BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACF55996.1 spne4 ACF55996.1 GIB00761CH01 "primosomal protein
N'"
         (798 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PRIA_BACSU RecName: Full=Primosomal protein N';         EC=3.6.1...   667   0.0  
PRIA_SYNY3 RecName: Full=Primosomal protein N';         EC=3.6.1...   483   e-138
PRIA_CHLPN RecName: Full=Primosomal protein N';         EC=3.6.1...   417   e-118
PRIA_CHLMU RecName: Full=Primosomal protein N';         EC=3.6.1...   384   e-108
PRIA_CHLTR RecName: Full=Primosomal protein N';         EC=3.6.1...   383   e-108
PRIA_ECOLI RecName: Full=Primosomal protein N';         EC=3.6.1...   383   e-108
PRIA_HAEIN RecName: Full=Primosomal protein N';         EC=3.6.1...   369   e-104
PRIA_TREPA RecName: Full=Primosomal protein N';         EC=3.6.1...   366   e-103
PRIA_RICBR RecName: Full=Primosomal protein N';         EC=3.6.1...   345   1e-96
PRIA_RICCN RecName: Full=Primosomal protein N';         EC=3.6.1...   343   3e-96
PRIA_RICTY RecName: Full=Primosomal protein N';         EC=3.6.1...   342   5e-96
PRIA_RICPR RecName: Full=Primosomal protein N';         EC=3.6.1...   336   5e-94
PRIA_RICFE RecName: Full=Primosomal protein N';         EC=3.6.1...   335   8e-94
PRIA_BORBU RecName: Full=Primosomal protein N';         EC=3.6.1...   315   9e-88
PRIA_THEMA RecName: Full=Primosomal protein N';         EC=3.6.1...   292   8e-81
PRIA_HELPY RecName: Full=Primosomal protein N';         EC=3.6.1...   276   4e-76
PRIA_HELPJ RecName: Full=Primosomal protein N';         EC=3.6.1...   273   5e-75
PRIA_RHORU RecName: Full=Primosomal protein N';         EC=3.6.1...   254   2e-69
PRIA_BUCAI RecName: Full=Primosomal protein N';         EC=3.6.1...   118   2e-28
PRIA_BUCAP RecName: Full=Primosomal protein N';         EC=3.6.1...   117   5e-28
PRIA_MYCLE RecName: Full=Putative primosomal protein N';        ...    84   3e-18
PRIA_MYCTU RecName: Full=Putative primosomal protein N';        ...    80   6e-17
PRIA_MYCBO RecName: Full=Putative primosomal protein N';        ...    80   6e-17
MFD_HELPJ RecName: Full=Transcription-repair-coupling factor;   ...    67   5e-13
MFD_HELPY RecName: Full=Transcription-repair-coupling factor;   ...    62   1e-11
MFD_ECOLI RecName: Full=Transcription-repair-coupling factor;   ...    60   7e-11
RECG_AQUAE RecName: Full=ATP-dependent DNA helicase recG;       ...    59   1e-10
RECG_STRPN RecName: Full=ATP-dependent DNA helicase recG;       ...    58   2e-10
MFD_STAHJ RecName: Full=Transcription-repair-coupling factor;   ...    58   3e-10
MFD_HAEIN RecName: Full=Transcription-repair-coupling factor;   ...    58   3e-10
MFD_SYNY3 RecName: Full=Transcription-repair-coupling factor;   ...    57   7e-10
RECG_MYCLE RecName: Full=ATP-dependent DNA helicase recG;       ...    56   9e-10
MFD_STAAW RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAS RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAR RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAN RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAM RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAC RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAAB RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;   ...    55   3e-09
COMFA_BACSU RecName: Full=ComF operon protein 1;         EC=3.6....    55   3e-09
MFD_STAS1 RecName: Full=Transcription-repair-coupling factor;   ...    54   4e-09
RECG_MYCTU RecName: Full=ATP-dependent DNA helicase recG;       ...    54   6e-09
RECG_MYCBO RecName: Full=ATP-dependent DNA helicase recG;       ...    54   6e-09
UVRB_CLOTE RecName: Full=UvrABC system protein B;         Short=...    52   1e-08
UVRB_CLAMS RecName: Full=UvrABC system protein B;         Short=...    52   1e-08
UVRB_CLAM3 RecName: Full=UvrABC system protein B;         Short=...    52   1e-08
RECG_BORBU RecName: Full=ATP-dependent DNA helicase recG;       ...    52   1e-08
MFD_STAES RecName: Full=Transcription-repair-coupling factor;   ...    52   1e-08
MFD_STAEQ RecName: Full=Transcription-repair-coupling factor;   ...    52   1e-08
UVRB_PROAC RecName: Full=UvrABC system protein B;         Short=...    52   2e-08
UVRB_DESVV RecName: Full=UvrABC system protein B;         Short=...    52   2e-08
UVRB_DESVH RecName: Full=UvrABC system protein B;         Short=...    52   2e-08
MFD_MYXXA RecName: Full=Transcription-repair-coupling factor;   ...    52   2e-08
UVRB_PELCD RecName: Full=UvrABC system protein B;         Short=...    51   3e-08
UVRB_CHLL2 RecName: Full=UvrABC system protein B;         Short=...    51   3e-08
UVRB_BACTN RecName: Full=UvrABC system protein B;         Short=...    51   4e-08
UVRB_BACFR RecName: Full=UvrABC system protein B;         Short=...    51   4e-08
UVRB_BACFN RecName: Full=UvrABC system protein B;         Short=...    51   4e-08
UVRB_LEGPL RecName: Full=UvrABC system protein B;         Short=...    50   5e-08
UVRB_LEGPH RecName: Full=UvrABC system protein B;         Short=...    50   5e-08
UVRB_LEGPC RecName: Full=UvrABC system protein B;         Short=...    50   5e-08
UVRB_LEGPA RecName: Full=UvrABC system protein B;         Short=...    50   5e-08
UVRB_CHLCH RecName: Full=UvrABC system protein B;         Short=...    50   5e-08
RECG_STAAW RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
RECG_STAAS RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
RECG_STAAN RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
RECG_STAAM RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
RECG_STAAC RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
RECG_STAA8 RecName: Full=ATP-dependent DNA helicase recG;       ...    50   5e-08
UVRB_THIDA RecName: Full=UvrABC system protein B;         Short=...    50   7e-08
UVRB_SHIFL RecName: Full=UvrABC system protein B;         Short=...    50   7e-08
UVRB_SHIF8 RecName: Full=UvrABC system protein B;         Short=...    50   7e-08
UVRB_DESVM RecName: Full=UvrABC system protein B;         Short=...    50   7e-08
UVRB_CHLPB RecName: Full=UvrABC system protein B;         Short=...    50   7e-08
MFD_BACSU RecName: Full=Transcription-repair-coupling factor;   ...    50   7e-08
UVRB_LACSS RecName: Full=UvrABC system protein B;         Short=...    50   9e-08
UVRB_YERPY RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPS RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPP RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPN RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPG RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPE RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPB RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERPA RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_YERP3 RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_THEYD RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_PASMU RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_NITEU RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_HAMD5 RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_FERNB RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_DESDG RecName: Full=UvrABC system protein B;         Short=...    49   1e-07
UVRB_METTH RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_MANSM RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
MFD_BORBU RecName: Full=Transcription-repair-coupling factor;   ...    49   2e-07
UVRB_SHISS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SHIDS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SHIBS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SHIB3 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALTY RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALTI RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALSV RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALPK RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALPC RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALPB RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALPA RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALNS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALHS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALG2 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALEP RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALDC RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALCH RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALAR RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_SALA4 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_KLEP7 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_KLEP3 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ESCF3 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ENT38 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOUT RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOSM RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOSE RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOLU RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOLI RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOLC RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOL6 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOL5 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOK1 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOHS RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECODH RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECOBW RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO8A RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO81 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO7I RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO5E RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO57 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO55 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO45 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO27 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_ECO24 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
UVRB_CITK8 RecName: Full=UvrABC system protein B;         Short=...    49   2e-07
RECG_STAES RecName: Full=ATP-dependent DNA helicase recG;       ...    49   2e-07
RECG_STAAR RecName: Full=ATP-dependent DNA helicase recG;       ...    49   2e-07
UVRB_PECCP RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_ERWCT RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_DECAR RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_COLP3 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_AZOSE RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
MFD_BUCAI RecName: Full=Transcription-repair-coupling factor;   ...    48   3e-07
UVRB_YERE8 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_VIBF1 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_SERP5 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_PROMH RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_PHOLL RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_MYCA5 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_HAEIN RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_HAEI8 RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVRB_GEOSL RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
UVB2_MYCPU RecName: Full=UvrABC system protein B;         Short=...    48   3e-07
RECG_PASMU RecName: Full=ATP-dependent DNA helicase recG;       ...    48   3e-07
DBP3_YARLI RecName: Full=ATP-dependent RNA helicase DBP3;       ...    48   3e-07
UVRB_VIBVY RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_VIBVU RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_VIBPA RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_THEAB RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_IDILO RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_HERA2 RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_COXBU RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_COXBR RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_COXBN RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_COXB2 RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_CHLPD RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_CARHZ RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_BORPD RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
UVRB_AQUAE RecName: Full=UvrABC system protein B;         Short=...    47   4e-07
DBP5_ASPFU RecName: Full=ATP-dependent RNA helicase dbp5;       ...    47   4e-07
UVRB_SYNY3 RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_NATTJ RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_FUSNN RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_EDWI9 RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOBM RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOBL RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOBK RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOBJ RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOB6 RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOB1 RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CLOAB RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CHRVO RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_CAMFF RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_BORA1 RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
UVRB_ALISL RecName: Full=UvrABC system protein B;         Short=...    47   6e-07
RHLB_ACTSZ RecName: Full=ATP-dependent RNA helicase rhlB;       ...    47   6e-07
RECG_STAEQ RecName: Full=ATP-dependent DNA helicase recG;       ...    47   6e-07
DBP5_NEOFI RecName: Full=ATP-dependent RNA helicase dbp5;       ...    47   6e-07
UVRB_PSEPK RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_PSEPF RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_PSEF5 RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_PHOPR RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_PARUW RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_METST RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_GLOVI RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_COXB1 RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_CLOPS RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_CLOPE RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
UVRB_CLOP1 RecName: Full=UvrABC system protein B;         Short=...    47   8e-07
RECG_HAEIN RecName: Full=ATP-dependent DNA helicase recG;       ...    47   8e-07
UVRB_THEEB RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_HELHP RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_DEHE1 RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_CYAP7 RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_THICR RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_PSYIN RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_NITOC RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_METS3 RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_ERWT9 RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_ENTFA RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_BORPE RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_BORPA RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_BORBR RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
UVRB_ACTP2 RecName: Full=UvrABC system protein B;         Short=...    46   1e-06
RECG_TREPA RecName: Full=ATP-dependent DNA helicase recG;       ...    46   1e-06
UVRB_PSEAE RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_MYCGE RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_KOSOT RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_CYAP4 RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_ACIAD RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_TROW8 RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_STRCO RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_NEIMB RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_NEIMA RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_NEIGO RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_NEIG1 RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_LACPL RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_CLOBB RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_CLOBA RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
UVRB_CHLTE RecName: Full=UvrABC system protein B;         Short=...    45   2e-06
RHLB_VIBHB RecName: Full=ATP-dependent RNA helicase rhlB;       ...    45   2e-06
UVRB_THET8 RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_STRAW RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_RALSO RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_RALEJ RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_METMP RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_LEPBL RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_LEPBJ RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_LACAC RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_BORGA RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_BORAP RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
UVRB_ANASP RecName: Full=UvrABC system protein B;         Short=...    45   3e-06
RHLB_ALISL RecName: Full=ATP-dependent RNA helicase rhlB;       ...    45   3e-06
RECG_BACSU RecName: Full=ATP-dependent DNA helicase recG;       ...    45   3e-06
DED1_MAGGR RecName: Full=ATP-dependent RNA helicase DED1;       ...    45   3e-06
DED1_KLULA RecName: Full=ATP-dependent RNA helicase DED1;       ...    45   3e-06
UVRB_TREDE RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_SYNJB RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_PSEU2 RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_PSESM RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_PSEHT RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_PSE14 RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_METBU RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_LEPIN RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_LEPIC RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_GEMAT RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_EUBR3 RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_CLOB8 RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_BORBZ RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_BORBU RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_ACAM1 RecName: Full=UvrABC system protein B;         Short=...    44   4e-06
UVRB_THETN RecName: Full=UvrABC system protein B;         Short=...    44   5e-06
UVRB_GEOKA RecName: Full=UvrABC system protein B;         Short=...    44   5e-06
UVRB_BURPS RecName: Full=UvrABC system protein B;         Short=...    44   5e-06
UVRB_BURMA RecName: Full=UvrABC system protein B;         Short=...    44   5e-06
UVRB_BACCA RecName: Full=UvrABC system protein B;         Short=...    44   5e-06
RHLB_VIBPA RecName: Full=ATP-dependent RNA helicase rhlB;       ...    44   5e-06
UVRB_WOLSU RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_THELT RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_SYMTH RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_MYCUA RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_MYCPU RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_LACCB RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_LACC3 RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_CALS8 RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_BACCR RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
UVRB_ANATD RecName: Full=UvrABC system protein B;         Short=...    44   6e-06
RHLB_VIBSL RecName: Full=ATP-dependent RNA helicase rhlB;       ...    44   6e-06
PRP28_MAGGR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    44   6e-06
UVRB_XYLFT RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_XYLFM RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_XYLFA RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_XYLF2 RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_TREPS RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_TREPA RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_SYNP6 RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_SYNJA RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_SYNE7 RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_OCEIH RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_CORDI RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACLD RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACHK RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACCZ RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACC1 RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACAN RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
UVRB_BACA2 RecName: Full=UvrABC system protein B;         Short=...    43   8e-06
DED1_LODEL RecName: Full=ATP-dependent RNA helicase DED1;       ...    43   8e-06
DBP2_CHAGB RecName: Full=ATP-dependent RNA helicase DBP2;       ...    43   8e-06
DBP1_YEAST RecName: Full=ATP-dependent RNA helicase DBP1;       ...    43   8e-06
DBP1_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP1;       ...    43   8e-06
UVRB_THEFY RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_STRZT RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_NATPD RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_METCA RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_HALMA RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_DEHSC RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_CYTH3 RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_CLONN RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_CHLAB RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
UVRB_AYWBP RecName: Full=UvrABC system protein B;         Short=...    43   1e-05
RHLB_VIBCM RecName: Full=ATP-dependent RNA helicase rhlB;       ...    43   1e-05
RHLB_VIBCH RecName: Full=ATP-dependent RNA helicase rhlB;       ...    43   1e-05
RHLB_VIBC3 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    43   1e-05
RHLB_MANSM RecName: Full=ATP-dependent RNA helicase rhlB;       ...    43   1e-05
DED1_EMENI RecName: Full=ATP-dependent RNA helicase ded1;       ...    43   1e-05
DED1_ASPOR RecName: Full=ATP-dependent RNA helicase ded1;       ...    43   1e-05
DED1_ASPNC RecName: Full=ATP-dependent RNA helicase ded1;       ...    43   1e-05
DBP5_ASPTN RecName: Full=ATP-dependent RNA helicase dbp5;       ...    43   1e-05
DBP1_CANGA RecName: Full=ATP-dependent RNA helicase DBP1;       ...    43   1e-05
