BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF55485.1 spne4 ACF55485.1 GIB00761CH01 "glycosyl transferase,
group 1 family protein"
         (347 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y1607_METJA RecName: Full=Uncharacterized glycosyltransferase MJ...    54   3e-09
WAAK_SALTY RecName: Full=Lipopolysaccharide 1,2-N-acetylglucosam...    51   2e-08
EPSD_BACSU RecName: Full=Putative glycosyltransferase epsD;     ...    49   5e-08
TUAC_BACSU RecName: Full=Putative teichuronic acid biosynthesis ...    47   2e-07
GPI3_YEAS7 RecName: Full=Phosphatidylinositol N-acetylglucosamin...    47   3e-07
GPI3_YEAST RecName: Full=Phosphatidylinositol N-acetylglucosamin...    45   1e-06
GPI3_YEAS6 RecName: Full=Phosphatidylinositol N-acetylglucosamin...    45   1e-06
GPI3_YEAS1 RecName: Full=Phosphatidylinositol N-acetylglucosamin...    45   1e-06
WCAI_ECOLI RecName: Full=Putative colanic acid biosynthesis glyc...    44   2e-06
GPI3_SCHPO RecName: Full=Phosphatidylinositol N-acetylglucosamin...    41   2e-05
Y2592_STRCO RecName: Full=Exopolysaccharide phosphotransferase S...    39   5e-05
LPCC_RHILV RecName: Full=Lipopolysaccharide core biosynthesis ma...    39   5e-05
COTSA_BACSU RecName: Full=Spore coat protein SA;         EC=2.4....    39   9e-05
RFBU_SALTY RecName: Full=Protein rfbU;         EC=2.4.-.-;             38   1e-04
GLGA_AQUAE RecName: Full=Glycogen synthase;         EC=2.4.1.21;...    38   2e-04
GLGA2_GEOMG RecName: Full=Glycogen synthase 2;         EC=2.4.1....    37   3e-04
YC07_KLEPN RecName: Full=Uncharacterized 41.2 kDa protein in cps...    36   4e-04

>Y1607_METJA RecName: Full=Uncharacterized glycosyltransferase
           MJ1607;         EC=2.4.-.-;
          Length = 390

 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 6/180 (3%)

Query: 98  KGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWH-PLPQEEV 156
           K I      S Y   + + V   +  E       P +KV  I N +N  ++   L  EE 
Sbjct: 136 KAIHAMEYLSTYESCQVITVSKSLKEEVCSIFNTPEDKVKVIYNGINPWEFDINLSWEEK 195

Query: 157 VRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGMTDGYEH 216
           +  R  +G+ D++ +++  G++  +KGI+  IR    +P+I           G  D  ++
Sbjct: 196 INFRRSIGVQDDEKMILFVGRLTYQKGIEYLIRA---MPKILERHNAKLVIAGSGDMRDY 252

Query: 217 YKKIMEN--PPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIML 274
            + +         ++F G V+ + +++LY  AD+ ++PS  E F +  LEA +   P+++
Sbjct: 253 LEDLCYQLGVRHKVVFLGFVNGDTLKKLYKSADVVVIPSVYEPFGIVALEAMAAGTPVVV 312


>WAAK_SALTY RecName: Full=Lipopolysaccharide
           1,2-N-acetylglucosaminetransferase;         EC=2.4.1.56;
          Length = 381

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 56/233 (24%), Positives = 108/233 (46%), Gaps = 22/233 (9%)

Query: 116 VVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGA 175
           ++V   F++      +P   V+ +PN    E +   PQ+    LR  L ++++  +++ A
Sbjct: 143 IIVPSQFLKAFYEERLPAAAVSIVPNGFCAETYKRNPQDN---LRQQLNIAEDATVLLYA 199

Query: 176 GQVQKRKGIDDFIRLAEEL----PQITFIWAGGFSFGGMTDGYEHYKKIMENPPK---NL 228
           G++   KGI   ++  ++L      I  +  G        +  E+ KK+++   +   + 
Sbjct: 200 GRISPDKGILLLLQAFKQLRTLRSNIKLVVVGDPYASRKGEKAEYQKKVLDAAKEIGTDC 259

