RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF67354.1 sent8 ACF67354.1 GIB00763CH01 "putative esterase
YbdB"
         (137 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1zkiA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA5202 A:4 -- 129               79   5e-18
1o0iA [d.38.1.5] HYPOTHETICAL PROTEIN HI1161                           72   7e-16
1q4sA [d.38.1.5] THIOESTERASE                                          59   6e-12
1yocA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA1835 A:1 -- 145               56   5e-11
2cy9A1 [d.38.1.5] THIOESTERASE SUPERFAMILY MEMBER 2 A:13 -- 139        53   3e-10
1j1yA [d.38.1.5] PAAI PROTEIN                                          46   6e-08
1sh8A [d.38.1.5] HYPOTHETICAL PROTEIN PA5026                           45   6e-08
2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209                      42   7e-07
2nujA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:3 -- 161                  36   4e-05
1vpmA [d.38.1.1] ACYL-COA HYDROLASE                                    36   6e-05
2av9A1 [d.38.1.1] THIOESTERASE A:5 -- 146                              35   9e-05
2ownA2 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:150 -...    33   3e-04

>1zkiA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA5202 A:4 -- 129
          Length = 126

 Score = 79.0 bits (195), Expect = 5e-18
 Identities = 25/108 (23%), Positives = 39/108 (36%), Gaps = 1/108 (0%)

Query: 23  HLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRDGQCVVG 82
            +G+    LGD V E  +P  A                  +    +A        +  V 
Sbjct: 14  LVGLDPVSLGDGVAEVRLPXAAHLRNRGGVXHGGALFSLXDVTXGLACSSSHGFDRQSVT 73

Query: 83  TELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCR 130
            E    + RAV+ G+VR V   LH GR++   E  +     +     +
Sbjct: 74  LECKINYIRAVADGEVRCVARVLHAGRRSLVVEAEVRQG-DKLVAKGQ 120


>1o0iA [d.38.1.5] HYPOTHETICAL PROTEIN HI1161
          Length = 137

 Score = 71.9 bits (176), Expect = 7e-16
 Identities = 55/130 (42%), Positives = 75/130 (57%)

Query: 2   IWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXX 61
           +WK+  TL+ LN    N+ V+HLGI  +  G+D +EA  PVD RT QPF           
Sbjct: 1   LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATXPVDHRTXQPFGVLHGGVSVAL 60

Query: 62  XETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDE 121
            ET+GS+AG L   +G+ VVG ++NA H R V  GKV     P++LGR  Q W+I +  E
Sbjct: 61  AETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTE 120

Query: 122 QGRRCCTCRL 131
           + + CC  RL
Sbjct: 121 ENKLCCVSRL 130


>1q4sA [d.38.1.5] THIOESTERASE
          Length = 142

 Score = 58.9 bits (142), Expect = 6e-12
 Identities = 26/126 (20%), Positives = 44/126 (34%), Gaps = 1/126 (0%)

Query: 7   LTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLG 66
                     + TL   +G V   +  +   A + V     Q +            E L 
Sbjct: 8   DVASHYPVAYEQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLA 67

Query: 67  SMAGYLMTR-DGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRR 125
           + A   +    G   VG   + +  R V +G VR   + +H G     W+++L D+ GR 
Sbjct: 68  TEATVAVVHEKGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRL 127

Query: 126 CCTCRL 131
           C    +
Sbjct: 128 CAVSSM 133


>1yocA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA1835 A:1 -- 145
          Length = 145

 Score = 55.8 bits (134), Expect = 5e-11
 Identities = 8/134 (5%), Positives = 24/134 (17%), Gaps = 5/134 (3%)

Query: 7   LTLDELNAT--SQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXET 64
           +   + +A         A +   +  L     E   P                     E 
Sbjct: 11  VGPAQFSAMIGQFAPYFASIAPQFVELRPGYAEVTFPKRREVLNHIGTVHAIALCNAAEL 70

Query: 65  LGSMAGYLMTRDGQCVVGTELNATHHRAVSQG-KVRGVCLPLHLGRQNQS-WEITLFDEQ 122
                       G   +   +   +    +   +       +           +  + + 
Sbjct: 71  AAGTMTDASIPAGHRWIPRGMTVEYLAKATGDVRAVADGSQIDWQATGNLVVPVVAYVD- 129

Query: 123 GRRCCTCRLGTAVM 136
            +      +   V 
Sbjct: 130 DKPVFRAEITMYVS 143


>2cy9A1 [d.38.1.5] THIOESTERASE SUPERFAMILY MEMBER 2 A:13 -- 139
          Length = 122

 Score = 53.2 bits (128), Expect = 3e-10
 Identities = 15/124 (12%), Positives = 31/124 (25%), Gaps = 8/124 (6%)

Query: 16  SQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTR 75
                     +       + L  E  V+ +                 +++ + A      
Sbjct: 5   KVPGFDVLEKVTLVSAAPEKLICEXKVEEQHTNKLGTLHGGLTATLVDSISTXAL----- 59

Query: 76  DGQCVVGTELNATHHRAVSQG-KVRGVCLPLHLGRQNQSWEITLF-DEQGRRCCTCRLGT 133
                V  + N T+      G ++      L  G+      + L     G+     R  T
Sbjct: 60  XCTPGVSVDXNITYXSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGR-HT 118

Query: 134 AVMG 137
             +G
Sbjct: 119 KHLG 122


>1j1yA [d.38.1.5] PAAI PROTEIN
          Length = 116

 Score = 45.6 bits (108), Expect = 6e-08
 Identities = 15/115 (13%), Positives = 33/115 (28%), Gaps = 6/115 (5%)