UVRB_STRZP RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRZJ RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRR6 RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRPS RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRPN RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRPJ RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRPI RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRP7 RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRP4 RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_STRP2 RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_MYCTU RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_MYCPN RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_MYCLE RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_MYCBO RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_METAC RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_LISMO RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_LISMF RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_LISIN RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_HELPY RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_HAEDU RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_CHLAD RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
UVRB_BIFLI RecName: Full=UvrABC system protein B;         Short=...    42   1e-05
DED1_SCLS1 RecName: Full=ATP-dependent RNA helicase ded1;       ...    42   1e-05
DED1_NEOFI RecName: Full=ATP-dependent RNA helicase ded1;       ...    42   1e-05
DED1_CANGA RecName: Full=ATP-dependent RNA helicase DED1;       ...    42   1e-05
DED1_ASPFU RecName: Full=ATP-dependent RNA helicase ded1;       ...    42   1e-05
DED1_AJECN RecName: Full=ATP-dependent RNA helicase DED1;       ...    42   1e-05
DBP5_ASPNC RecName: Full=ATP-dependent RNA helicase dbp5;       ...    42   1e-05
UVRB_XANOR RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANOP RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANOM RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANCP RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANCB RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANC8 RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_XANAC RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_SYNPX RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_SYNPW RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAHJ RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_RHOBA RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_PROMP RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_PROM0 RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_HALSA RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_CHLTR RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_CHLTA RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_CHLCV RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
RH25_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 25;...    42   2e-05
PRP28_SCHPO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    42   2e-05
DED1_NEUCR RecName: Full=ATP-dependent RNA helicase ded-1;      ...    42   2e-05
DED1_COCIM RecName: Full=ATP-dependent RNA helicase DED1;       ...    42   2e-05
DED1_ASPTN RecName: Full=ATP-dependent RNA helicase ded1;       ...    42   2e-05
UVRB_STRU0 RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STRTD RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STRT2 RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STRT1 RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAW RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAS RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAR RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAN RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAM RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_STAAC RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_CHLPN RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_BIFLO RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_BACSU RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
UVRB_ANAPZ RecName: Full=UvrABC system protein B;         Short=...    42   2e-05
RHLB_VIBVY RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RHLB_VIBVU RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RHLB_VIBFM RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RHLB_VIBF1 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RHLB_SHIF8 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RHLB_PHOPR RecName: Full=ATP-dependent RNA helicase rhlB;       ...    42   2e-05
RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53;...    42   2e-05
DED1_USTMA RecName: Full=ATP-dependent RNA helicase DED1;       ...    42   2e-05
DED1_PHANO RecName: Full=ATP-dependent RNA helicase DED1;       ...    42   2e-05
DBP3_PICGU RecName: Full=ATP-dependent RNA helicase DBP3;       ...    42   2e-05
DBP2_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-2;      ...    42   2e-05
UVRB_STAES RecName: Full=UvrABC system protein B;         Short=...    41   3e-05
UVRB_STAEQ RecName: Full=UvrABC system protein B;         Short=...    41   3e-05
UVRB_HELAH RecName: Full=UvrABC system protein B;         Short=...    41   3e-05
UVRB_BACHD RecName: Full=UvrABC system protein B;         Short=...    41   3e-05
RHLB_SALTY RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALTI RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALSV RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALPK RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALPC RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALPB RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALNS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALHS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALG2 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALEP RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALDC RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALCH RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALAR RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_SALA4 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
RHLB_ERWT9 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   3e-05
MFD_MYCTU RecName: Full=Transcription-repair-coupling factor;   ...    41   3e-05
MFD_MYCBO RecName: Full=Transcription-repair-coupling factor;   ...    41   3e-05
DED1_SCHPO RecName: Full=ATP-dependent RNA helicase ded1;       ...    41   3e-05
DED1_CHAGB RecName: Full=ATP-dependent RNA helicase DED1;       ...    41   3e-05
DBP5_EMENI RecName: Full=ATP-dependent RNA helicase dbp5;       ...    41   3e-05
DBP5_ASPOR RecName: Full=ATP-dependent RNA helicase dbp5;       ...    41   3e-05
DBP2_GIBZE RecName: Full=ATP-dependent RNA helicase DBP2;       ...    41   3e-05
UVRB_SYNS3 RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_PROMM RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_PROMA RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_PROM3 RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_LACLS RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_LACLM RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_LACLA RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_LACBA RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_HELPJ RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
UVRB_HELPH RecName: Full=UvrABC system protein B;         Short=...    41   4e-05
RHLB_SHISS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_SHIFL RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_SHIDS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_SHIBS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_SHIB3 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_KLEP3 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_HAES1 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ESCF3 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ENTS8 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOUT RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOSM RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOSE RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOLU RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOLI RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOLC RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOL6 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOL5 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOK1 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOHS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECODH RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECOBW RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO8A RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO81 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO7I RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO5E RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO55 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO45 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO27 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
RHLB_ECO24 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    41   4e-05
PRP5_PHANO RecName: Full=Pre-mRNA-processing ATP-dependent RNA h...    41   4e-05
DED1_ASHGO RecName: Full=ATP-dependent RNA helicase DED1;       ...    41   4e-05
DBP5_ASPCL RecName: Full=ATP-dependent RNA helicase dbp5;       ...    41   4e-05
DBP2_MAGGR RecName: Full=ATP-dependent RNA helicase DBP2;       ...    41   4e-05
UVRB_STRMU RecName: Full=UvrABC system protein B;         Short=...    40   5e-05
UVRB_MYCMS RecName: Full=UvrABC system protein B;         Short=...    40   5e-05
UVRB_METMA RecName: Full=UvrABC system protein B;         Short=...    40   5e-05
UVRB_CAMHC RecName: Full=UvrABC system protein B;         Short=...    40   5e-05
RHLB_HAES2 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   5e-05
RHLB_HAEIN RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   5e-05
RHLB_HAEIG RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   5e-05
RHLB_HAEIE RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   5e-05
RHLB_CITK8 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   5e-05
RECG_SYNY3 RecName: Full=ATP-dependent DNA helicase recG;       ...    40   5e-05
DED1_YARLI RecName: Full=ATP-dependent RNA helicase DED1;       ...    40   5e-05
UVRB_STRSV RecName: Full=UvrABC system protein B;         Short=...    40   7e-05
UVRB_STRGC RecName: Full=UvrABC system protein B;         Short=...    40   7e-05
UVRB_MYCMO RecName: Full=UvrABC system protein B;         Short=...    40   7e-05
UVRB_LEIXX RecName: Full=UvrABC system protein B;         Short=...    40   7e-05
PRP28_NEUCR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    40   7e-05
DED1_ASPCL RecName: Full=ATP-dependent RNA helicase ded1;       ...    40   7e-05
UVRB_ZYMMO RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRS7 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRS2 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPZ RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPM RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPG RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPD RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPC RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRPB RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRP8 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRP6 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRP3 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRP1 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STREM RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRE4 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRA5 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRA3 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_STRA1 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_PROMT RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_PROM1 RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_MICLC RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
UVRB_BACSK RecName: Full=UvrABC system protein B;         Short=...    40   9e-05
RHLB_ECO57 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    40   9e-05
DED1_BOTFB RecName: Full=ATP-dependent RNA helicase ded1;       ...    40   9e-05
UVRB_STRPF RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_STAS1 RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_RICAE RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_PROM4 RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_MYCPE RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_MICAN RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
UVRB_FRATT RecName: Full=UvrABC system protein B;         Short=...    39   1e-04
ROK1_NEOFI RecName: Full=ATP-dependent RNA helicase rok1;       ...    39   1e-04
ROK1_ASPFU RecName: Full=ATP-dependent RNA helicase rok1;       ...    39   1e-04
RHLB_SERP5 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   1e-04
RHLB_PHOLL RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   1e-04
RHLB_KLEP7 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   1e-04
RHLB_AERHH RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   1e-04
RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3;  ...    39   1e-04
PRP28_ASPOR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    39   1e-04
DDX47_DICDI RecName: Full=Probable ATP-dependent RNA helicase dd...    39   1e-04
DBP5_CHAGB RecName: Full=ATP-dependent RNA helicase DBP5;       ...    39   1e-04
DBP3_GIBZE RecName: Full=ATP-dependent RNA helicase DBP3;       ...    39   1e-04
UVRB_ONYPE RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_CAMJR RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_CAMJE RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_ANAMM RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_ANAMF RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
SPB4_DEBHA RecName: Full=ATP-dependent rRNA helicase SPB4;      ...    39   2e-04
RHLB_ENT38 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_AERS4 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RECG_ECOLI RecName: Full=ATP-dependent DNA helicase recG;       ...    39   2e-04
PRP28_COCIM RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    39   2e-04
I4A3A_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-A;...    39   2e-04
DCL2_ASPOR RecName: Full=Dicer-like protein 2;Includes:  RecName...    39   2e-04
DBP5_CANGA RecName: Full=ATP-dependent RNA helicase DBP5;       ...    39   2e-04
DBP2_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp2;       ...    39   2e-04
DBP2_BOTFB RecName: Full=ATP-dependent RNA helicase dbp2;       ...    39   2e-04
UVRB_RICRS RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_RICRO RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_RICPU RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_RICCN RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_LEPBP RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_LEPBA RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_LACJO RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_LACGA RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
UVRB_BEUC1 RecName: Full=UvrABC system protein B;         Short=...    39   2e-04
RRP3_CHAGB RecName: Full=ATP-dependent rRNA helicase RRP3;      ...    39   2e-04
ROK1_ASPNC RecName: Full=ATP-dependent RNA helicase rok1;       ...    39   2e-04
RHLB_YERPY RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPS RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPP RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPN RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPE RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPB RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERPA RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RHLB_YERP3 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    39   2e-04
RH47A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47...    39   2e-04
RH31_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 31;...    39   2e-04
PRP28_GIBZE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    39   2e-04
IF4A3_XENTR RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_TAEGU RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_SALSA RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_RAT RecName: Full=Eukaryotic initiation factor 4A-III;    ...    39   2e-04
IF4A3_PIG RecName: Full=Eukaryotic initiation factor 4A-III;    ...    39   2e-04
IF4A3_MOUSE RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_MACFA RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_HUMAN RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_CHICK RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
IF4A3_BOVIN RecName: Full=Eukaryotic initiation factor 4A-III;  ...    39   2e-04
I4A3B_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-B;...    39   2e-04
DED1_PICGU RecName: Full=ATP-dependent RNA helicase DED1;       ...    39   2e-04
DED1_GIBZE RecName: Full=ATP-dependent RNA helicase DED1;       ...    39   2e-04
DED1_DEBHA RecName: Full=ATP-dependent RNA helicase DED1;       ...    39   2e-04
DED1_CRYNE RecName: Full=ATP-dependent RNA helicase ded1;       ...    39   2e-04
DBP5_PICST RecName: Full=ATP-dependent RNA helicase DBP5;       ...    39   2e-04
UVRB_WOLTR RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
UVRB_CHLMU RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
UVRB_ARTCA RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
ROK1_ASPOR RecName: Full=ATP-dependent RNA helicase rok1;       ...    38   3e-04
RHLB_PROMH RecName: Full=ATP-dependent RNA helicase rhlB;       ...    38   3e-04
RHLB_HAMD5 RecName: Full=ATP-dependent RNA helicase rhlB;       ...    38   3e-04
RECG_ECO57 RecName: Full=ATP-dependent DNA helicase recG;       ...    38   3e-04
PRP28_ASPTN RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    38   3e-04
PRP28_ASPNC RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    38   3e-04
MFD_BUCBP RecName: Full=Transcription-repair-coupling factor;   ...    38   3e-04
DBP5_PHANO RecName: Full=ATP-dependent RNA helicase DBP5;       ...    38   3e-04
DBP3_CRYNE RecName: Full=ATP-dependent RNA helicase DBP3;       ...    38   3e-04
UVRB_RICAH RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
UVRB_ARTS2 RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
UVRB_ARTAT RecName: Full=UvrABC system protein B;         Short=...    38   3e-04
ROK1_COCIM RecName: Full=ATP-dependent RNA helicase ROK1;       ...    38   3e-04
ROK1_ASPCL RecName: Full=ATP-dependent RNA helicase rok1;       ...    38   3e-04
RHLB_PECCP RecName: Full=ATP-dependent RNA helicase rhlB;       ...    38   3e-04
RHLB_PASMU RecName: Full=ATP-dependent RNA helicase rhlB;       ...    38   3e-04
RHLB_ERWCT RecName: Full=ATP-dependent RNA helicase rhlB;       ...    38   3e-04
PRP28_EMENI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    38   3e-04
PRP28_CANAL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    38   3e-04
PRP28_ASPCL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    38   3e-04
DCL2_EMENI RecName: Full=Dicer-like protein 2;Includes:  RecName...    38   3e-04
DBP5_YEAST RecName: Full=ATP-dependent RNA helicase DBP5;       ...    38   3e-04
DBP5_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP5;       ...    38   3e-04
DBP5_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-5;      ...    38   3e-04
UVRB_RICPR RecName: Full=UvrABC system protein B;         Short=...    37   5e-04
SPB42_CANAL RecName: Full=ATP-dependent rRNA helicase SPB42;    ...    37   5e-04
SPB41_CANAL RecName: Full=ATP-dependent rRNA helicase SPB41;    ...    37   5e-04
RHLB_SODGM RecName: Full=ATP-dependent RNA helicase rhlB;       ...    37   5e-04
PRP28_NEOFI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    37   5e-04
PRP28_DEBHA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    37   5e-04
PRP28_ASPFU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    37   5e-04
MS116_SCHPO RecName: Full=ATP-dependent RNA helicase mss116, mit...    37   5e-04
DDX23_PONAB RecName: Full=Probable ATP-dependent RNA helicase DD...    37   5e-04
DDX23_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DD...    37   5e-04
DBP3_SCHPO RecName: Full=ATP-dependent RNA helicase dbp3;       ...    37   5e-04
DBP3_LODEL RecName: Full=ATP-dependent RNA helicase DBP3;       ...    37   5e-04
UVRB_RICTY RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
UVRB_RICM5 RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
UVRB_RICFE RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
UVRB_RICBR RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
UVRB_RICB8 RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
UVRB_RENSM RecName: Full=UvrABC system protein B;         Short=...    37   6e-04
RRP3_BOTFB RecName: Full=ATP-dependent rRNA helicase rrp3;      ...    37   6e-04
RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52...    37   6e-04
DEAD_BUCBP RecName: Full=Cold-shock DEAD box protein A homolog; ...    37   6e-04
DDX4_RANLE RecName: Full=Probable ATP-dependent RNA helicase DDX...    37   6e-04
DCL4_ARATH RecName: Full=Dicer-like protein 4;         EC=3.1.26.-;    37   6e-04
DCL2_MAGGR RecName: Full=Dicer-like protein 2;Includes:  RecName...    37   6e-04
DCL22_ASPNC RecName: Full=Dicer-like protein 2-2;Includes:  RecN...    37   6e-04
DBP5_MAGGR RecName: Full=ATP-dependent RNA helicase DBP5;       ...    37   6e-04
DBP5_CRYNE RecName: Full=ATP-dependent RNA helicase DBP5;       ...    37   6e-04
DBP4_ASPCL RecName: Full=ATP-dependent RNA helicase dbp4;       ...    37   6e-04
DBP3_PICST RecName: Full=ATP-dependent RNA helicase DBP3;       ...    37   6e-04
DBP2_ASPFU RecName: Full=ATP-dependent RNA helicase dbp2;       ...    37   6e-04
SKI2_YEAST RecName: Full=Antiviral helicase SKI2;         EC=3.6...    37   8e-04
ROK1_EMENI RecName: Full=ATP-dependent RNA helicase rok1;       ...    37   8e-04
RH47B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47...    37   8e-04
RH26_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 26;...    37   8e-04
PRP5_YEAST RecName: Full=Pre-mRNA-processing ATP-dependent RNA h...    37   8e-04
PRP5_YEAS7 RecName: Full=Pre-mRNA-processing ATP-dependent RNA h...    37   8e-04
PRP28_CRYNE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    37   8e-04
PRP28_CANGA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA he...    37   8e-04
MS116_PHANO RecName: Full=ATP-dependent RNA helicase MSS116, mit...    37   8e-04
IF4A_DICDI RecName: Full=Eukaryotic initiation factor 4A;       ...    37   8e-04
DBP4_ASHGO RecName: Full=ATP-dependent RNA helicase DBP4;       ...    37   8e-04
DBP3_VANPO RecName: Full=ATP-dependent RNA helicase DBP3;       ...    37   8e-04
DBP2_NEOFI RecName: Full=ATP-dependent RNA helicase dbp2;       ...    37   8e-04
DBP2_ASPOR RecName: Full=ATP-dependent RNA helicase dbp2;       ...    37   8e-04
DBP2_ASPNC RecName: Full=ATP-dependent RNA helicase dbp2;       ...    37   8e-04
DBP2_ASPCL RecName: Full=ATP-dependent RNA helicase dbp2;       ...    37   8e-04

