BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF55075.1 spne4 ACF55075.1 GIB00761CH01 "RRF2 family protein"
         (145 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1xd7A [a.4.5] YWNA                                                     94   2e-22
1ylfB [x.x.x] RRF2 FAMILY PROTEIN                                      74   3e-16
1ylfC [x.x.x] RRF2 FAMILY PROTEIN                                      71   2e-15
1ylfA [x.x.x] RRF2 FAMILY PROTEIN                                      64   2e-13

>1xd7A [a.4.5] YWNA
          Length = 116

 Score = 94.0 bits (232), Expect = 2e-22
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 17/132 (12%)

Query: 5   SRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGT 64
           SR  +A H+L +I+++ K S   S+ +A SV  NPV++R+++S LKKA++++   G  G 
Sbjct: 1   SRLAVAIHILSLISMDEKTS---SEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGA 57

Query: 65  EIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTME 124
            + KD  DISLL+VY+AV+               NP CPVG  I + LD+  E +Q  ME
Sbjct: 58  SLKKDPADISLLEVYRAVQ--------------KNPKCPVGKKIQNALDETFESVQRAME 103

Query: 125 AELGQTSLEKVV 136
            EL   SL+ V+
Sbjct: 104 NELASKSLKDVM 115


>1ylfB [x.x.x] RRF2 FAMILY PROTEIN
          Length = 114

 Score = 73.9 bits (180), Expect = 3e-16
 Identities = 52/120 (43%), Positives = 67/120 (55%), Gaps = 20/120 (16%)

Query: 5   SRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGT 64
           SRF+IA H+L I+      S  TSD+ A SV  NPV+IRKI S LK+A  + V RG GG 
Sbjct: 2   SRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYVNRGPGGA 58

Query: 65  EIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTME 124
            ++KDL +I+LLDVY AV                   CP+GA+I  VL+  L + Q   E
Sbjct: 59  GLLKDLHEITLLDVYHAVNV-----------------CPIGANIQAVLEIILIQAQSAEE 101


>1ylfC [x.x.x] RRF2 FAMILY PROTEIN
          Length = 115

 Score = 70.9 bits (172), Expect = 2e-15
 Identities = 55/138 (39%), Positives = 72/138 (52%), Gaps = 29/138 (21%)

Query: 3   IPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTG 62
           I SRF+IA H+L I+      S  TSD+ A SV  NPV+IRKI S LK+A  + V RG G
Sbjct: 1   ISSRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYVNRGPG 57

Query: 63  GTEIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLD------QKL 116
           G  ++KDL +I+LLDVY AV                     VGA+I  VL+      Q  
Sbjct: 58  GAGLLKDLHEITLLDVYHAVN--------------------VGANIQAVLEIILIQAQSA 97

Query: 117 ERIQLTMEAELGQTSLEK 134
           E +   +  +L +T  EK
Sbjct: 98  EEVLRNITGQLFETLQEK 115


>1ylfA [x.x.x] RRF2 FAMILY PROTEIN
          Length = 113

 Score = 64.3 bits (155), Expect = 2e-13
 Identities = 42/85 (49%), Positives = 55/85 (64%), Gaps = 6/85 (7%)

Query: 2  QIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGT 61
          +I SRF+IA H+L I+      S  TSD+ A SV  NPV+IRKI S LK+A  + V    
Sbjct: 1  KISSRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYV---N 54

Query: 62 GGTEIVKDLKDISLLDVYQAVECLG 86
          GG  ++KDL +I+LLDVY AV  +G
Sbjct: 55 GGAGLLKDLHEITLLDVYHAVNVIG 79


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 777,935,592
Number of extensions: 31984960
Number of successful extensions: 86750
Number of sequences better than 1.0e-03: 2417
Number of HSP's gapped: 84616
Number of HSP's successfully gapped: 2662
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)