Query: 18  NTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRDG 77
           +  +  LG+    L          V A                  ++    A  L +   
Sbjct: 2   DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADS----AFALASNTR 57

Query: 78  QCVVGTELNATHHRAVSQG-KVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRL 131
              V       + R +  G +V    + ++L R+  ++ + +  E G+       
Sbjct: 58  GPAVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSE-GKLVALFTG 111


>1sh8A [d.38.1.5] HYPOTHETICAL PROTEIN PA5026
          Length = 153

 Score = 45.4 bits (107), Expect = 6e-08
 Identities = 18/146 (12%), Positives = 30/146 (20%), Gaps = 15/146 (10%)

Query: 5   RHLTLDELNATSQN--TLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXX 62
             L  +     ++     V   G+    L    +   MP                     
Sbjct: 2   MPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNE-NHIGSMYAGALFTLA 60

Query: 63  ETLGSMAGYLMTRDGQ-CVVGTELNATHHRAVSQG-----------KVRGVCLPLHLGRQ 110
           E  G           +   +  E+     R                  +        G+ 
Sbjct: 61  ELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGKA 120

Query: 111 NQSWEITLFDEQGRRCCTCRLGTAVM 136
             S E+ L DEQG           + 
Sbjct: 121 EYSLELQLTDEQGEVVAESAALYQLR 146


>2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209
          Length = 203

 Score = 42.0 bits (98), Expect = 7e-07
 Identities = 10/124 (8%), Positives = 31/124 (25%), Gaps = 4/124 (3%)

Query: 9   LDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSM 68
           +   +  +         +V   L D  +   + +      P             + +  +
Sbjct: 79  VTRHDPVTGPENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGV 138

Query: 69  AGYLMTRDGQCVVGTELNATHHRAVSQG-KVRGVCLPLHLGRQNQSWEITLFDEQGRRCC 127
           A     +        +L+  +HR       +        +  +  +    +    G+ C 
Sbjct: 139 ANAWGGK---AGXTAQLSTRYHRPTPLFEPLTLTGKLXSVDGRKITTAGDIRTADGQVCV 195

Query: 128 TCRL 131
           +   
Sbjct: 196 SVEG 199


>2nujA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:3 -- 161
          Length = 159

 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 11/126 (8%), Positives = 25/126 (19%), Gaps = 8/126 (6%)

Query: 19  TLVAHLGIVYTRLGDDVLEAEMPV-----DARTHQPFXXXXXXXXXXXXETLGSMAGYLM 73
            L A      +            V     DA  H                 L +      
Sbjct: 7   PLPAETLRALSIPAPWTFGLADRVRFGELDAIGHVNHTAYLRWYESFRLPFLKARHVTDY 66

Query: 74  TRDGQCVVGTELNATHHRAVSQG-KVRGVCLPLHLGRQNQSWEITLF--DEQGRRCCTCR 130
                 +V  +++ T+      G          +    + + E   +   +         
Sbjct: 67  GPTSPRLVLKQVHCTYLAEXGXGEDYVITGRVSNFRTTSFTXEFACWRLGDAVECTSEGS 126

Query: 131 LGTAVM 136
               ++
Sbjct: 127 AVVVLL 132


>1vpmA [d.38.1.1] ACYL-COA HYDROLASE
          Length = 155

 Score = 35.7 bits (82), Expect = 6e-05
 Identities = 9/107 (8%), Positives = 22/107 (20%), Gaps = 5/107 (4%)

Query: 28  YTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRDGQCVVGTELNA 87
              +          V                    + + ++           V  +  + 
Sbjct: 3   SYPVERSRTIQTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTAXKHAN-SAVVTASIDSV 61

Query: 88  THHRAVSQGK-VRGVCLPLHLGRQNQSWEITLFDEQ---GRRCCTCR 130
               + + G  +       H GR +    + +       G R  T  
Sbjct: 62  DFKSSATVGDALELEGFVTHTGRTSXEVYVRVHSNNLLTGERTLTTE 108


>2av9A1 [d.38.1.1] THIOESTERASE A:5 -- 146
          Length = 142

 Score = 35.0 bits (80), Expect = 9e-05
 Identities = 12/114 (10%), Positives = 28/114 (24%), Gaps = 6/114 (5%)

Query: 29  TRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMA-----GYLMTRDGQCVVGT 83
                 +    +      +  +            +T  +       G  +       +  
Sbjct: 3   PLREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVV 62

Query: 84  ELNATHHRAVSQGK-VRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVM 136
             +  +   V+  + +        LG  +  +E+ LF E  R  C       V 
Sbjct: 63  SSSCDYFAPVAFPQRIEXGLRVARLGNSSVQYELALFLEGQREACAAGRFVHVF 116


>2ownA2 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:150 --
           258
          Length = 109

 Score = 33.4 bits (76), Expect = 3e-04
 Identities = 12/112 (10%), Positives = 23/112 (20%), Gaps = 7/112 (6%)

Query: 26  IVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAGYLMTRDGQCVVGTEL 85
            +     D  +     V      P                      L            +
Sbjct: 2   PISFEATDTTITKPYHVRFFDIDPNRHVNNAHYFDWLVDTLPATFLLQ------HDLVHV 55

Query: 86  NATHHRAVSQGK-VRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVM 136
           +  +   V  G+ V      L     +Q     L +    +CC   +    +
Sbjct: 56  DVRYENEVKYGQTVTAHANILPSEVADQVTTSHLIEVDDEKCCEVTIQWRTL 107


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0594    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,006,739
Number of extensions: 1073793
Number of successful extensions: 5282
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 4945
Number of HSP's successfully gapped: 319
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)