>PRIA_BACSU RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 805

 Score =  667 bits (1722), Expect = 0.0
 Identities = 360/810 (44%), Positives = 504/810 (62%), Gaps = 17/810 (2%)

Query: 1   MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSD 60
           M  A++IVDV     D+P+ Y+IP+  +GM++ GMRV VPFG   R IQG V  ++  SD
Sbjct: 1   MNFAEVIVDVSTKNIDRPFDYKIPDHLKGMIKTGMRVIVPFGP--RKIQGFVTAVKEASD 58

Query: 61  GEEMEQDLKDIAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKIL 120
                + +K++ ++LD +PVLT E + L+  L     S+KI+ L+AMLP           
Sbjct: 59  LSG--KSVKEVEDLLDLTPVLTEELMILSSWLSDKTLSFKITALQAMLPXXXXXXXXXXX 116

Query: 121 YPLEGLSQEERV-RLFGSEDSLAFSSLDLGKQAEMM-RLTRKGLLGLEYQAVDQKKVKTQ 178
               G     +V RLF    +L +S +   +  +++ R  +KG + + Y+   +   K  
Sbjct: 117 XXXHGADLPPQVERLFSETKTLLYSDIPDHETLKLIQRHVQKGDIDVTYKVAQKTNKKMV 176

Query: 179 SWYEVDHAQLEGVE----ISTRAKKKLELRDYXXXXXXXXXXXXXXXXY----SREQVNF 230
              + + ++ E  +    +S +A K+  +  +                     S   +  
Sbjct: 177 RHIQANASKEELAKQAEGLSRQAAKQQAILHFLISEPEGVKIPAAELCKKTDTSSATIKT 236

Query: 231 FVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPP-FLLQGI 289
            + +G +    +EV R     +  + + PL L  EQR A + +  ++ S +   FLL G+
Sbjct: 237 LIQKGLLKESYEEVYRDPYQDKMFKKTEPLPLTDEQRAAFEPIRETLDSDEHKVFLLHGV 296

Query: 290 TGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEK 349
           TGSGKTE+YLQ I+  L KGK AI+LVPEISLTPQM  RF  RFG +VA++HSGLS GEK
Sbjct: 297 TGSGKTEIYLQSIEKVLAKGKEAIVLVPEISLTPQMVNRFKGRFGSQVAVMHSGLSTGEK 356

Query: 350 YDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRA 409
           YDEWRK+ R + ++VVGARSAIFAP +NLG++IIDEEHE++YKQ+  PRYHA+EVAI RA
Sbjct: 357 YDEWRKIHRKEVRLVVGARSAIFAPFENLGMIIIDEEHESSYKQEEMPRYHAKEVAIKRA 416

Query: 410 QYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETS 469
           +++   +VLGSATP+LES ARA KGVY+ L L  R N    +PEV ++D R+ +     S
Sbjct: 417 EHHSCPVVLGSATPTLESYARAQKGVYELLSLKHRVNH-RVMPEVSLVDMREELRNGNRS 475

Query: 470 NFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTM 529
            F+  L+E +++ + K EQ VL LN+RGYSSFVMCR+CG V  CP+CDIS+T H   + +
Sbjct: 476 MFSVELMEKLEETIAKGEQAVLFLNKRGYSSFVMCRDCGYVPQCPHCDISMTYHRYGQRL 535

Query: 530 NCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSH 589
            CHYCG  + +P  CP C S  IR++GTGTQ+  +EL ++ P AR++RMDVDTT +KG+H
Sbjct: 536 KCHYCGHEEPVPHTCPECASEHIRFFGTGTQRVEEELTKVLPSARVIRMDVDTTSRKGAH 595

Query: 590 QALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQV 649
           + LL  FG G+ADILLGTQMIAKGLDFPNVTLVGVL+ADT L++PDFRS+E+TFQLLTQV
Sbjct: 596 EKLLSAFGEGKADILLGTQMIAKGLDFPNVTLVGVLSADTTLHIPDFRSAEKTFQLLTQV 655

Query: 650 AGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITL 709
           +GRAGR EK G V+IQ+Y   HY+I+  K  DYE FY +EM  RR+  YPPYY+   +T+
Sbjct: 656 SGRAGRHEKPGHVIIQTYTPSHYSIQLTKTHDYETFYQHEMAHRREQSYPPYYYLALVTV 715

Query: 710 SHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGP 769
           SH              + L++     + ILGP+  PIAR  + Y YQ +IKY+ E +L  
Sbjct: 716 SHXXXXXXXXXXXXXXHFLKANCGADTKILGPSASPIARIKDRYRYQCVIKYKQETQLSA 775

Query: 770 TLNQVLA-LTQERENSELRLSIDHEPQQFL 798
            L ++L    +E E   + +SID  P   +
Sbjct: 776 LLKKILEHYKREIEQKHVMISIDMNPYMMM 805


>PRIA_SYNY3 RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 831

 Score =  483 bits (1244), Expect = e-138
 Identities = 314/789 (39%), Positives = 432/789 (54%), Gaps = 46/789 (5%)

Query: 4   AKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEE 63
           A ++VD+P  Q +  Y+Y IP      ++ G  V VPFG  N+ + GIV+G  ++   + 
Sbjct: 25  AAVLVDLP--QNEGVYTYAIPPGLT--VQDGDIVAVPFG--NQQLGGIVVGCLTKLPPDL 78

Query: 64  MEQDLKDIAEVLD---FSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKIL 120
             + +K I +V+    F+P       WLAE     + +    I  A+ PG L  S  +I 
Sbjct: 79  PPEKIKPIQDVIVSGFFAPHYWRLLHWLAEYYCTELITV---IRMALPPGLLQRSQRRI- 134

Query: 121 YPLEGLSQEERVRLFGSEDS-----LAFSSLDLGKQAEMM-RLTRKGLLGLEYQAVDQ-K 173
             L G        LF S+ S        + L   K+ +   R  R+ + GL     D  K
Sbjct: 135 -KLNGDRLPSDWPLFLSQPSHQGARQILTLLQSSKEGDYSYRYLRQKVPGLTKALRDLLK 193

Query: 174 KVKTQSWYEVDHA---QLEGVEISTRAKKKLELRDYXXXXXXXXXXXXXXXXY------- 223
           +   +S+ E   A   QL  +          +L +                         
Sbjct: 194 RQWVESYLEPPKAVQPQLPKMVTLLNFDPSFKLTELQARTLIVLKNQGGEMWLADLLKAV 253

Query: 224 --SREQVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQ 281
             S   +     +G V I ++E  R       I AS+  EL P Q+QA   V+   G  Q
Sbjct: 254 PCSASTIQSLAKKGLVAIAEREKLRLFQQ-PSINASQAPELTPAQKQACQTVLPLQGYHQ 312

Query: 282 PPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILH 341
              LL G+TGSGKTEVYLQI    L KG++ ++LVPEI LTPQ+T+RF ARFG+KVA+ H
Sbjct: 313 --VLLHGVTGSGKTEVYLQICGDRLGKGQSVLVLVPEIGLTPQLTDRFRARFGNKVAVYH 370

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDS-NPRYH 400
           SGLS+GEKYD WR+   G  Q+V+G RSAIF PL NLG++I+DEEH++++KQ    P YH
Sbjct: 371 SGLSSGEKYDTWRQTLLGHEQIVIGTRSAIFTPLPNLGLIILDEEHDSSFKQTQLTPNYH 430

Query: 401 AREVAILRAQYNQATLVLGSATPSLES----RARAGKGVYQHLRLTQRANPLATIPEVQV 456
           AR VA  RA+  Q  L+LGSATPSLES              +L L +R      +P VQ+
Sbjct: 431 ARTVAQRRAELEQCPLILGSATPSLESWHTVHRHQNDPQRHYLELPERVQS-RPLPPVQI 489

Query: 457 IDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNC 516
           +D R  + Q   S F+  L  A+ +   K++Q +L +NRRG+S+FV CR CG V  CPNC
Sbjct: 490 VDMRAELKQGNRSIFSRALQTALGELKAKQQQGILFINRRGHSTFVSCRSCGYVLECPNC 549

Query: 517 DISLTLHM----DTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQ 572
           D+SL+ H         + CHYC  ++  P+VCP C S  ++++G+GTQK  + L + FP 
Sbjct: 550 DVSLSYHYVQGNGQPLLRCHYCNHAEIQPKVCPECSSPYLKFFGSGTQKVTEALTQEFPD 609

Query: 573 ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALN 632
            R +R D DTTR+KG+H+ALLDQF RGEAD+L+GTQM+ KGLD   +TLVGV+ AD+ LN
Sbjct: 610 LRWIRFDSDTTRRKGAHRALLDQFQRGEADLLVGTQMLTKGLDLAQITLVGVVAADSLLN 669

Query: 633 LPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGI 692
             D+RS+ER FQ LTQV+GRAGR E+ GQV+IQ+Y  +H  I+  K  +Y GF A E+  
Sbjct: 670 FADYRSAERGFQTLTQVSGRAGRGEEPGQVIIQTYTPRHPVIQAVKTHNYHGFIAQELPQ 729

Query: 693 RRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNL 752
           R  L YPPY   I +      E EV K    +  +    L +T  ILGP P  I R    
Sbjct: 730 REMLNYPPYGKLILLRCLGTNEREVEKTIQAIAVLCEQLLPKTVEILGPAPASILRIAQR 789

Query: 753 YHYQILIKY 761
           Y +Q+L+KY
Sbjct: 790 YRWQLLVKY 798


>PRIA_CHLPN RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 749

 Score =  417 bits (1072), Expect = e-118
 Identities = 228/507 (44%), Positives = 320/507 (63%), Gaps = 6/507 (1%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQ-PPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P +L+PEQ+ A D + SS+ +SQ    LL GITGSGKTE+YL+    AL +GK+ ILLVP
Sbjct: 207 PKDLHPEQQSAIDKIFSSLKTSQFHTHLLFGITGSGKTEIYLRATSEALKQGKSTILLVP 266

Query: 318 EISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKN 377
           EI+LT Q    F ARFG  V +LH  LS+ +K   WR+   G  ++++G RSA+F P+KN
Sbjct: 267 EIALTVQTVSLFKARFGKDVGVLHHKLSDSDKSRTWRQASEGSLRILIGPRSALFCPMKN 326

Query: 378 LGVMIIDEEHEAAYKQ-DSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVY 436
           LG++I+DEEH+ AYKQ +S P YHAR+VA++R +   AT+VLGSATPSLES   A  G Y
Sbjct: 327 LGLIIVDEEHDPAYKQTESPPCYHARDVAVMRGKLAHATVVLGSATPSLESYTNALSGKY 386

Query: 437 QHLRLTQRANPLATIPEVQVIDFRDYIGQNETSN-FTPPLLEAIQDRLVKKEQVVLMLNR 495
                           ++ +I+      +++T   F+ P+L+ I +RL   EQV++  NR
Sbjct: 387 VXXXXXXXXXXXHPA-KISLINMNLEREKSKTKILFSQPVLKKIAERLEVGEQVLIFFNR 445

