BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF55177.1 spne4 ACF55177.1 GIB00761CH01 "choline-binding
protein F, point mutation"
         (141 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TOXA_CLODI RecName: Full=Toxin A;                                      49   2e-08
ALYS_BPHB3 RecName: Full=Lytic amidase;         EC=3.5.1.28;AltN...    37   8e-05
ALYS_STRPN RecName: Full=Autolysin;         EC=3.5.1.28;AltName:...    36   2e-04
LYS_BPCP9 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName: F...    35   5e-04
LYS_BPCP1 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName: F...    35   5e-04
GTFS_STRDO RecName: Full=Glucosyltransferase-S;         Short=GT...    34   7e-04

>TOXA_CLODI RecName: Full=Toxin A;
          Length = 2710

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 40/127 (31%), Positives = 57/127 (44%), Gaps = 11/127 (8%)

Query: 16   FFGLLGTSTVFADDSE---GWQFVQENGRTYYKKGDLKE--TYWRVIDGKYYYFDPLSGE 70
            F  L G    F +DS+   GWQ +  +G+ YY   +  E  T W+ IDGK YYF+  + E
Sbjct: 2308 FLTLNGKKYYFDNDSKAVTGWQTI--DGKKYYFNLNTAEAATGWQTIDGKKYYFNLNTAE 2365

Query: 71   MVVGWQYIPAP--HKGVTIGPSPRIEISLRPDWFYFGQDGVLQ--EFVGKQVLEAKTATN 126
               GWQ I     +       +     S+    FYF  DG++Q   F G    E     N
Sbjct: 2366 AATGWQTIDGKKYYFNTNTFIASTGYTSINGKHFYFNTDGIMQIGVFKGPNGFEYFAPAN 2425

Query: 127  TNKHHGE 133
            T+ ++ E
Sbjct: 2426 TDANNIE 2432



 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 36/107 (33%), Positives = 50/107 (46%), Gaps = 9/107 (8%)

Query: 34   QFVQENGRTYYKKGDLKE-TYWRVIDGKYYYFDPLSGEMVVGWQYIPAP----HKGVTIG 88
            +F+  NG+ YY   D K  T  R IDGK YYF+  +   V GWQ I       +   +I 
Sbjct: 2441 KFLTLNGKKYYFGSDSKAVTGLRTIDGKKYYFNTNTAVAVTGWQTINGKKYYFNTNTSIA 2500

Query: 89   PSPRIEISLRPDWFYFGQDGVLQ--EFVGKQVLEAKTATNTNKHHGE 133
             +    IS +   FYF  DG++Q   F G    E     NT+ ++ E
Sbjct: 2501 STGYTIISGK--HFYFNTDGIMQIGVFKGPDGFEYFAPANTDANNIE 2545



 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 34   QFVQENGRTYYKKGDLKE-TYWRVIDGKYYYFDPLSGEMVVGWQYI 78
            +F+  NG+ YY   D K  T W+ IDGK YYF+  + E   GWQ I
Sbjct: 2307 KFLTLNGKKYYFDNDSKAVTGWQTIDGKKYYFNLNTAEAATGWQTI 2352



 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 11/127 (8%)

Query: 16   FFGLLGTSTVFADDSEGWQFVQE-NGRTYYKKGDLKE--TYWRVIDGKYYYFDPLSGEMV 72
            F  L G    F ++S+    +Q  + + YY   +  E  T W+ IDGK YYF+  + E  
Sbjct: 2060 FLTLNGKKYYFDNNSKAVTGLQTIDSKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAEAA 2119

Query: 73   VGWQYIPAPHKGVTIGPSPRIEIS----LRPDWFYFGQDGVLQ--EFVGKQVLEAKTATN 126
             GWQ I    K      +  I  +    +    FYF  DG++Q   F G    E     N
Sbjct: 2120 TGWQTIDG--KKYYFNTNTAIASTGYTIINGKHFYFNTDGIMQIGVFKGPNGFEYFAPAN 2177

Query: 127  TNKHHGE 133
            T+ ++ E
Sbjct: 2178 TDANNIE 2184



 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 36/117 (30%), Positives = 50/117 (42%), Gaps = 30/117 (25%)

Query: 34   QFVQENGRTYYKKGDLKE-TYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPR 92
            +F+  NG+ YY   D K  T WR+I+ K YYF+P +         I A H          
Sbjct: 2193 EFLTLNGKKYYFGSDSKAVTGWRIINNKKYYFNPNNA--------IAAIHL--------- 2235

Query: 93   IEISLRPDWFYFGQDGVLQ---------EFVGKQVLEAKTATNTNK-HHGEEYDSPA 139
               ++  D +YF  DG+LQ          F      E+K  T   K  +G EY +PA
Sbjct: 2236 --CTINNDKYYFSYDGILQNGYITIERNNFYFDANNESKMVTGVFKGPNGFEYFAPA 2290



