BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF54781.1 spne4 ACF54781.1 GIB00761CH01
"bacteriocin-associated integral membrane protein"
         (676 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SYP_HALMA RecName: Full=Prolyl-tRNA synthetase;         EC=6.1.1...    37   7e-04

>SYP_HALMA RecName: Full=Prolyl-tRNA synthetase;       
           EC=6.1.1.15;AltName: Full=Proline--tRNA ligase;       
           Short=ProRS;
          Length = 484

 Score = 36.6 bits (83), Expect = 7e-04
 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 8/94 (8%)

Query: 387 LSDYTPSGNVIYVSPR-YLIEEKITVSSEFMDKMQNLSEGEFGLILPESLREQSVYYQGL 445
           L+DY P G  I   PR Y I E+I  + +   K   +    F L +PES  E+       
Sbjct: 30  LADYAPMGGFIVTRPRGYAIWERIQNNLDGWFKDTGVQNAYFPLFIPESYLEKE------ 83

Query: 446 FTDYLQNFSSESVEVTSQKHYLPQVRLAFTETGQ 479
             D ++ F  E   VT   H   + RLA   T +
Sbjct: 84  -KDVVEGFDPEVAWVTHGGHNELEERLAVRPTSE 116


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 7,920,207,737
Number of extensions: 318702933
Number of successful extensions: 935532
Number of sequences better than 1.0e-03: 19382
Number of HSP's gapped: 903797
Number of HSP's successfully gapped: 31003
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)