Query: 496 RGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFS-KDIPQVCPNCK-SRSIR 553
           RGY + V C  C     CP+CD+ LT H     + CH C  S KD+PQ CP C  + +++
Sbjct: 446 RGYHTNVSCTVCKHTLKCPHCDMVLTFHKYANVLLCHLCNSSPKDLPQSCPKCLGTMTLQ 505

Query: 554 YYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKG 613
           Y G+GT+K    L ++FPQ R +R+D DTT+ KGSH+ LL QF  G+AD+L+GTQMIAKG
Sbjct: 506 YRGSGTEKIEKILQQIFPQIRTIRIDSDTTKFKGSHETLLRQFATGKADVLIGTQMIAKG 565

Query: 614 LDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYA 673
           ++F  VTL  +LN D+ L +PDFR+SE+ FQL+TQVAGR+GR+   G++LIQS+   H  
Sbjct: 566 MNFSAVTLAVILNGDSGLYIPDFRASEQVFQLITQVAGRSGRSHLPGEILIQSFLPDHPT 625

Query: 674 IRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLS 733
           I  A  QDY  FY+ E+  R    YPP+   I      K  ++ ++ A+ V NIL+  L 
Sbjct: 626 IHSAMRQDYSAFYSQEITGRELCEYPPFIRLIRCIFMGKCPKQTWEEAHRVHNILKEQLE 685

Query: 734 ETSPILGPTPKPIARTHNLYHYQILIK 760
            T+P++  TP    +  + + YQ LIK
Sbjct: 686 STNPLMPVTPCGHFKIKDTFRYQFLIK 712


>PRIA_CHLMU RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 753

 Score =  384 bits (985), Expect = e-108
 Identities = 222/543 (40%), Positives = 325/543 (59%), Gaps = 12/543 (2%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQ-PPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P  L  EQ +A + +  S+ +++    LL G+TGSGKTEVYLQ+I+ A   GK+ ILLVP
Sbjct: 211 PPTLTQEQIEAINTISQSLITTKFQTCLLFGVTGSGKTEVYLQVIRKARSLGKSVILLVP 270

Query: 318 EISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKN 377
           E++LT Q    F   FG +V +LH  LS  E+   W K  RG   +++G RSAIF P++N
Sbjct: 271 EVALTIQTLSFFKMHFGAEVGVLHYKLSESERTQTWHKAARGLINIIIGPRSAIFCPMQN 330

Query: 378 LGVMIIDEEHEAAYKQ-DSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVY 436
           LG++I+DEEH+ AYKQ D  P Y AR+VA++R ++  AT++LGSATPSLES   A    Y
Sbjct: 331 LGLIIVDEEHDGAYKQSDLPPFYQARDVAVMRGKFTNATVILGSATPSLESYTNALSKKY 390

Query: 437 QHLRLTQRANPLATIP-EVQVIDF-RDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLN 494
               L++RA+   +IP +V +ID  R+     +   F+P ++ +I+ RL   EQ ++  N
Sbjct: 391 TLSVLSKRAS--TSIPTKVSLIDMNREMEKTRKKILFSPTVIRSIEQRLAVGEQTIIFFN 448

Query: 495 RRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCG--FSKDIPQVCPNCK-SRS 551
           RRG+ + V C  C     CP+CD+ LT H   + + CH C    SK I   CP C  + +
Sbjct: 449 RRGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLCNTRLSKPITS-CPQCHGTMT 507

Query: 552 IRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIA 611
           ++Y G GT+K    L + FP  R +R+D DTTR +GSH AL+ QF  G+ADIL+GTQMIA
Sbjct: 508 LQYRGAGTEKIEALLQDFFPTVRTIRLDSDTTRYRGSHDALIKQFATGKADILIGTQMIA 567

Query: 612 KGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQH 671
           KG+ FP VTL  VL+ D+ L +PDFR++E+ FQL+TQV GR+GR+   G+VLIQ++  Q+
Sbjct: 568 KGMHFPAVTLSVVLSGDSGLYIPDFRAAEQVFQLITQVTGRSGRSYLPGEVLIQTFLPQN 627

Query: 672 YAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSG 731
             I  A  QD+  FY  E+  R+   YPP+   I      K  E   + A  +  +++  
Sbjct: 628 STISHALAQDFPAFYKEEILGRKACNYPPFTRLIRCIFLGKCAEYTLQEAQRMHELIKQN 687

Query: 732 LSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENSELRLSID 791
           L   + ++  +P    +  +L+HYQ LIK R    +   L    A +  + +S++R  +D
Sbjct: 688 LDAQASLMDISPCGHFKVKDLFHYQFLIKTRNILTVNKQLQD--AFSAAKLSSKVRCIVD 745

Query: 792 HEP 794
            +P
Sbjct: 746 IDP 748


>PRIA_CHLTR RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 753

 Score =  383 bits (984), Expect = e-108
 Identities = 223/542 (41%), Positives = 322/542 (59%), Gaps = 10/542 (1%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQ-PPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P  LN EQ  A + +  S+ + Q    LL G+TGSGKTEVYLQ+I+ A   GK+ ILLVP
Sbjct: 211 PPTLNQEQLDAVNTISQSLVAEQFQTCLLFGVTGSGKTEVYLQVIRKARALGKSVILLVP 270

Query: 318 EISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKN 377
           E++LT Q    F   FG +V +LH  LS+ E+   W K  RG   +++G RSAIF P++N
Sbjct: 271 EVALTIQTLSFFKMHFGSEVGVLHYKLSDSERTQTWYKASRGLINIIIGPRSAIFCPIQN 330

Query: 378 LGVMIIDEEHEAAYKQ-DSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVY 436
           LG++I+DEEH++AYKQ D  P Y AR+VA++R +   AT++LGSATPSLES   A    Y
Sbjct: 331 LGLIIVDEEHDSAYKQSDLPPFYQARDVAVMRGKMTNATVILGSATPSLESYTNALSKKY 390

Query: 437 QHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNF-TPPLLEAIQDRLVKKEQVVLMLNR 495
               L++RA+  +T  +V +ID    + +     F +  ++ +I+ RL   EQ ++  NR
Sbjct: 391 TLSVLSKRAST-STPTKVFLIDMNLEMEKTRKKPFFSQTVIRSIEQRLEVGEQTIIFFNR 449

Query: 496 RGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCG--FSKDIPQVCPNCK-SRSI 552
           RG+ + V C  C     CP+CD+ LT H   + + CH C    SK I   CP C  + ++
Sbjct: 450 RGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLCNTRLSKPITS-CPQCLGTMTL 508

Query: 553 RYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           +Y G GT+K    L E FP AR +R+D DTTR +GSH AL+ QF  G+ADIL+GTQMIAK
Sbjct: 509 QYRGAGTEKIETLLREFFPTARTIRLDSDTTRFRGSHDALVKQFATGKADILIGTQMIAK 568

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           G+ FP VTL  VL+ D+ L +PDFR++E+ FQL+TQV GR+GR+   G+VLIQ++  Q+ 
Sbjct: 569 GMHFPAVTLSVVLSGDSGLYIPDFRAAEQVFQLITQVTGRSGRSHLPGEVLIQTFLPQNS 628

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGL 732
            I  A  QD+  FY  E+  R+   YPP+   I      K  +   K    V  +++  L
Sbjct: 629 TISHALAQDFPAFYKEEILGRKVCNYPPFTRLIRCIFLGKCSDYTLKETQRVHTLIKQNL 688

Query: 733 SETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENSELRLSIDH 792
              + ++  +P    +  +L+HYQ LIK R        + + LA    + +S++R  +D 
Sbjct: 689 DSQASLMEISPCGHFKVKDLFHYQFLIKTRNILVANKQIQEALAAA--KLSSKVRCIVDV 746

Query: 793 EP 794
           +P
Sbjct: 747 DP 748


>PRIA_ECOLI RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 732

 Score =  383 bits (983), Expect = e-108
 Identities = 213/539 (39%), Positives = 318/539 (58%), Gaps = 10/539 (1%)

Query: 260 LELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEI 319
           L LN EQ  A  A+ S+  +    +LL G+TGSGKTEVYL +++  L +GK A+++VPEI
Sbjct: 197 LRLNTEQATAVGAIHSAADTFSA-WLLAGVTGSGKTEVYLSVLENVLAQGKQALVMVPEI 255

Query: 320 SLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLG 379
            LTPQ   RF  RF   V +LHSGL++ E+   W K + G+A +V+G RSA+F P KNLG
Sbjct: 256 GLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFKNLG 315

Query: 380 VMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHL 439
           V++IDEEH+++YKQ    RYHAR++A+ RA   Q  ++LGSATP+LE+     +  Y+ L
Sbjct: 316 VIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKYRLL 375

Query: 440 RLTQRANPLATIPEVQ-VIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGY 498
           RLT+RA      P +Q V+D +   GQ   +   P L+  ++  L    QV+L LNRRG+
Sbjct: 376 RLTRRAGNAR--PAIQHVLDLK---GQKVQAGLAPALITRMRQHLQADNQVILFLNRRGF 430

Query: 499 SSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTG 558
           +  ++C +CG +  CP CD   TLH     + CH+C   + +P+ CP+C S  +   G G
Sbjct: 431 APALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGSTHLVPVGLG 490

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++    LA LFP   I R+D DTT +KG+ +  L +  RG A IL+GTQM+AKG  FP+
Sbjct: 491 TEQLEQTLAPLFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHFPD 550

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           VTLV +L+ D AL   DFRS+ER  QL TQVAGRAGRA K G+V++Q+++ +H  ++   
Sbjct: 551 VTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQTLL 610

Query: 679 DQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSG--LSETS 736
            + Y+ F    +  RR +  PP+   + +       +       ++ N++ S     E  
Sbjct: 611 YKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADEKL 670

Query: 737 PILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENS-ELRLSIDHEP 794
            +LGP P    +    + +QIL+++     L   +N  LAL     +S +++  +D +P
Sbjct: 671 WVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIINGTLALINTIPDSRKVKWVLDVDP 729



 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 13/78 (16%)

Query: 19 YSYRIPEEFEGM-LEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEME-QDLKDIAEVLD 76
          + Y +PE   GM ++ G RV VPFGK    I GIV+   S SD  E+   +LK + EVLD
Sbjct: 16 FDYLLPE---GMTVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPLNELKAVVEVLD 68

Query: 77 FSPVLTPE----QLWLAE 90
            PV T       LW A+
Sbjct: 69 SEPVFTHSVWRLLLWAAD 86


>PRIA_HAEIN RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 730

 Score =  369 bits (948), Expect = e-104
 Identities = 202/542 (37%), Positives = 307/542 (56%), Gaps = 7/542 (1%)

Query: 254 IEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           + A   L LN +Q  A   ++   G +   +LL G+TGSGKTE+YLQ I+  L  GK  +
Sbjct: 193 VNAENRLTLNKQQALAFSQLLFHSGFNV--WLLDGVTGSGKTEIYLQYIEEILKSGKQVL 250

Query: 314 LLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFA 373
           +LVPEI LTPQ  +RF  RF  ++ +LHS L++ ++   W +   G + +V+G RSA+F 
Sbjct: 251 VLVPEIGLTPQTVQRFKVRFNVEIDVLHSNLTDTQRLYVWDRARSGQSAIVIGTRSALFT 310

Query: 374 PLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGK 433
              NLG +I+DEEH+++YKQ  + RYHAR++AI+ AQ    ++++GSATPSLES      
Sbjct: 311 QFSNLGAIILDEEHDSSYKQQDSWRYHARDLAIVLAQKLNISVLMGSATPSLESINNVQN 370

Query: 434 GVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLML 493
           G YQHL L++RA     +    VID ++   QN  +  + PLLE ++  L K  QV+L L
Sbjct: 371 GKYQHLVLSKRAGNSTALRHF-VIDLKN---QNIQNGLSKPLLERMKAHLEKGNQVLLFL 426

Query: 494 NRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIR 553
           NRRG++  ++C ECG +  CP+C+   T H     + CH+CG  K IP+ C +C S    
Sbjct: 427 NRRGFAPVLLCHECGWIAQCPHCEKPYTYHQHQNVLRCHHCGAQKTIPRQCGDCGSTHXX 486

Query: 554 YYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKG 613
                           FP   + R+D D+T +KG  +  L+   +G++ IL+GTQM+AKG
Sbjct: 487 XXXXXXXXXXXXXXXXFPHYSVARIDRDSTSRKGKLEGYLEDIQQGKSQILIGTQMLAKG 546

Query: 614 LDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYA 673
             FPNVTLV ++N D+AL   DFR+ ER  QL  QVAGRAGRA+K G+V++Q++   H  
Sbjct: 547 HHFPNVTLVALVNVDSALFSLDFRAEERLAQLYIQVAGRAGRADKQGEVVLQTHYPDHPL 606

Query: 674 IRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLS 733
           +       Y+ F    + +R  +G PP+ F   I    +  +       ++ +  +S   
Sbjct: 607 LTTLLANGYQAFAKETLQLRHSMGLPPFTFQALIKAQARHSDLAENCLSQIADFFQSKQI 666

Query: 734 ETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENSELRLSIDHE 793
               +LGP P P ++    Y +Q+L+++     L   L +      E+ NS++RL +D +
Sbjct: 667 TGLQMLGPMPAPFSKKAGQYRWQLLLQHPSRMTLQKALREYQQAELEK-NSQVRLILDVD 725

Query: 794 PQ 795
           PQ
Sbjct: 726 PQ 727



 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 9/83 (10%)

Query: 1  MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSD 60
          M + ++ + VPL +    + Y +P++    L++GMRV VPFG   R+   IV    ++SD
Sbjct: 1  MKIVRVALAVPLPRL---FDYFVPDDVS--LQIGMRVLVPFGTQKRV--AIVADFPTKSD 53

Query: 61 GEEMEQDLKDIAEVLDFSPVLTP 83
              E  LK I + LD +P+ TP
Sbjct: 54 --VPEDKLKAILQPLDLAPLFTP 74


>PRIA_TREPA RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 657

 Score =  366 bits (939), Expect = e-103
 Identities = 210/514 (40%), Positives = 290/514 (56%), Gaps = 9/514 (1%)