Query: 229 IFPGIVSPERMRELYALADLFLLPS-YNELFPMTILEA-ASCEAPIMLRDLDLYKVILEG 286
           I  G  SP++M   Y +ADL ++PS   E F M  +EA A+ +A +  +   + + +L+G
Sbjct: 260 IMAGGQSPDQMHNFYHIADLVIVPSQVEEAFCMVAVEAMAAGKAVLASKKGGISEFVLDG 319

Query: 287 --NYRATAGREEMKEAILEYQANPAVL----KDLKEKAKN-ISREYSEEHLLQ 332
              Y      E M    +    N A+       + EKAK+ +  +YS E++ Q
Sbjct: 320 ITGYHLA---EPMSSDSIINDINRALADKERHQIAEKAKSLVFSKYSWENVAQ 369


>EPSD_BACSU RecName: Full=Putative glycosyltransferase epsD;        
           EC=2.4.-.-;
          Length = 381

 Score = 49.3 bits (116), Expect = 5e-08
 Identities = 48/204 (23%), Positives = 86/204 (42%), Gaps = 14/204 (6%)

Query: 143 VNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIR----LAEELPQIT 198
           VN E++ P+   E  RLR   G  ++ FI+V   ++   K     I     L E++P + 
Sbjct: 171 VNTERFRPVSPIEQQRLREKHGFREDDFILVYPAELNLNKNQKQLIEAAALLKEKIPSLR 230

Query: 199 FIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELF 258
            ++AG    G M   Y+   + +     ++ F G  S   + EL  LAD+ +  S  E  
Sbjct: 231 LVFAGE---GAMEHTYQTLAEKL-GASAHVCFYGFCSD--IHELIQLADVSVASSIREGL 284

Query: 259 PMTILEAASCEAPIMLRDLDLYKVIL---EGNYRATAG-REEMKEAILEYQANPAVLKDL 314
            M +LE  + E P +  D   ++ I+   E  +    G        I +    P + + L
Sbjct: 285 GMNVLEGMAAEQPAIATDNRGHREIIRDGENGFLIKIGDSAAFARRIEQLYHKPELCRKL 344

Query: 315 KEKAKNISREYSEEHLLQIWLDFY 338
            ++ +  +  +SE   ++   D Y
Sbjct: 345 GQEGRKTALRFSEARTVEEMADIY 368


>TUAC_BACSU RecName: Full=Putative teichuronic acid biosynthesis
           glycosyltransferase tuaC;         EC=2.4.-.-;
          Length = 389

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 17/128 (13%)

Query: 153 QEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEEL---PQITFIWAGGFSFGG 209
           +E    +R  LGL  +Q + V  G++ + KGI +     E L   P+  F+  G      
Sbjct: 203 EETKEEIRKRLGLPLDQRLAVYVGRLVREKGIFELSEAIESLQDSPKAVFVGDGPAKSTL 262

Query: 210 MTDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCE 269
              G+              I  G V   ++R+    ADLF+LPSY+E  P  ++EA +  
Sbjct: 263 TQKGH--------------IVTGQVPNHQVRDYLLAADLFVLPSYSEGMPTVVIEALALR 308

Query: 270 APIMLRDL 277
            P++  D+
Sbjct: 309 VPVICTDV 316


>GPI3_YEAS7 RecName: Full=Phosphatidylinositol
           N-acetylglucosaminyltransferase GPI3 subunit;       
           EC=2.4.1.198;AltName: Full=GlcNAc-PI synthesis protein;
          Length = 452

 Score = 46.6 bits (109), Expect = 3e-07
 Identities = 50/243 (20%), Positives = 97/243 (39%), Gaps = 23/243 (9%)

Query: 102 KRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRT 161
           K   F+  N    + V N      +V   +  + ++ IPN V  E + P    +  + + 
Sbjct: 139 KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTDSTKRKQ 198

Query: 162 DLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEEL----PQITFIWAGG----FSFGGMTDG 213
               S ++ ++V  G++   KG D   R+  ++      + FI AG       F  M + 
Sbjct: 199 ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIES 254

