BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF56071.1 spne4 atpC GIB00761CH01 "ATP synthase F0, C chain"
         (66 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1yceA [x.x.x] SUBUNIT C                                                39   2e-05
1wu0A [x.x.x] ATP SYNTHASE C CHAIN                                     36   1e-04

>1yceA [x.x.x] SUBUNIT C
          Length = 89

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 22/56 (39%), Positives = 30/56 (53%)

Query: 10 IACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFII 65
          IA +G  VG+G       +SVARQP+   +  S M LG A  E T   +LV + I+
Sbjct: 23 IAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALIL 78


>1wu0A [x.x.x] ATP SYNTHASE C CHAIN
          Length = 72

 Score = 35.8 bits (81), Expect = 1e-04
 Identities = 15/37 (40%), Positives = 25/37 (67%)

Query: 28 KSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFI 64
          + +ARQP++    ++ MF+GVA +E    + +VFSFI
Sbjct: 32 EGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFI 68


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 729,166,449
Number of extensions: 30056470
Number of successful extensions: 77255
Number of sequences better than 1.0e-03: 1667
Number of HSP's gapped: 75489
Number of HSP's successfully gapped: 2058
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)