Query: 247 SAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGAL 306
           S A   G+  +    L+ EQR+A DA+ +S G+    F + G+TGSGKTEV+L+  +  L
Sbjct: 117 SFASCAGVRRTDTYALSGEQRKAIDAITASTGARS--FYVHGVTGSGKTEVFLRAAEAVL 174

Query: 307 DKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVG 366
            +GK+ I LVPEI+LT Q+ +    RFG + A+LHS LS  ++  EWR+++     VV+G
Sbjct: 175 ARGKSVIYLVPEIALTHQVLQEVYVRFGSQAAVLHSALSGSQRLGEWRRIQCMRHCVVIG 234

Query: 367 ARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLE 426
           ARSAIFAPLK LG++I+DEEH+++YK    PRYHAR+VA+ R        V+GSATPS+E
Sbjct: 235 ARSAIFAPLKRLGLVIMDEEHDSSYKSAHVPRYHARQVAMYRCADANCPFVMGSATPSVE 294

Query: 427 SRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKK 486
           +     +G  + L LT R    A  P V+V+D        E    +  L++ I+      
Sbjct: 295 AWYAMLRGAVRRLPLTARVAGGAP-PRVEVVDV-----SKEALLLSTRLVDEIRKTKEAG 348

Query: 487 EQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPN 546
            Q +L LNRRG+S    CR CG    C  C + LT H     M CHYCG  +  P+ CP 
Sbjct: 349 YQSMLFLNRRGFSYSFQCRSCGYTLCCTQCAVPLTWHKRVGAMQCHYCGRQEAPPESCPC 408

Query: 547 CKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLG 606
           C S   RY G GT+   + +  LFP+ RI R+D D  R  G  Q  ++QF  G+ D+LLG
Sbjct: 409 CHSFDTRYGGVGTEYIEEAVQALFPEYRIARVDTDALR-SGHVQQTMEQFRAGKIDVLLG 467

Query: 607 TQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS 666
           TQMIAKG +FP + LVG+  ADT L+ PDFR++ER+F L+ QVAGRAGR    G V+IQ+
Sbjct: 468 TQMIAKGFNFPTLRLVGIACADTGLHTPDFRAAERSFALMMQVAGRAGRYVDNGLVIIQT 527

Query: 667 YNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMN 726
            N  H A+  A+  D E FYA E+  R  L +PP+   I      K              
Sbjct: 528 RNPAHPAVVCAQHGDCESFYAQELAQREALCFPPFVRLIRFVFRSKXXXXXXXXXXXXXX 587

Query: 727 ILRSGLSETSPILGPTPKPIARTHNLYHYQILIK 760
                +   + +LGP    +A+    Y  QIL++
Sbjct: 588 XXXXQMPLGADVLGPAACVVAQVAGSYRMQILLR 621


>PRIA_RICBR RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 648

 Score =  345 bits (884), Expect = 1e-96
 Identities = 201/544 (36%), Positives = 308/544 (56%), Gaps = 24/544 (4%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+ EQ+QA    +  +  S  P L++G+TGSGKTEVY  +I   L KGK A++++PEI+
Sbjct: 121 DLSEEQKQA----LQMLNDSNKPILIKGVTGSGKTEVYFYLIAEYLAKGKQALVMLPEIA 176

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGV 380
           L+ Q+  RF  RFG    I +S ++  +K    R +     ++V+GARS++F P KNLG+
Sbjct: 177 LSTQIINRFKERFGFDPIIWNSSVTKAQKKMILRGILEDKVKIVIGARSSLFLPFKNLGL 236

Query: 381 MIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLR 440
           ++IDEEH+ +YKQD    Y+AR+ AI+R+ +++A +VL SATPS+E+   A  G Y  + 
Sbjct: 237 IVIDEEHDDSYKQDDGVLYNARDTAIVRSTFDKAQIVLCSATPSIETMYNANIGKYSVIN 296

Query: 441 LTQRANPLATIPEVQVIDF-RDYIGQN-ETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGY 498
           L+ R    A +P +++ID  ++ + +N   SN    L++AI++ L  KEQ +L LNRRGY
Sbjct: 297 LSSRYKN-AVLPNIEMIDMTKEELPKNCYLSNI---LIKAIKNNLENKEQTLLFLNRRGY 352

Query: 499 SSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGT 557
           +  ++C+ CG   TC  C   + +H  +K + CH+CG+   I   CP C +  S+   G 
Sbjct: 353 APLMLCKSCGHKFTCKYCSSWMVVHKSSKKLECHHCGYQSKIFNSCPECLEDESLAICGP 412

Query: 558 GTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFP 617
           G ++  +E   LFP ++I  +  D  +       LL Q    E DIL+GTQMI KG  FP
Sbjct: 413 GIERIEEEAKTLFPNSKIAVISKDHVKNPEKIAQLLHQMENLEIDILIGTQMITKGYHFP 472

Query: 618 NVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFA 677
           N+TLVGV++AD   N  D RSSER FQLL QV GRAGR    G V +QSY   +    + 
Sbjct: 473 NLTLVGVVDADLGSNHADLRSSERAFQLLHQVGGRAGRGNSKGMVYLQSYYPDNIIFSYI 532

Query: 678 KDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSP 737
           KD+  + F+  E+ +R+    PP+     + LS   E ++ + A    N++R        
Sbjct: 533 KDEREDNFFVNELEVRKAADMPPFSKMASVILSGTNEHKILEVA---KNMVRIAPEAQVK 589

Query: 738 ILGPTPKPIARTHNLYHYQILI----KYRLEDELGPTLNQVLALTQERENSELRLSIDHE 793
           ILGP    +++    Y ++ILI    K+ L+  L   L  +      +  S   + ID +
Sbjct: 590 ILGPASSLMSKLAGKYRFRILIIADKKFNLQKYLKFWLELI------KIPSFCHIKIDID 643

Query: 794 PQQF 797
           P+ F
Sbjct: 644 PKSF 647


>PRIA_RICCN RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 648

 Score =  343 bits (880), Expect = 3e-96
 Identities = 201/538 (37%), Positives = 302/538 (56%), Gaps = 12/538 (2%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+ EQ+QA    V+ +  S  P L++G+TGSGKTE+Y  +I   L KGK  ++++PEI+
Sbjct: 121 DLSEEQKQA----VTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVLVMLPEIA 176

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGV 380
           L+ Q+  RFI RFG +  I +S ++   K    R +     +VV+GARS++F P KNLG+
Sbjct: 177 LSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFLPFKNLGL 236

Query: 381 MIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLR 440
           ++IDEEH+ +YKQD    Y+AR+ AI+R  +++A +VL SATPS+E+      G YQ + 
Sbjct: 237 IVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEIGKYQLVT 296

Query: 441 LTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSS 500
           L  R   +  +P +++ID                 +EAI+  L  K+QV+L LNRRGY+ 
Sbjct: 297 LVNRYKNV-DLPNIEIIDM-TXXXXXXXXXXXXXXIEAIKGNLDNKKQVLLFLNRRGYAP 354

Query: 501 FVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGTGT 559
            ++C+ CG   TC  C   + +H  TK + CH+CG+   I   CP C +  ++   G G 
Sbjct: 355 LMLCKACGYRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPGI 414

Query: 560 QKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           ++  +E   LFP+++I  +  D  +       LL Q    E DIL+GTQ+I KG  FPN+
Sbjct: 415 ERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGYHFPNL 474

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKD 679
           TLVGV++AD   N  D R+SERTFQLL QV GRAGR +  G V +QSY   +    + K 
Sbjct: 475 TLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIFSYVKA 534

Query: 680 QDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPIL 739
            D + F+A E+ IR+    PP+  T  + LS   E ++ + A +++ I          IL
Sbjct: 535 GDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPKA---NVKIL 591

Query: 740 GPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENSELRLSIDHEPQQF 797
           GP    +++    Y Y+ILI    +  L   L   L+L   +  S   L ID +P+ F
Sbjct: 592 GPASSLMSKLAGKYRYRILIIANKKFNLQKYLKFWLSLI--KIPSFCHLKIDIDPKSF 647


>PRIA_RICTY RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 648

 Score =  342 bits (878), Expect = 5e-96
 Identities = 200/533 (37%), Positives = 306/533 (57%), Gaps = 12/533 (2%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+ EQ+QA    V+    S  P L++G+TGSGKTE+Y  II   L KG+  ++++PEI+
Sbjct: 121 QLSEEQKQA----VTIFNESNKPTLIKGVTGSGKTEIYFHIIADHLMKGQQVLIMLPEIA 176

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGV 380
           L+ Q+  RFI RFG +  I +S ++  +K    R +     +VV+GARS++F P  NLG+
Sbjct: 177 LSRQIINRFIDRFGFEPIIWNSSVTKAQKKMILRGILSDKVKVVIGARSSLFLPFHNLGL 236

Query: 381 MIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLR 440
           ++IDEEH+ +YKQD N  Y+AR+ AI+R  +++A +VL SATPSLE+        YQ + 
Sbjct: 237 IVIDEEHDDSYKQDDNILYNARDTAIVRGVFDKAKIVLCSATPSLETIYNIKTHKYQLVT 296

Query: 441 LTQRANPLATIPEVQVIDF-RDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYS 499
           L  R   +  +P +++ID  ++ + +N  S  +  L++AI+  L  K+QV+L LNRRGY+
Sbjct: 297 LVNRYKNI-DLPNIEIIDMTKEKLPKN--SYLSKILIDAIKGNLENKKQVLLFLNRRGYA 353

Query: 500 SFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGTG 558
             ++C+ CG   TC  C   + LH  TKT+ CH+CG+   I   CP C +  ++   G G
Sbjct: 354 PLMLCKACGHRFTCRFCSAWMVLHKATKTLECHHCGYQSKIFSSCPECLEDETLTICGPG 413

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
            ++  +E   LFP+++I  +  D  +       LL Q    E DIL+GTQ+I KG  FPN
Sbjct: 414 IERIEEEAMLLFPKSKIAVISKDHAKTPAKIAQLLHQMENLEIDILIGTQIITKGYHFPN 473

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           +TLVGV++AD   N  + R+SERTFQLL QV GRAGR +  G V +QSY   +    + K
Sbjct: 474 LTLVGVIDADLGSNNAELRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNIIFSYVK 533

Query: 679 DQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPI 738
             D + F+  E+ IR+    PP+  T  + LS   E ++   A    NI++        I
Sbjct: 534 VGDEDSFFTNELEIRKAANMPPFSKTASLILSGFSESKILDIA---KNIVQIAPKANVKI 590

Query: 739 LGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQERENSELRLSID 791
           LGP    +++    Y Y+ILI    +  L   L   L+L +     ++++ ID
Sbjct: 591 LGPARALMSKLAGKYRYRILIIADKKFNLQQYLKFWLSLIKIPSYCQIKIDID 643


>PRIA_RICPR RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 648

 Score =  336 bits (861), Expect = 5e-94
 Identities = 199/543 (36%), Positives = 308/543 (56%), Gaps = 22/543 (4%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+ EQ+QA    V+ +  S  P L++G+TGSGKTE+Y  II   L KG+  ++++PEI+
Sbjct: 121 KLSEEQKQA----VTILNESNKPTLIKGVTGSGKTEIYFHIIADYLIKGRQVLIMLPEIA 176

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGV 380
           L  Q+  RFI RFG +  I +S ++  +K    R +     +VV+G RS++F P  NLG+
Sbjct: 177 LGKQIINRFIDRFGFEPIIWNSSVTKAQKKMILRGILSNKVKVVIGTRSSLFLPFHNLGL 236

Query: 381 MIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLR 440
           ++IDEEH+ +YKQD N  Y+AR+ AI+R ++++A +VL SATPSLE+        YQ + 
Sbjct: 237 IVIDEEHDDSYKQDDNILYNARDTAIVRGKFDKAKIVLCSATPSLETIYNIKTHKYQLVT 296

Query: 441 LTQRANPLATIPEVQVIDF-RDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYS 499
           L  R   +  +P +++ID  ++ + +N  S  +  L++AI+  L  K+Q +L LNRRGY+
Sbjct: 297 LANRYKNV-DLPNIEIIDMTKEKLPKN--SYLSKILIDAIKGNLENKKQALLFLNRRGYA 353

Query: 500 SFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGTG 558
             ++C+ CG   TC  C   + LH  TK + CH+CG+   I   CP C +  ++   G G
Sbjct: 354 PLMLCKACGHRFTCKFCSAWMVLHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPG 413

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
            ++  +E   LFP+++I  +  D  +       LL Q    E DIL+GTQ+I KG  FPN
Sbjct: 414 IERIAEEAMLLFPKSKIAVISKDHAKTPEKIAQLLHQMENLEIDILIGTQIITKGYHFPN 473

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           +TLVGV++AD   N  + R+SERTFQLL QV GRAGR +  G V +QSY   +    + K
Sbjct: 474 LTLVGVIDADLGSNNAELRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNIIFSYVK 533

Query: 679 DQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPI 738
             D + F+  E+ IR+    PP+  T  + LS   E ++   A +++ I          I
Sbjct: 534 VGDEDRFFTNELEIRKAANMPPFSKTASLILSGFSESKILDIARKIVQIAPKA---NVKI 590

Query: 739 LGPTPKPIARTHNLYHYQILI----KYRLEDELGPTLNQVLALTQERENSELRLSIDHEP 794
           LGP    +++    Y Y+ILI    K+ L+  L   L  +      +  S  ++ ID +P
Sbjct: 591 LGPARSLMSKLAGKYRYRILIIADKKFNLQKYLKFWLGFI------KIPSYCQIKIDIDP 644

Query: 795 QQF 797
           + F
Sbjct: 645 KTF 647


>PRIA_RICFE RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 648

 Score =  335 bits (859), Expect = 8e-94
 Identities = 199/543 (36%), Positives = 304/543 (55%), Gaps = 22/543 (4%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+ EQ+QA    V+ +  S  P L++G+TGSGKTE+Y  +I   L KGK  ++++PEI+
Sbjct: 121 DLSEEQKQA----VTILNESNKPTLIKGVTGSGKTEIYFHLIADYLVKGKQVLIMLPEIA 176

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGV 380
           L+ Q+  RFI RFG +  I +S ++  +K    R +     +VV+GARS++F P KNLG+
Sbjct: 177 LSTQIINRFIERFGFEPIIWNSSVTKAQKKMILRGILSDKVKVVIGARSSLFLPFKNLGL 236

Query: 381 MIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLR 440
           ++IDEEH+ +YKQD    Y+AR+ AI+R  +++A +VL SATPS+E+      G YQ + 
Sbjct: 237 VVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETMYNIEIGKYQLVT 296

Query: 441 LTQRANPLATIPEVQVIDF-RDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYS 499
           L  R N +  +P +++ID  ++ + +N  S  +  L+EAI+D L  K+QV+L LNRRGY+
Sbjct: 297 LVNRYNNV-DLPNIEIIDMTKEKLSKN--SYLSKILIEAIKDNLDNKKQVLLFLNRRGYA 353

Query: 500 SFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGTG 558
             ++C+ CG   TC  C   + +H  TK + CH+CG+   I   CP C +  ++   G G
Sbjct: 354 PLMLCKACGHRFTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPG 413

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
            ++  +E   LFP+ +I  +  D  +       LL Q    E DIL+GTQMI KG  FPN
Sbjct: 414 IERIEEEAKALFPENKIAVISKDHAKNPERIAQLLHQMENLEIDILIGTQMITKGYHFPN 473

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           +TLVGV++AD   N  D R+SERTFQLL Q               +QSY   +    + K
Sbjct: 474 LTLVGVIDADLGSNNADLRASERTFQLLHQXXXXXXXXXXXXXXYLQSYYPDNIIFSYVK 533

Query: 679 DQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPI 738
             D + F+A E+ IR+    PP+  T  + LS   E ++ + A  ++ I          I
Sbjct: 534 AGDEDSFFANELEIRKSADMPPFSKTASVILSGSNESKILEIARAMVRIAPKA---NVKI 590

Query: 739 LGPTPKPIARTHNLYHYQILI----KYRLEDELGPTLNQVLALTQERENSELRLSIDHEP 794
           LGP    +++    Y Y+ILI    K+ L+  L   L+ +      +  S   L ID +P
Sbjct: 591 LGPASSLMSKLAGKYRYRILIIADKKFNLQKYLKFWLSLI------KIPSFCHLKIDIDP 644

Query: 795 QQF 797
           + F
Sbjct: 645 KSF 647


>PRIA_BORBU RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 660

 Score =  315 bits (807), Expect = 9e-88
 Identities = 174/501 (34%), Positives = 274/501 (54%), Gaps = 12/501 (2%)

Query: 260 LELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEI 319
           LELN EQ+     ++ S  ++   F L GI GSGKTE+++++ +  L   +  + L+PEI
Sbjct: 132 LELNNEQQNIYKEIIGSEKTNV--FYLFGIPGSGKTEIFIKLCEYYLALEQQVLFLIPEI 189

Query: 320 SLTPQMTER--FIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKN 377
           SL  Q+ +R  +      K+   +S + N +K   W KV+ G++ VV+G +S +  P   
Sbjct: 190 SLGYQIIKRIKYALNMHHKIYEYNSKVPNSDKNLIWNKVKNGESLVVIGIKSVLMLPFTK 249

Query: 378 LGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQ 437
           L ++I+DEEHE  YK ++ PR+H+R ++    +   A  V+GSATPSLE+         +
Sbjct: 250 LKLIIMDEEHETTYKSENIPRFHSRHISFFLQKKFNAKFVMGSATPSLEAYHAMKNNQIK 309

Query: 438 HLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRG 497
            + + Q     + I ++++I+ +      E S  +  LL +IQ  L +K Q ++ +N+RG
Sbjct: 310 KI-IMQNKFSQSKIEDIKIINMK-----KEPSTISSELLYSIQKSLNEKRQSLIFINKRG 363

Query: 498 YSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGT 557
           Y   + C ECG +  CPNC   L  H     + CHYC +       CP C+S+ I+Y   
Sbjct: 364 YLKNLECNECGHIICCPNCSFGLIYHKKENKLLCHYCSYKTKTASHCPQCESKDIKYKTY 423

Query: 558 GTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFP 617
           G Q    EL +  P A+I R+D D T+ +      +++F   E DIL+GTQ+IAKG +F 
Sbjct: 424 GIQLVEKELKKFLPNAKIARIDSDITKIENIDS--INKFENKEIDILIGTQIIAKGFNFE 481

Query: 618 NVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFA 677
           N+  +G++NAD  + LPDFRS ER F  L+Q+ GRA R +    ++IQ+ N  +YAI++A
Sbjct: 482 NIKTLGIINADIGMGLPDFRSGERIFTTLSQIMGRAARFKDDNIIIIQTKNPNYYAIKYA 541

Query: 678 KDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSP 737
               YE FY  E+ IR++L YPP+   I I    K EE   ++ +E     +  L E   
Sbjct: 542 YKNQYEQFYEEELDIRKKLNYPPFNKIIRIIFRSKNEESAKQKCWEFFEKSKEFLQEEIE 601

Query: 738 ILGPTPKPIARTHNLYHYQIL 758
            LGP+   + +    Y Y I+
Sbjct: 602 HLGPSEAIMKKISKNYRYNII 622


>PRIA_THEMA RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 736

 Score =  292 bits (747), Expect = 8e-81
 Identities = 172/494 (34%), Positives = 265/494 (53%), Gaps = 16/494 (3%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD-KVAILHSG 343
           L  G TGSGKTE   ++I     KG T + LVPE+S+      R    F D K+ I HS 
Sbjct: 240 LFFGPTGSGKTEALFELIDVYSRKG-TVLFLVPEVSVLTHTLSRLKGAFPDLKIGIYHSY 298

Query: 344 LSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHARE 403
           LS   K  EW K   G   V++G RSA+F P+KNL ++I+DEEH+ ++ Q + P Y A  
Sbjct: 299 LSRARKNLEWYKAASGKIDVLLGTRSAVFVPVKNLSLLIVDEEHDESFYQHTRPSYDAIV 358

Query: 404 VAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYI 463
           VA   ++     ++L SATP L +   A +G  +    T+R   L+    V+V+D R+  
Sbjct: 359 VARKISEVFDVPIILSSATPDLWTYREAKEGRIRTFNFTRRFGSLS----VEVVDMRN-- 412

Query: 464 GQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLH 523
            + +  +F    L+ I++ L + ++V++ + R+G+   V C  CG V  C NCD+SL  H
Sbjct: 413 -EEKIGSFAKKTLDRIEETLEEGKRVLIYVRRKGFWGRVQCEVCGYVLKCENCDVSLVYH 471

Query: 524 MDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTT 583
            DT ++ CH CG    + + CP C  R +     GT++   EL   FP  RI R+D +  
Sbjct: 472 SDTHSLKCHQCGREYGLVESCPRCGGRLVG-RTAGTERVERELKRYFPTRRIARVDREVV 530

Query: 584 RKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTF 643
                 ++ +D+  RGE DIL+GT++I K L  P + LV +++ D+ +  PD+ SS RTF
Sbjct: 531 DNIMELESYIDKLIRGEIDILVGTRLITKSLSVPEIGLVCIMDVDSLIFNPDYSSSLRTF 590

Query: 644 QLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYF 703
           QL+ Q  GRA R ++ G+ +IQ+YN +   IR A ++D  GFYA E+  R+ LGYPPY  
Sbjct: 591 QLVVQALGRASRGDQ-GKAIIQTYNPEDTIIRKALEEDVNGFYAEELERRKALGYPPYRH 649

Query: 704 TIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRL 763
            I + +   K  EV K +   +     G      +LGP    + +    Y + +++K   
Sbjct: 650 LIQVAVK-SKNPEVGKNSLTSLKEFLKG----EEVLGPVEHWVFKLRGFYRHHLIVKTED 704

Query: 764 EDELGPTLNQVLAL 777
            + + P L + L +
Sbjct: 705 LERVLPKLEKALRI 718


>PRIA_HELPY RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 619

 Score =  276 bits (706), Expect = 4e-76
 Identities = 171/476 (35%), Positives = 255/476 (53%), Gaps = 18/476 (3%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGL 344
           LL G TGSGKTE+Y+  I   L++ K+A+LLVPEI+LTPQM +R    F + + + HS L
Sbjct: 129 LLFGDTGSGKTEIYMHAIAQTLEQKKSALLLVPEIALTPQMQQRLKRVFKENLGLWHSKL 188

Query: 345 SNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREV 404
           S  +K     K+   + ++VVG RSA+F PLK LG++I+DEEH+ +YK   +P Y+AR++
Sbjct: 189 SQNQKKQFLEKLYSQEIKLVVGTRSALFLPLKELGLIIVDEEHDFSYKSHQSPMYNARDL 248

Query: 405 AILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIG 464
            +  +      ++LGSATPSL S  R        +RL  R  P            ++ I 
Sbjct: 249 CLYLSHKFPIQVILGSATPSLNSYKRFKDKAL--VRLKGRYTPTQ----------KNIIF 296

Query: 465 QNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHM 524
           +      TP LLEA+Q  L K EQ ++ +  R     ++C+ C     CP C ++++LH+
Sbjct: 297 EKTERFITPKLLEALQQVLDKNEQAIIFVPTRANFKTLLCQSCYKSVQCPFCSVNMSLHL 356

Query: 525 DTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTR 584
            T  + CHYC FS  IP++C  C+S  +     GT +   EL  L   A+I  +D D T 
Sbjct: 357 KTNKLMCHYCHFSSPIPKICSACQSEVLVGKRIGTMQVLKELESLLEGAKIAILDKDHTS 416

Query: 585 KKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQ 644
            +     +L+ F   + +IL+GTQMI+KG D+  V+L  VL  D  +    +R+ E    
Sbjct: 417 TQKKLHNILNDFNAQKTNILIGTQMISKGHDYAKVSLAVVLGIDNIIKSNSYRALEEGVS 476

Query: 645 LLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFT 704
           LL Q+AGR+ R + +GQV IQS  +          +DYE F  YE+  R +L YPP+   
Sbjct: 477 LLYQIAGRSAR-QISGQVFIQSTETDLLENFL---EDYEDFLQYELQERCEL-YPPFSRL 531

Query: 705 IGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIK 760
             +   HK EE+  + + +    L S L E    L     PI +  + Y Y IL++
Sbjct: 532 CLLEFKHKNEEKAQQLSLKASQTLSSCL-EKGVTLSNFKAPIEKIASSYRYLILLR 586


>PRIA_HELPJ RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 619

 Score =  273 bits (697), Expect = 5e-75
 Identities = 170/479 (35%), Positives = 253/479 (52%), Gaps = 18/479 (3%)

Query: 282 PPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILH 341
           P  LL G TGSGKTE+Y+  I   L++ K+A+LLVPEI+LTPQM +R    F + + + H
Sbjct: 126 PASLLFGDTGSGKTEIYMHAIAQTLEQKKSALLLVPEIALTPQMQQRLKKVFKENLGLWH 185

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHA 401
           S LS  +K     K+   + ++VVG RSA+F PLK LG++I+DEEH+ +YK   +P Y+A
Sbjct: 186 SKLSQNQKKQFLEKLYSQEIKLVVGTRSALFLPLKELGLIIVDEEHDFSYKSQQSPMYNA 245

Query: 402 REVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRD 461
           R++ +  +      ++LGSATPSL S  R        +RL  R  P            ++
Sbjct: 246 RDLCLYLSHKFPIQVILGSATPSLSSYQRFKDKAL--VRLKGRYTPTQ----------KN 293

Query: 462 YIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLT 521
            I +      TP LLEA++  + K EQ ++ +  R     ++C  C     CP C ++++
Sbjct: 294 IIFEKTERFITPKLLEALKQVIDKNEQAIIFVPTRANFKTLLCPNCYKSVQCPFCSVNMS 353

Query: 522 LHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVD 581
           LH+ T  + CHYC FS  IP++C  C+S  +     GT +   EL  L   A+I  +D D
Sbjct: 354 LHLKTNKLMCHYCHFSSPIPKICNACQSEVLVGKRIGTMQVLKELESLLEGAKIAILDKD 413

Query: 582 TTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSER 641
            T        +L+ F   + +IL+GTQMI+KG D+  V+L  VL  D  +    +R+ E 
Sbjct: 414 HTSTPKKLHNILNDFNAQKTNILIGTQMISKGHDYAKVSLAVVLGIDNIIKSNSYRALEE 473

Query: 642 TFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPY 701
              LL Q+AGR+ R + +GQV IQS  +          +DYE F  YE+  R +L YPP+
Sbjct: 474 GVSLLYQIAGRSAR-QISGQVFIQSTETDLLENFL---EDYEDFLQYELQERCEL-YPPF 528

Query: 702 YFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIK 760
                +   HK EE+  + + E    L   L E    L     PI +  + Y Y IL++
Sbjct: 529 SRLCLLEFKHKNEEKAQQLSLEASQTLSLCL-EKGVTLSNFKAPIEKIASSYRYLILLR 586


>PRIA_RHORU RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 811

 Score =  254 bits (649), Expect = 2e-69
 Identities = 169/545 (31%), Positives = 251/545 (46%), Gaps = 57/545 (10%)

Query: 255 EASRPLEL-NPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           +A RP  L + +Q+ A D + +++       LL+G+TGSGKTEVY + I   L +G+ A+
Sbjct: 219 DADRPGPLLSADQQAAADGLRTALDQGFSGLLLEGVTGSGKTEVYFEAIAETLRRGRQAL 278

Query: 314 LLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFA 373
           +L+PEI+L  Q   RF  RFG      HS +                  VVVGARSA+F 
Sbjct: 279 VLLPEIALAAQWPRRFADRFGAAPVQWHSQMGXXXXXXXXXXXXXXXXPVVVGARSALFL 338

Query: 374 PLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGK 433
           P  +LG++I+DEEH++A+KQ+    Y+AR++A++RA+      VL SATPSLE+   A +
Sbjct: 339 PYPDLGLIIVDEEHDSAFKQEEGVPYNARDMAVVRARLGGFPAVLASATPSLETIENARQ 398

Query: 434 GVYQHLRLTQRANPLATIPEVQVIDFR----------DYIGQNETSN------------- 470
           G Y+HL L +R    A +PE+ ++D R          D+ G   +               
Sbjct: 399 GRYRHLVLPRRHGG-AEMPEITLLDLRRAPPQKWLPTDFAGPGGSEGLAAPGGANDEAEE 457

Query: 471 -----------------------------FTPPLLEAIQDRLVKKEQVVLMLNRRGYSSF 501
                                         +PPL+ A+++ L   EQV+L LNRRGY+  
Sbjct: 458 QKXXXXXXXXXXXXXXXXXXXXXXXXLGWLSPPLITAVEETLAAGEQVLLFLNRRGYAPL 517