 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 5/100 (5%)

Query: 39   NGRTYYKKGDLKETYWRV-IDGKYYYFDPLSGEMVVGWQYIPAP--HKGVTIGPSPRIEI 95
            + +TYY   D K     + I+   +YFDP+   +V GWQ I     +  +  G +     
Sbjct: 1817 DNKTYYYDEDSKLVKGLININNSLFYFDPIEFNLVTGWQTINGKKYYFDINTGAALTSYK 1876

Query: 96   SLRPDWFYFGQDGVLQ--EFVGKQVLEAKTATNTNKHHGE 133
             +    FYF  DGV+Q   F G    E     NT  ++ E
Sbjct: 1877 IINGKHFYFNNDGVMQLGVFKGPDGFEYFAPANTQNNNIE 1916



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 34   QFVQENGRTYYKKGDLKE-TYWRVIDGKYYYFDPLSGEMVVGWQYI 78
            +F+  NG+ YY   + K  T WR+I+ + YYF+P +    VG Q I
Sbjct: 1925 KFLTLNGKKYYFDNNSKAVTGWRIINNEKYYFNPNNAIAAVGLQVI 1970


>ALYS_BPHB3 RecName: Full=Lytic amidase;       
           EC=3.5.1.28;AltName: Full=N-acetylmuramoyl-L-alanine
           amidase;
          Length = 318

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 23/81 (28%)

Query: 34  QFVQENGRTYYKKGD---LKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPS 90
           +F + NG  YY  G    L + + +  DG +YYFD  SGEM  GW+              
Sbjct: 198 KFEKINGTWYYFDGSGYMLSDRWKKHTDGNWYYFDQ-SGEMATGWK-------------- 242

Query: 91  PRIEISLRPDWFYFGQDGVLQ 111
                 +   W+YF  +G ++
Sbjct: 243 -----KIADKWYYFDVEGAMK 258



 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 30  SEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDPLSGEMVVG-------WQYIPAPH 82
           S+ W+   +    Y+ +     T W+ I  K+YYFD + G M  G       W Y+ A  
Sbjct: 217 SDRWKKHTDGNWYYFDQSGEMATGWKKIADKWYYFD-VEGAMKTGWVKYKDTWYYLDA-- 273

Query: 83  KGVTIGPSPRIEISLRPDWFYFGQDGVLQE 112
           K   +  +  I+ +    W+Y   DG L +
Sbjct: 274 KEGAMVSNAFIQSADGTGWYYLKPDGTLAD 303


>ALYS_STRPN RecName: Full=Autolysin;         EC=3.5.1.28;AltName:
           Full=N-acetylmuramoyl-L-alanine amidase;AltName:
           Full=Murein hydrolase;
          Length = 318

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 23/81 (28%)

Query: 34  QFVQENGRTYY--KKGDLKETYWRV-IDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPS 90
           +F + NG  YY    G +    WR   DG +Y+FD  SGEM  GW+              
Sbjct: 198 KFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDN-SGEMATGWK-------------- 242

Query: 91  PRIEISLRPDWFYFGQDGVLQ 111
                 +   W+YF ++G ++
Sbjct: 243 -----KIADKWYYFNEEGAMK 258


>LYS_BPCP9 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
           Full=Endolysin;AltName: Full=Muramidase;AltName:
           Full=CP-9 lysin;
          Length = 339

 Score = 34.7 bits (78), Expect = 5e-04
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 22  TSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFD 65
           T+  +  DS+GW F + NG   Y K       W  I G +YYFD
Sbjct: 198 TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD 234


>LYS_BPCP1 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
           Full=Endolysin;AltName: Full=Muramidase;AltName:
           Full=CP-1 lysin;
          Length = 339

 Score = 34.7 bits (78), Expect = 5e-04
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 22  TSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFD 65
           T+  +  DS+GW F + NG   Y K       W  I G +YYFD
Sbjct: 198 TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD 234


>GTFS_STRDO RecName: Full=Glucosyltransferase-S;       
           Short=GTF-S;         EC=2.4.1.5;AltName:
           Full=Dextransucrase;AltName: Full=Sucrose
           6-glucosyltransferase;
          Length = 1365

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 39  NGRTYY--KKGDLKETYWRVIDGKYYYFDPLSGE 70
           +G+TYY    G   + Y  VIDGK YYFD  +GE
Sbjct: 154 DGKTYYVDANGQRLKNYSMVIDGKTYYFDGQTGE 187


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.327    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,791,160,474
Number of extensions: 358060866
Number of successful extensions: 1013711
Number of sequences better than 1.0e-03: 28073
Number of HSP's gapped: 970166
Number of HSP's successfully gapped: 36182
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)