Query: 214 YEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIM 273
           +   K++           G V  E++R++    D++L  S  E F   ++EAASC   I+
Sbjct: 255 HRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIV 306

Query: 274 LRDLDLYKVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQI 333
              +     +L       A +  + + +   QA    +  ++ KA + S  +     +  
Sbjct: 307 TTQVGGIPEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYD 363

Query: 334 WLD 336
           W+D
Sbjct: 364 WMD 366


>GPI3_YEAST RecName: Full=Phosphatidylinositol
           N-acetylglucosaminyltransferase GPI3 subunit;       
           EC=2.4.1.198;AltName: Full=GlcNAc-PI synthesis protein;
          Length = 452

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 50/243 (20%), Positives = 96/243 (39%), Gaps = 23/243 (9%)

Query: 102 KRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRT 161
           K   F+  N    + V N      +V   +  + ++ IPN V  E + P       + + 
Sbjct: 139 KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTGGTKRKQ 198

Query: 162 DLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEEL----PQITFIWAGG----FSFGGMTDG 213
               S ++ ++V  G++   KG D   R+  ++      + FI AG       F  M + 
Sbjct: 199 ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIES 254

Query: 214 YEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIM 273
           +   K++           G V  E++R++    D++L  S  E F   ++EAASC   I+
Sbjct: 255 HRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIV 306

Query: 274 LRDLDLYKVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQI 333
              +     +L       A +  + + +   QA    +  ++ KA + S  +     +  
Sbjct: 307 TTQVGGIPEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYD 363

Query: 334 WLD 336
           W+D
Sbjct: 364 WMD 366


>GPI3_YEAS6 RecName: Full=Phosphatidylinositol
           N-acetylglucosaminyltransferase GPI3 subunit;       
           EC=2.4.1.198;AltName: Full=GlcNAc-PI synthesis protein;
          Length = 452

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 50/243 (20%), Positives = 96/243 (39%), Gaps = 23/243 (9%)

Query: 102 KRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRT 161
           K   F+  N    + V N      +V   +  + ++ IPN V  E + P       + + 
Sbjct: 139 KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTGGTKRKQ 198

Query: 162 DLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEEL----PQITFIWAGG----FSFGGMTDG 213
               S ++ ++V  G++   KG D   R+  ++      + FI AG       F  M + 
Sbjct: 199 ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIES 254

Query: 214 YEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIM 273
           +   K++           G V  E++R++    D++L  S  E F   ++EAASC   I+
Sbjct: 255 HRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIV 306

Query: 274 LRDLDLYKVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQI 333
              +     +L       A +  + + +   QA    +  ++ KA + S  +     +  
Sbjct: 307 TTQVGGIPEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYD 363

Query: 334 WLD 336
           W+D
Sbjct: 364 WMD 366


>GPI3_YEAS1 RecName: Full=Phosphatidylinositol
           N-acetylglucosaminyltransferase GPI3 subunit;       
           EC=2.4.1.198;AltName: Full=GlcNAc-PI synthesis protein;
          Length = 452

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 50/243 (20%), Positives = 96/243 (39%), Gaps = 23/243 (9%)

Query: 102 KRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRT 161
           K   F+  N    + V N      +V   +  + ++ IPN V  E + P       + + 
Sbjct: 139 KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTGGTKRKQ 198

Query: 162 DLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEEL----PQITFIWAGG----FSFGGMTDG 213
               S ++ ++V  G++   KG D   R+  ++      + FI AG       F  M + 
Sbjct: 199 ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIES 254

Query: 214 YEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIM 273
           +   K++           G V  E++R++    D++L  S  E F   ++EAASC   I+
Sbjct: 255 HRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIV 306

Query: 274 LRDLDLYKVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQI 333
              +     +L       A +  + + +   QA    +  ++ KA + S  +     +  
Sbjct: 307 TTQVGGIPEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYD 363

Query: 334 WLD 336
           W+D
Sbjct: 364 WMD 366


>WCAI_ECOLI RecName: Full=Putative colanic acid biosynthesis
           glycosyl transferase wcaI;
          Length = 407