Query: 502 VMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNC-KSRSIRYYGTGTQ 560
            +CR CG    CP C   L  H     + CH+CG+ + IP+ CP C  + S+   G G +
Sbjct: 518 TLCRSCGHRLKCPRCTAWLVEHRRDGRLRCHHCGYQQPIPETCPACGVADSLAPCGPGVE 577

Query: 561 KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVT 620
           +  +E A  FP+AR+     DT        AL  +    + D+++GTQ++AKG  FP + 
Sbjct: 578 RLAEEAAHRFPKARMDVAASDTVTGPKEAAALATRIANHDIDLIIGTQIMAKGHHFPLIX 637

Query: 621 LVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQ 680
                           R+SERT QLL QV            VLIQ+ +  H  +      
Sbjct: 638 XXXXXXXXXXXXXXXXRASERTHQLLHQVXXXXXXXXXXXXVLIQTVDPGHPVMEALASG 697

Query: 681 DYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILG 740
           D   F   E   R+ L  PP+   + + +S   E+                      +LG
Sbjct: 698 DPALFLEVEAAERQALAMPPFGRLVALVIS--GEDSXXXXXXXXXXXXXXXXXXXXDVLG 755

Query: 741 PTPKP 745
           P P P
Sbjct: 756 PVPAP 760


>PRIA_BUCAI RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 726

 Score =  118 bits (296), Expect = 2e-28
 Identities = 107/491 (21%), Positives = 198/491 (40%), Gaps = 24/491 (4%)

Query: 294 KTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEW 353
           K + YL +IQ  L KG   ++LVP I     +       F   + ++HS L++ + +  W
Sbjct: 226 KVKFYLGLIQSVLYKGVQILILVPYIKNINTIAFFLEKYFNASIDVMHSKLTSSKYFSNW 285

Query: 354 RKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQ 413
            + + G+  +V+G   +              EEH   YK  +  RY+ R++ ILRA   +
Sbjct: 286 VRTKNGENSIVIGTGKSXXXXXXXXXXXXXXEEHNLKYKSINQCRYNIRDLGILRAYKEK 345

Query: 414 ATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNF-- 471
             ++L S TPSL++          +++L               +       + E   F  
Sbjct: 346 IPIILDSETPSLKTLNNVLHRKCFYIKLXXXXXXXXXXXXXXXL-------KTEKIKFGL 398

Query: 472 TPPLLEAIQDRLVKKEQVVLMLNRRGYSSFV-MCRECGTVDTCPNCDISLTLHMDTKTMN 530
           +  L+  I      K QV+L+ N+     FV MC++C  +  C NCD    ++     + 
Sbjct: 399 SLTLINEIYKNFTGK-QVLLIFNKFVLFFFVLMCQKCNEIFKCTNCDDYFEINQYRNILF 457

Query: 531 CHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQ 590
           C +C      P  C NC S S+  +  G ++   E+  +FP+                  
Sbjct: 458 CKFCLIQIKKPIFCYNCGSFSLIVFKIGAEEIKKEMHSIFPKIPXXXXXXXXXXXXXXXX 517

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVA 650
               +F      I++ T+ + +   FP+V L+ ++  D      ++R+ E   Q    + 
Sbjct: 518 TKSFEFAISSPCIIIVTEELVQNYYFPHVKLISLICIDNYFLSFNYRAMEYFAQFYINLN 577

Query: 651 GRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYF-TIGITL 709
                 +K+ ++ IQ+       ++   +  Y  F    M IR+    PP+ F TI  + 
Sbjct: 578 QLTRSTKKSCKIFIQTSFPNDINLKEICNNGYFSFSKKAMAIRKSFLLPPWSFQTIVYSA 637

Query: 710 SHKKEEEVFKRAYEVMNILRSGLSETSP-------ILGPTPKPIARTHNLYHYQILIKYR 762
           S   +  +       ++++R  L + S        +LGP    ++   + Y +Q+LI+  
Sbjct: 638 STNTKYNII-----FLSLMRKILQKKSRKYNCFLWVLGPNNAFLSINKHKYFHQLLIQCS 692

Query: 763 LEDELGPTLNQ 773
               L   LN+
Sbjct: 693 SRVALNNVLNE 703


>PRIA_BUCAP RecName: Full=Primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 720

 Score =  117 bits (292), Expect = 5e-28
 Identities = 94/414 (22%), Positives = 170/414 (41%), Gaps = 8/414 (1%)

Query: 294 KTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEW 353
           K + YL +I+  L K    ++LVP +    Q+       F   + I+HS L+N +   +W
Sbjct: 219 KVKFYLGLIKECLSKNLQILILVPFVKDIYQILFFLKKYFNVYIDIIHSQLNNEDYLKKW 278

Query: 354 RKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQ 413
            + + G   +++G ++++F P   LG++I+++EH   Y+     RY+ R++AILRA    
Sbjct: 279 IRTKSGKNSIIIGTKNSVFFPFLKLGLIIVNQEHHLNYRNLDQCRYNVRDIAILRAYKQN 338

Query: 414 ATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTP 473
             ++L S TPSL +          +++  +  N      +  VID R    +      + 
Sbjct: 339 IPIILDSDTPSLRTLYNILHKKCFYIKFIK--NKKTFFLKNNVIDLRK---ERIKIGLSS 393

Query: 474 PLLEAIQDRLVKKEQVVLMLNRRGYSSF-VMCRECGTVDTCPNCDISLTLHMDTKTMNCH 532
            L+  I + + K   V+L+LN+  +  F ++CR CG ++ C  C+           + C 
Sbjct: 394 TLINEIFNNIQKNYPVLLVLNKFSFVFFGLICRRCGKIEKCHICNDYFETKKYDNFLFCR 453

Query: 533 YCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQAL 592
            C      P  C NCK+ S+  +                                     
Sbjct: 454 NCLIKIKKPLFCYNCKNFSLIVFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 513

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
                   A I++ T+ I++   FP V  + + N D       F S E   Q    +   
Sbjct: 514 XXXXPISNACIIITTEKISQHYYFPYVRFIALTNVDHYFFSFHFCSIEHFLQFYFNLINL 573

Query: 653 AGRAEKAGQVLIQ-SYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTI 705
            G  +K  ++ IQ SY +  + +      DY  F    + +R++   PP+ F +
Sbjct: 574 TGENKKLLKIFIQTSYPNNKFLLNLC-SSDYFLFCRKILSLRKKYFLPPWNFQV 626


>PRIA_MYCLE RecName: Full=Putative primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 651

 Score = 84.3 bits (207), Expect = 3e-18
 Identities = 61/219 (27%), Positives = 97/219 (44%), Gaps = 9/219 (4%)

Query: 337 VAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSN 396
           V  L +GL    +Y  W KV RG A++V+G RSA+FAP+ +LG++++  + +    +   
Sbjct: 201 VVALSAGLGQAVRYQRWLKVLRGSARLVIGTRSAVFAPVNDLGLVMVWSDADDMLAEPRA 260

Query: 397 PRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQV 456
           P  HAREVA+LRA   +   ++G  T + E+ A    G + H                  
Sbjct: 261 PYPHAREVAMLRAYQARCAALIGGYTRTAEAHALVRSG-WAHDXXXXXXXXXXXXXXXXX 319

Query: 457 IDFRDYIGQNE----TSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDT 512
           +D   Y  +++    T                    V++ + RRGY   + C  C T+  
Sbjct: 320 LDDSGYAEESDPAARTXXXXXXXXXXXXXXXXXXXXVLVQVPRRGYVPSLACGRCRTLAR 379

Query: 513 CPNCDISLTLHMDTKTMN--CHYCGFSKDIPQVCPNCKS 549
           C +C   L+L +D  T    C +CG   D+   C  C S
Sbjct: 380 CRHCTGPLSL-LDRATPGTVCCWCG-RADLTLRCARCGS 416


>PRIA_MYCTU RecName: Full=Putative primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 655

 Score = 80.1 bits (196), Expect = 6e-17
 Identities = 97/422 (22%), Positives = 158/422 (37%), Gaps = 24/422 (5%)

Query: 287 QGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD-KVAILHSGLS 345
           Q + G    + + +     +  G+T + +VP+      + +   A   +  V  L +GL 
Sbjct: 147 QALPGELWADRFAEAAAQTVRAGRTVLAIVPDQRDLDTLWQAATALVDEHSVVALSAGLG 206

Query: 346 NGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVA 405
              +Y  W    RG A++V+G RSA+FAPL  LG++++  + + +  +   P  HAREVA
Sbjct: 207 PEARYRRWLAALRGSARLVIGTRSAVFAPLSELGLVMVWADADDSLAEPRAPYPHAREVA 266

Query: 406 ILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQ 465
           +LRA   +   ++G    + E+ A    G + H  +  R    A  P V  +D   Y   
Sbjct: 267 MLRAHQARCAALIGGYARTAEAHALVRSG-WAHDVVAPRPEVRARSPRVVALDDSGYXXX 325

Query: 466 NETSNFTPPL----LEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLT 521
                    L    L A +  L     V++ + RRGY   +                 L+
Sbjct: 326 XXXXXXXXXLPSIALRAARSALQSGAPVLVQVPRRGYIPSLXXXXXXXXXXXXXXTGPLS 385

Query: 522 LH-MDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDV 580
           L    +    C +CG   D    C  C S              +EL   FP   ++    
Sbjct: 386 LQGAGSPGAVCRWCG-RVDPTLRCVRCGSDXXXXXXXXXXXXXEELGRAFPGTAVITSAG 444

Query: 581 DTTRKKGSHQALLDQFGRGEADILL--GTQMIAKGLDFPNVTLVGVLNADTALNLPDFRS 638
           DT         L+ Q   G A ++   G +  A G          +L++   L   D R+
Sbjct: 445 DT---------LVPQLDAGPALVVATPGAEPRAPG----GYGAALLLDSWALLGRQDLRA 491

Query: 639 SERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGY 698
           +E         A    R   AG V+     S    ++     D  G    E+  R ++G 
Sbjct: 492 AEDALWRWMTAAALV-RPRGAGGVVTVVAESSIPTVQSLIRWDPVGHAEAELAARTEVGL 550

Query: 699 PP 700
           PP
Sbjct: 551 PP 552


>PRIA_MYCBO RecName: Full=Putative primosomal protein N';       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase
           priA;AltName: Full=Replication factor Y;
          Length = 655

 Score = 80.1 bits (196), Expect = 6e-17
 Identities = 97/422 (22%), Positives = 158/422 (37%), Gaps = 24/422 (5%)

Query: 287 QGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD-KVAILHSGLS 345
           Q + G    + + +     +  G+T + +VP+      + +   A   +  V  L +GL 
Sbjct: 147 QALPGELWADRFAEAAAQTVRAGRTVLAIVPDQRDLDTLWQAATALVDEHSVVALSAGLG 206

Query: 346 NGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVA 405
              +Y  W    RG A++V+G RSA+FAPL  LG++++  + + +  +   P  HAREVA
Sbjct: 207 PEARYRRWLAALRGSARLVIGTRSAVFAPLSELGLVMVWADADDSLAEPRAPYPHAREVA 266

Query: 406 ILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQ 465
           +LRA   +   ++G    + E+ A    G + H  +  R    A  P V  +D   Y   
Sbjct: 267 MLRAHQARCAALIGGYARTAEAHALVRSG-WAHDVVAPRPEVRARSPRVVALDDSGYXXX 325

Query: 466 NETSNFTPPL----LEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLT 521
                    L    L A +  L     V++ + RRGY   +                 L+
Sbjct: 326 XXXXXXXXXLPSIALRAARSALQSGAPVLVQVPRRGYIPSLXXXXXXXXXXXXXXTGPLS 385

Query: 522 LH-MDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDV 580
           L    +    C +CG   D    C  C S              +EL   FP   ++    
Sbjct: 386 LQGAGSPGAVCRWCG-RVDPTLRCVRCGSDXXXXXXXXXXXXXEELGRAFPGTAVITSAG 444

Query: 581 DTTRKKGSHQALLDQFGRGEADILL--GTQMIAKGLDFPNVTLVGVLNADTALNLPDFRS 638
           DT         L+ Q   G A ++   G +  A G          +L++   L   D R+
Sbjct: 445 DT---------LVPQLDAGPALVVATPGAEPRAPG----GYGAALLLDSWALLGRQDLRA 491

Query: 639 SERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGY 698
           +E         A    R   AG V+     S    ++     D  G    E+  R ++G 
Sbjct: 492 AEDALWRWMTAAALV-RPRGAGGVVTVVAESSIPTVQSLIRWDPVGHAEAELAARTEVGL 550

Query: 699 PP 700
           PP
Sbjct: 551 PP 552


>MFD_HELPJ RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1001

 Score = 67.0 bits (162), Expect = 5e-13
 Identities = 52/159 (32%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 239 IVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEV 297
           I+ K++    A  E  ++    E   +Q +A   +   + S +    LL G  G GKTEV
Sbjct: 462 ILGKKMDTHLAELEIFKSHAGFEYTSDQEKAIAEISRDLSSHRVMDRLLSGDVGFGKTEV 521

Query: 298 YLQIIQGALDKGKTAILLVPEISLTPQMTERFIARF---GDKVAILHSGLSNGEKYDEWR 354
            +  I  A   G  + L+VP   L  Q  E   ARF   G KVA L   +   EK    +
Sbjct: 522 AMHAIFCAFLNGFQSALVVPTTLLAHQHFETLKARFENFGVKVARLDRYIKTSEKSKLLK 581

Query: 355 KVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQ 393
            VE G   V++G  + +    KNLG+M++DEEH+   KQ
Sbjct: 582 AVELGLVDVLIGTHAILGTKFKNLGLMVVDEEHKFGVKQ 620


>MFD_HELPY RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 999

 Score = 62.4 bits (150), Expect = 1e-11
 Identities = 52/159 (32%), Positives = 75/159 (47%), Gaps = 6/159 (3%)

Query: 239 IVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEV 297
           I+ K++    A  E  ++    E   +Q +A   +   + S +    LL G  G GKTEV
Sbjct: 462 ILGKKMDVHLAELEVFKSHAGFEYTSDQEKAIAEISKDLSSHRVMDRLLSGDVGFGKTEV 521

Query: 298 YLQIIQGALDKGKTAILLVPEISLTPQMTERFIARF---GDKVAILHSGLSNGEKYDEWR 354
            +  I  A   G  + L+VP   L  Q  E   ARF   G KVA L    S  EK    +
Sbjct: 522 AMHAIFCAFLNGFQSALVVPTTLLAHQHFETLRARFENFGVKVARLDRYAS--EKNKLLK 579

