%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN 60
           +RL H      D+ R  A+  ++         ++ +     A++       +  +     
Sbjct: 4   VRLDHFNQVTPDVPRGRAYLEDLGFRVSEDIKDS-DGVTYAAWMHRKQTVHDTALTGGNG 62

Query: 61  WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGST--IIAFVEDPDG 118
                    +          N  + C+++     +   E GP + G +     ++ DPDG
Sbjct: 63  PR------MHHVAFATHEKHNIIQICDKMGALRISDRIERGPGRHGVSNAFYLYILDPDG 116

Query: 119 YKIELI 124
           ++IE+ 
Sbjct: 117 HRIEIY 122


>1sp8A1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:36 -- 207
          Length = 172

 Score = 64.9 bits (158), Expect = 9e-14
 Identities = 27/145 (18%), Positives = 43/145 (29%), Gaps = 27/145 (18%)

Query: 1   MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPE----------YKYSLAFVG---YG 47
           +   H  L   D   +   ++  LG  L   S+                SL+F+    Y 
Sbjct: 12  LAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNSAHASLLLRSGSLSFLFTAPYA 71

Query: 48  PETEEAVIELTYNWGVE----SYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPV 103
              + A   L           + D G A   +AL V +A +A       G         +
Sbjct: 72  HGADAATAALPSFSAAAARRFAADHGLAVRAVALRVADAEDAFRASVAAGARPAFGPVDL 131

Query: 104 KG----------GSTIIAFVEDPDG 118
                       G  ++ +V  PDG
Sbjct: 132 GRGFRLAEVELYGDVVLRYVSYPDG 156


>1mpyA2 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:146 -- 307
          Length = 162

 Score = 43.6 bits (103), Expect = 2e-07
 Identities = 21/127 (16%), Positives = 45/127 (35%), Gaps = 15/127 (11%)

Query: 2   RLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61
           R  H ++   +L  +   +T VLG  L     +        F+    +  +         
Sbjct: 5   RFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAF------ 58

Query: 62  GVESYDMGNAYGHIALSVDNAAE---ACERIRQNGGNVTREAGPVKGGSTIIAF--VEDP 116
            +   + G  + H++  ++   +   A + I     ++  + GP + G T        DP
Sbjct: 59  -IHHPEKGRLH-HVSFHLETWEDLLRAADLISMTDTSI--DIGPTRHGLTHGKTIYFFDP 114

Query: 117 DGYKIEL 123
            G + E+
Sbjct: 115 SGNRNEV 121


>2i7rA1 [d.32.1.2] CONSERVED DOMAIN PROTEIN A:1 -- 115
          Length = 115

 Score = 34.4 bits (79), Expect = 1e-04
 Identities = 18/118 (15%), Positives = 42/118 (35%), Gaps = 12/118 (10%)

Query: 10  VGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMG 69
           V ++ +  A   ++L  K    ++         F  +   +    +   +   +E++  G
Sbjct: 10  VSNVPQVCADLEHILDKKADYANDG--------FAQFTIGSHCLXLSQNHLVPLENFQSG 61

Query: 70  NAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAK 127
                I + V++  +  +R+ + G  V         G T    V+ P G  ++    K
Sbjct: 62  II---IHIEVEDVDQNYKRLNELGIKVLHGPTVTDWG-TESLLVQGPAGLVLDFYRXK 115


>1zswA2 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:145 -- 314
          Length = 170

 Score = 34.1 bits (78), Expect = 2e-04
 Identities = 21/122 (17%), Positives = 44/122 (36%), Gaps = 18/122 (14%)

Query: 8   LRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYD 67
           L V  L +  +  T + G   +  ++      ++     G    E V++        +  
Sbjct: 18  LTVRRLDKMASTLTEIFGYTEVSRNDQ----EAIFQSIKGEAFGEIVVKYL---DGPTEK 70

Query: 68  MGNAYG---HIALSVDN---AAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKI 121
            G   G   H+A+ V N    A   E+++Q G + +   G +        +  + +G   
Sbjct: 71  PG--RGSIHHLAIRVKNDAELAYWEEQVKQRGFHSS---GIIDRFYFKSLYFRESNGILF 125

Query: 122 EL 123
           E+
Sbjct: 126 EI 127


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0466    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,711,364
Number of extensions: 806752
Number of successful extensions: 3589
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 3404
Number of HSP's successfully gapped: 176
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)