 Score = 44.3 bits (103), Expect = 2e-06
 Identities = 29/143 (20%), Positives = 68/143 (47%), Gaps = 5/143 (3%)

Query: 110 NRMEHLVVVNPMFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRTDLGLSDNQ 169
           + ++++  ++   +   +  G+  E V + PN+    ++  +   +V  LR  L L DN+
Sbjct: 172 HNVDNVSTISRSMMNKAIEKGVAAENVIFFPNWSEIARFQHVADADVDALRNQLDLPDNK 231

Query: 170 FIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGMTDGYEHYKKI-MENPPKNL 228
            I++ +G + +++G+++ I  A+ L     I    F+  G   G    +K+  +   +N+
Sbjct: 232 KIILYSGNIGEKQGLENVIEAADRLRDEPLI----FAIVGQGGGKARLEKMAQQRGLRNM 287

Query: 229 IFPGIVSPERMRELYALADLFLL 251
            F  + S + +  L  + D  L+
Sbjct: 288 QFFPLQSYDALPALLKMGDCHLV 310


>GPI3_SCHPO RecName: Full=Phosphatidylinositol
           N-acetylglucosaminyltransferase gpi3 subunit;       
           EC=2.4.1.198;AltName: Full=GlcNAc-PI synthesis protein;
          Length = 456

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 52/235 (22%), Positives = 96/235 (40%), Gaps = 25/235 (10%)

Query: 112 MEHLVVVNPMFIEDLVAAGIPREK-VTYIPNFVNKEKWHPLPQEEVVRLRTDLGLSDNQF 170
           + H++ V+    E+ V   +   K V+ IPN +  E + P P +           S +  
Sbjct: 142 VNHVICVSHTCRENTVLRAVLNPKRVSVIPNALVAENFQPDPSKA----------SKDFL 191

Query: 171 IVVGAGQVQKRKGIDDFI----RLAEELPQITFIWAGGFSFGGMTDGYEHYK-KIMENPP 225
            +V   ++   KGID  I    R+  + P++ F+ AG    G  +   E  + K M    
Sbjct: 192 TIVVISRLYYNKGIDLLIAVIPRICAQHPKVRFVIAGD---GPKSIDLEQMREKYMLQDR 248

Query: 226 KNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLYKVILE 285
             ++  G V  +++R++     ++L PS  E F   ++EAASC   ++   +     +L 
Sbjct: 249 VEML--GSVRHDQVRDVMVRGHIYLHPSLTEAFGTVLVEAASCGLYVISTKVGGVPEVLP 306

Query: 286 GNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEK 340
            +    A  EE   A        +V+ D  +        + E   +  W+D  E+
Sbjct: 307 SHMTRFARPEEDDLA----DTLSSVITDYLDHKIKTETFHEEVKQMYSWIDVAER 357


>Y2592_STRCO RecName: Full=Exopolysaccharide phosphotransferase
           SCO2592;         EC=2.7.-.-;AltName: Full=Stealth
           protein SCO2592;
          Length = 942

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 6/108 (5%)

Query: 237 ERMRELYALADLFLLPSYN-ELFPMTILEAASCEAPIMLRDL-----DLYKVILEGNYRA 290
           + M E +A A L +LPS + E FP+ +LEA +   P +  D+     ++ +   +G    
Sbjct: 274 QHMTEEWARASLTILPSQDGEAFPLVLLEAFAAGVPAVAYDIVTGPAEIIRHGEDGLLVP 333

Query: 291 TAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFY 338
               E + EAI     + A+L+   EKA   S  ++ + +++ W + +
Sbjct: 334 PNDVESLAEAISRLMGDEALLRSYGEKAHEGSTRFAADVIVKQWEELF 381


>LPCC_RHILV RecName: Full=Lipopolysaccharide core biosynthesis
           mannosyltransferase lpcC;         EC=2.4.-.-;
          Length = 352

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 15/146 (10%)

Query: 176 GQVQKRKGIDDFIR-LAEELPQITFIWAGGFSFGGMTDGYEHYKK------IMENPPKNL 228
           G+V+ +KG D F+R + E LPQ T  W    S G +T  +  +        +       +
Sbjct: 173 GRVRHQKGTDLFVRAMIELLPQHT-EWTAVVS-GRVTAEHVAFADKLKADVVAAGLSDRI 230

