RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF68005.1 sent8 nuoE GIB00763CH01 "NADH-quinone
oxidoreductase, E subunit"
         (166 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2fug21 [c.47.1.21] NADH-QUINONE OXIDOREDUCTASE CHAIN 2 2:3 -- 180     135   6e-35
1f37A [c.47.1.11] FERREDOXIN [2FE-2S]                                  84   2e-19
1fc3A [a.4.6.3] SPO0A                                                  55   1e-10

>2fug21 [c.47.1.21] NADH-QUINONE OXIDOREDUCTASE CHAIN 2 2:3 -- 180
          Length = 178

 Score =  135 bits (341), Expect = 6e-35
 Identities = 44/152 (28%), Positives = 79/152 (51%), Gaps = 3/152 (1%)

Query: 14  LSAAEREAIEHEKHHY--EDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEG 71
               +++ +E     Y  E  RAA +  L+ VQ++ GW+    I  IA ++G   ++V G
Sbjct: 1   FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMG 60

Query: 72  VATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPT 131
           VA+FYS     P G++ ++ C ++ C + G + +   L + L I PG+ T DG F++   
Sbjct: 61  VASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKV 120

Query: 132 CCLGNCDKGPNMMIDEDT-HSHLTPEAIPELL 162
            CLG+C   P + ++++     +T   +  LL
Sbjct: 121 ECLGSCHTAPVIQVNDEPYVECVTRARLEALL 152


>1f37A [c.47.1.11] FERREDOXIN [2FE-2S]
          Length = 109

 Score = 83.9 bits (207), Expect = 2e-19
 Identities = 18/96 (18%), Positives = 36/96 (37%), Gaps = 8/96 (8%)

Query: 73  ATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTC 132
           A F   +F     +          C   G + +  A  + +   P          + PT 
Sbjct: 1   AEFKH-VF--VCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQL---FMTTVITPTG 54

Query: 133 CLGNCDKGPNMMI--DEDTHSHLTPEAIPELLERYK 166
           C+  C  GP +++  D   +  + PE + E++E++ 
Sbjct: 55  CMNACMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHL 90


>1fc3A [a.4.6.3] SPO0A
          Length = 119

 Score = 54.6 bits (131), Expect = 1e-10
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 3/71 (4%)

Query: 4  NQQPQTEAFELSAAEREA-IEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVL 62
          N+    +   +++   E  +      Y   R A    +    +  G +       IA   
Sbjct: 1  NKPKNLD-ASITSIIHEIGVPAHIKGYLYLREAIA-MVYHDIELLGSITKVLYPDIAKKY 58

Query: 63 GIPASDVEGVA 73
             AS VE   
Sbjct: 59 NTTASRVERAI 69


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.330    0.142    0.461 

Gapped
Lambda     K      H
   0.267   0.0646    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 19,793,693
Number of extensions: 1463840
Number of successful extensions: 6023
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 5848
Number of HSP's successfully gapped: 211
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)