Query: 229 IFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLYKVIL---- 284
           +F G V    ++  Y    L++ PS NE F +T LEA +    ++  D   Y  ++    
Sbjct: 231 LFLGEVPD--IKIWYRRLTLYVAPSRNEGFGLTPLEAMASRTAVVASDAGAYAELIVTGE 288

Query: 285 EGNYRATAGREEMKEAILEYQANPAV 310
            G+  A +  E +  AI  Y A+PA+
Sbjct: 289 TGSVVAASDGEALTRAIAPYIADPAL 314


>COTSA_BACSU RecName: Full=Spore coat protein SA;       
           EC=2.4.-.-;
          Length = 377

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 37/152 (24%), Positives = 70/152 (46%), Gaps = 12/152 (7%)

Query: 133 REKVTYIPNFVNKEKWHPLPQEEVVR----LRTDLGLSDNQFIVVGAGQVQKRKGIDDFI 188
           R K   + + V+ + +HP    E  R    +R++LGL   + IV+  G++ K KG    +
Sbjct: 152 RSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKK-IVLFVGRLSKVKGPHILL 210

Query: 189 R----LAEELPQITFIWAGGFSFGG--MTDGYEHYKKIMENPPKNLIFPGIVSPERMREL 242
           +    + EE P +  ++ G   FG   + +  +H   +      ++ F   V P+ +  L
Sbjct: 211 QALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRL 270

Query: 243 YALADLFLLPS-YNELFPMTILEAASCEAPIM 273
           Y ++D+F+  S + E       EA +   PI+
Sbjct: 271 YTMSDVFVCSSQWQEPLARVHYEAMAAGLPII 302


>RFBU_SALTY RecName: Full=Protein rfbU;         EC=2.4.-.-;
          Length = 353

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 54/252 (21%), Positives = 111/252 (44%), Gaps = 37/252 (14%)

Query: 96  FLKGIVKRYVFSF-YNRMEHLVVVNPMFIEDLVAA--GIPREKVTYIPNFVNKEKWHPLP 152
           F++ +  R++      R +H++ V+   ++D +A    +  EK++ I N VNK  +    
Sbjct: 123 FIQKVYFRFLLKMSVKRCKHVLTVS-YTVKDSIAKTYNVDSEKISVIYNSVNKSDFIQKK 181

Query: 153 QEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSF---GG 209
           ++E            N F+ VGA      K I  FI+  +       +W+  ++     G
Sbjct: 182 EKE------------NYFLAVGASW--PHKNIHSFIKNKK-------VWSDSYNLIIVCG 220

Query: 210 MTD-GYEHYKKIMENPPKNLI-FPGIVSPERMRELYALADLFLLPSYNELFPMTILEAAS 267
            TD      + +++   K+ + F   VS   ++ LY+ A   + PS +E F +  +EA +
Sbjct: 221 RTDYAMSLQQMVVDLELKDKVTFLHEVSFNELKILYSKAYALVYPSIDEGFGIPPIEAMA 280

Query: 268 CEAPIMLRDLDLY-KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYS 326
              P+++ D+ ++ +V+  G        E+  ++ ++   N   L D   +  N    Y 
Sbjct: 281 SNTPVIVSDIPVFHEVLTNGALYVNPDDEKSWQSAIK---NIEQLPDAISRFNNYVARYD 337

Query: 327 EEHLLQI---WL 335
            +++ Q+   WL
Sbjct: 338 FDNMKQMVGNWL 349


>GLGA_AQUAE RecName: Full=Glycogen synthase;       
           EC=2.4.1.21;AltName: Full=Starch [bacterial glycogen]
           synthase;
          Length = 463

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 52/231 (22%), Positives = 95/231 (41%), Gaps = 31/231 (13%)

Query: 135 KVTYIPNFVNKEKWHPLPQEEVVR----------------LRTDLGLSDNQFIVVGAGQV 178
           K+  I N ++ E W+P   + + +                L  +LG+   + ++    + 
Sbjct: 234 KLRGILNGIDYEVWNPEKDKYIYQNYSLRNYSKKFKNKEFLSKELGIEAEKPLISFINRF 293

Query: 179 QKRKGIDDFIRLAEELPQITFIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVSPER 238
             +KG++  +  AEE+ ++       F F G T  YE+    +    KN       +   
Sbjct: 294 THQKGVELILNCAEEMSKLN----ANFVFLG-TGEYENAFLDVSKIYKNFKVFAEFNEGF 348

Query: 239 MRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDL----DLYKVILEGNYRATAGR 294
            R+LYA +D  L+PSY E   +T +         ++R      D  K I EG Y  T   
Sbjct: 349 ARKLYASSDFILMPSYFEPCGLTQMIGMRYGCVPIVRKTGGLRDTVKDISEGGYGITF-E 407

Query: 295 EEMKEAILEYQANPAVLKDLKEKAKN-----ISREYSEEHLLQIWLDFYEK 340
           E  KE  L        L +  +K +N     +S ++S + + + +++ YE+
Sbjct: 408 EPSKETFLCSLKRAIELYENAKKFRNSVKIVMSLDFSCDRMTKEYIECYEE 458


>GLGA2_GEOMG RecName: Full=Glycogen synthase 2;       
           EC=2.4.1.21;AltName: Full=Starch [bacterial glycogen]
           synthase 2;
          Length = 484

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 48/171 (28%), Positives = 78/171 (45%), Gaps = 31/171 (18%)

Query: 139 IPNFVNKEKWHPLPQEEVVR----------------LRTDLGLSDNQFI-VVG-AGQVQK 180
           I N ++ E+W+P     + R                L+ +LGL     I ++G  G++ +
Sbjct: 249 ILNGLDSEEWNPSLDRRIFRNYSSKSLAGKGADKRELQRELGLKAGASIPIIGMVGRIVE 308

Query: 181 RKGIDDFIRL-----AEELPQITFIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVS 235
           +KGID  I L     AEEL Q+  +  G      M   +E   K ++N   NL F   ++
Sbjct: 309 QKGIDLVIDLLPRFAAEEL-QLVILGTGDLRL--MHQLHEFRNKGVKNVSINLGFKEPLA 365

Query: 236 PERMRELYALADLFLLPSYNELFPMTILEAASC-EAPIMLRDLDLYKVILE 285
           P+    +YA  D+FL+PS  E   ++ L A S    PI+ R   L   +++
Sbjct: 366 PK----IYAGCDMFLMPSRFEPCGLSQLIALSYGTVPIVRRTGGLADTVID 412


>YC07_KLEPN RecName: Full=Uncharacterized 41.2 kDa protein in cps
           region;AltName: Full=ORF7;
          Length = 358

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 37/165 (22%), Positives = 79/165 (47%), Gaps = 20/165 (12%)

Query: 127 VAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLR--TDLGLSDNQFIVVGAGQVQKRKGI 184
           V AGI + K+  + N V+ +      QE++ R++   +  +   +  ++  G+  K+KG 
Sbjct: 152 VDAGISKNKIKVVYNAVSLDG-----QEKLERIKKCNENEVQKEKINILFVGRFDKQKGY 206

Query: 185 DDFIRLAE--ELPQITFIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVSPERMREL 242
           D  + + +  ++ + TF   G      + D +E  +K      +N+++ G V  + +   
Sbjct: 207 DYLLNVIKVADVSKYTFNIIGD----SVHDVFEKIEK------ENVVYYGWVDNKELPAY 256

Query: 243 YALADLFLLPSYNELFPMTILEAASCEAPIMLRDL-DLYKVILEG 286
           +   D+ L+PS  E F +  +EA     P++  ++  L +VI +G
Sbjct: 257 FCENDVLLMPSRWESFGLVAVEAQLYGVPVIANNVASLPEVISDG 301


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.324    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,927,995,210
Number of extensions: 411506039
Number of successful extensions: 1139860
Number of sequences better than 1.0e-03: 21927
Number of HSP's gapped: 1105827
Number of HSP's successfully gapped: 33605
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.1 bits)