Query: 355 KVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQ 393
            VE G    ++G  + + A  KNLG++++DEEH+   KQ
Sbjct: 580 AVELGQVDALIGTHAILGAKFKNLGLVVVDEEHKFGVKQ 618


>MFD_ECOLI RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1148

 Score = 60.1 bits (144), Expect = 7e-11
 Identities = 52/175 (29%), Positives = 84/175 (48%), Gaps = 20/175 (11%)

Query: 257 SRPLELNPEQRQARDAVVSSIGSSQP---PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           S P E  P+Q QA +AV+S +   QP     L+ G  G GKTEV ++    A+D  K   
Sbjct: 596 SFPFETTPDQAQAINAVLSDM--CQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVA 653

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
           +LVP   L  Q  + F  RF +   ++ ++    S  E+     +V  G   +++G    
Sbjct: 654 VLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKL 713

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           + + +  K+LG++I+DEEH    +       H   +  +RA  +  TL   +ATP
Sbjct: 714 LQSDVKFKDLGLLIVDEEHRFGVR-------HKERIKAMRANVDILTL---TATP 758


>RECG_AQUAE RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 792

 Score = 58.9 bits (141), Expect = 1e-10
 Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQPPF-LLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P +L   Q +A   ++  +    P   LLQG  GSGKT V +      +  G    ++VP
Sbjct: 358 PFKLTRAQERAIKEILEDLSRDVPMNRLLQGDVGSGKTIVAILTSLAVVKSGYQVAVMVP 417

Query: 318 EISLTPQMTERF---IARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAI--F 372
              L  Q  ++F   +  +G  VA+L   L+  +K   ++ V+ G+  V+VG  + I   
Sbjct: 418 TEILAHQHYKKFSEMLKDYGVNVALLTGSLTPSQKKSVYKHVKEGNIHVLVGTHALIQDK 477

Query: 373 APLKNLGVMIIDEEHEAAYKQ 393
              KNLG +IIDE+H     Q
Sbjct: 478 VEFKNLGYVIIDEQHRFGVMQ 498



 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 14/102 (13%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           Y+   +LFP  ++L +      K+    A++++F R E DIL+ T +I  G+D P  T++
Sbjct: 597 YERWKKLFPDRKVLLLHGKMPDKE--KLAVMEEFKR-EGDILVSTTVIEVGIDVPEATVM 653

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
            + +A        F  S+     L Q+ GR GR++K    L+
Sbjct: 654 VIEDAHR------FGLSQ-----LHQLRGRVGRSDKEAYCLL 684


>RECG_STRPN RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 671

 Score = 58.2 bits (139), Expect = 2e-10
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 14/174 (8%)

Query: 254 IEASRPLELNPEQRQARDAVVSSIGSSQPPF-LLQGITGSGKTEVYLQIIQGALDKGKTA 312
           ++ S P  L   Q ++   +++ + S      LLQG  GSGKT V    +  A+  G  A
Sbjct: 245 VKVSLPFALTQAQEKSLQEILTDMKSDHHMNRLLQGDVGSGKTVVAGLAMFAAVTAGYQA 304

Query: 313 ILLVPEISLTPQMTERFIARFGD-KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAI 371
            L+VP   L  Q  E     F + K+A+L   L   EK +    + +G+A +++G  + I
Sbjct: 305 ALMVPTEILAEQHFESLQNLFPNLKLALLTGSLKAAEKREVLETIAKGEADLIIGTHALI 364

Query: 372 FAPLK--NLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              ++   LG++IIDE+H          R+   +  ILR + +   +++ +ATP
Sbjct: 365 QDGVEYARLGLIIIDEQH----------RFGVGQRRILREKGDNPDVLMMTATP 408


>MFD_STAHJ RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1169

 Score = 57.8 bits (138), Expect = 3e-10
 Identities = 64/247 (25%), Positives = 108/247 (43%), Gaps = 28/247 (11%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +   +P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 613 EMDFPYELTPDQAKSIDEIKGDMERERPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 672

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    S  E  +    ++ G   +VVG    
Sbjct: 673 FLVPTTILAQQHYETLIERMQDFPVQIELISRFRSTKEVKETKEGLKSGYVDIVVGTHKL 732

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESR 428
           +   +  K+LG++I+DEE     +       H   +  ++   +  TL   +ATP   + 
Sbjct: 733 LGKDIHYKDLGLLIVDEEQRFGVR-------HKERIKTMKTNVDVLTL---TATPIPRTL 782

Query: 429 ARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQ 488
             +  GV       +  + + T PE +    + Y+   + SNF   + EA++  L +  Q
Sbjct: 783 HMSMLGV-------RDLSVIETPPENR-FPVQTYV-LEQNSNF---IKEALERELSRDGQ 830

Query: 489 VVLMLNR 495
           V  + NR
Sbjct: 831 VFYLYNR 837


>MFD_HAEIN RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1146

 Score = 57.8 bits (138), Expect = 3e-10
 Identities = 69/268 (25%), Positives = 116/268 (43%), Gaps = 38/268 (14%)

Query: 241 QKEVRRSAAY------FEGIEASRPLELNPEQRQARDAVVSSIGSSQPPF---LLQGITG 291
           Q+E ++  A+      F+   A+ P E   +Q  A +AV+S +   QP     L+ G  G
Sbjct: 576 QREAKKGFAFKYDREEFQQFSATFPFEETYDQEMAINAVISDM--CQPKAMDRLVCGDVG 633

Query: 292 SGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGE 348
            GKTEV ++    A+   K   +LVP   L  Q  E F  RF +    V +L    +  E
Sbjct: 634 FGKTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHYENFKDRFANLPVNVEVLSRFKTAKE 693

Query: 349 KYDEWRKVERGDAQVVVGARSAIFAPLK--NLGVMIIDEEHEAAYKQDSNPRYHAREVAI 406
           +      +  G   +++G    I + +K  +LG++IIDEEH     Q         ++  
Sbjct: 694 QKQILENLAEGKVDILIGTHKLIQSDVKFNDLGLLIIDEEHRFGVGQ-------KEKIKQ 746

Query: 407 LRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQN 466
           LRA  +  TL   +ATP   +   A  G+        R   + + P  + +  + ++ QN
Sbjct: 747 LRANIDILTL---TATPIPRTLNMAMNGI--------RDLSIISTPPARRLSIKTFVRQN 795

Query: 467 ETSNFTPPLLEAIQDRLVKKEQVVLMLN 494
           +       + EAI   +++  QV  + N
Sbjct: 796 DDL----VVREAILREILRGGQVYYLHN 819


>MFD_SYNY3 RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1199

 Score = 56.6 bits (135), Expect = 7e-10
 Identities = 49/162 (30%), Positives = 79/162 (48%), Gaps = 9/162 (5%)

Query: 254 IEASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKG-KT 311
           +E S P +  P+Q +A   V   +   +P   L+ G  G GKTEV ++ I  A+  G K 
Sbjct: 638 LEDSFPYQPTPDQLKAVQDVKRDLEGDRPMDRLVCGDVGFGKTEVAVRAIFKAVTSGNKQ 697

Query: 312 AILLVPEISLTPQ----MTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGA 367
             LL P   LT Q    + ERF A +   + +L+   +  EK +   K++ G+  +VVG 
Sbjct: 698 VALLAPTTVLTQQHYHTLKERF-APYPITIGLLNRFRTASEKKEILAKLKSGELDIVVGT 756

Query: 368 RSAIFAPLK--NLGVMIIDEEHEAAYKQDSNPRYHAREVAIL 407
           +  +   +K  +LG+++IDEE      Q    +    EV +L
Sbjct: 757 QQVLGTSVKFKDLGLLVIDEEQRFGVNQKEKIKTLKTEVDVL 798


>RECG_MYCLE RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 743

 Score = 56.2 bits (134), Expect = 9e-10
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 17/161 (10%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   QR+ RD +   + +++P   LLQG  GSGKT V +  +   +D G   +LL P
Sbjct: 285 PFELTEGQREVRDVLSDGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAP 344

Query: 318 EISLTPQ--MTERFI------------ARFGDKVAILHSGLSNGEKYDEWRKVERGDAQV 363
              L  Q  ++ R +            A    +VA+L   ++  +K      +  G   +
Sbjct: 345 TEVLAAQHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSGQTGI 404

Query: 364 VVGARSAIFAPLK--NLGVMIIDEEHEAAYKQDSNPRYHAR 402
           V+G  + +   ++  NLG++++DE+H    +Q    R  AR
Sbjct: 405 VIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKAR 445



 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 11/79 (13%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVA 650
           A +  F  GE D+L+ T +I  G+D PN T++ V++AD       F  S+     L Q+ 
Sbjct: 575 AAMMAFRAGEIDVLVCTNVIEVGVDVPNATIMLVMDADR------FGISQ-----LHQLR 623

Query: 651 GRAGRAEKAGQVLIQSYNS 669
           GR GR       L+ S+ S
Sbjct: 624 GRIGRGTHPSLCLLASWVS 642


>MFD_STAAW RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAS RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAR RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAN RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAM RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAC RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAAB RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1168

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ D +   +  S+P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 612 ELDFPYELTPDQAKSIDEIKDDMQKSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 671

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   ++ ++    +  E       ++ G   +VVG    
Sbjct: 672 FLVPTTILAQQHYETLIERMQDFPVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKL 731

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP
Sbjct: 732 LSKDIQYKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---TATP 776


>COMFA_BACSU RecName: Full=ComF operon protein 1;       
           EC=3.6.1.-;AltName: Full=ATP-dependent helicase comFA;
          Length = 463

 Score = 54.7 bits (130), Expect = 3e-09
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 17/185 (9%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +L+  Q++A + ++ +I S +   L+  + G+GKTE+    I+ AL++G    +  P   
Sbjct: 120 KLSSGQQKAANVLIEAI-SKKEELLIWAVCGAGKTEMLFPGIESALNQGLRVCIATPRTD 178

Query: 321 LTPQMTERFIARF-GDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLG 379
           +  ++  R  A F G  ++ L+ G  +  +           + +++     +      + 
Sbjct: 179 VVLELAPRLKAAFQGADISALYGGSDDKGRL----------SPLMISTTHQLLRYKDAID 228

Query: 380 VMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHL 439
           VMIIDE     Y  D   ++     A+ +A+   +TLV  SATP  E + +A  G    +
Sbjct: 229 VMIIDEVDAFPYSADQTLQF-----AVQKARKKNSTLVYLSATPPKELKRKALNGQLHSV 283

Query: 440 RLTQR 444
           R+  R
Sbjct: 284 RIPAR 288


>MFD_STAS1 RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1170

 Score = 54.3 bits (129), Expect = 4e-09
 Identities = 62/247 (25%), Positives = 109/247 (44%), Gaps = 28/247 (11%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E   P EL P+Q ++ + +   +   +P   LL G  G GKTEV ++    A+ +GK   
Sbjct: 614 EIDFPYELTPDQSKSIEEIKQDMEIERPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVA 673

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
            LVP   L  Q  E  I R  D   +V ++    +  E  +    ++ G   +VVG    
Sbjct: 674 FLVPTTILAQQHYETLIERMQDFPIEVQLISRFRTTKEVKETKEGLKSGFVDIVVGTHKL 733

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESR 428
           +   +  K+LG++I+DEE           R+  R    +++  N   ++  +ATP   + 
Sbjct: 734 LGKDIQYKDLGLLIVDEEQ----------RFGVRHKERIKSLKNNVDVLTLTATPIPRTL 783

Query: 429 ARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQ 488
             +  GV       +  + + T PE +    + Y+ +  T NF   + EA++  L +  Q
Sbjct: 784 HMSMLGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQ 831

Query: 489 VVLMLNR 495
           V  + N+
Sbjct: 832 VFYLYNK 838


>RECG_MYCTU RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 737

 Score = 53.5 bits (127), Expect = 6e-09
 Identities = 42/160 (26%), Positives = 68/160 (42%), Gaps = 17/160 (10%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   QR+  D +   + +++P   LLQG  GSGKT V +  +   +D G    LL P
Sbjct: 285 PFELTAGQREVLDVLSDGLAANRPLNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAP 344

Query: 318 EISLTPQMTERFI--------------ARFGDKVAILHSGLSNGEKYDEWRKVERGDAQV 363
              L  Q                    A    +VA+L   ++ G+K     ++  G   +
Sbjct: 345 TEVLAAQHLRSIRDVLGPLAMGGQLGGAENATRVALLTGSMTAGQKKQVRAEIASGQVGI 404

Query: 364 VVGARSAI--FAPLKNLGVMIIDEEHEAAYKQDSNPRYHA 401
           V+G  + +       NLG++++DE+H    +Q    R  A
Sbjct: 405 VIGTHALLQEAVDFHNLGMVVVDEQHRFGVEQRDQLRAKA 444



 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVA 650
           A +  F  GE D+L+ T +I  G+D PN T++ V++AD       F  S+     L Q+ 
Sbjct: 574 AAMAAFRAGEVDVLVCTTVIEVGVDVPNATVMLVMDADR------FGISQ-----LHQLR 622

Query: 651 GRAGRAEKAGQVLIQSY 667
           GR GR E     L+ S+
Sbjct: 623 GRIGRGEHPSVCLLASW 639


>RECG_MYCBO RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 737

 Score = 53.5 bits (127), Expect = 6e-09
 Identities = 42/160 (26%), Positives = 68/160 (42%), Gaps = 17/160 (10%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   QR+  D +   + +++P   LLQG  GSGKT V +  +   +D G    LL P
Sbjct: 285 PFELTAGQREVLDVLSDGLAANRPLNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAP 344

Query: 318 EISLTPQMTERFI--------------ARFGDKVAILHSGLSNGEKYDEWRKVERGDAQV 363
              L  Q                    A    +VA+L   ++ G+K     ++  G   +
Sbjct: 345 TEVLAAQHLRSIRDVLGPLAMGGQLGGAENATRVALLTGSMTAGQKKQVRAEIASGQVGI 404

Query: 364 VVGARSAI--FAPLKNLGVMIIDEEHEAAYKQDSNPRYHA 401
           V+G  + +       NLG++++DE+H    +Q    R  A
Sbjct: 405 VIGTHALLQEAVDFHNLGMVVVDEQHRFGVEQRDQLRAKA 444



 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVA 650
           A +  F  GE D+L+ T +I  G+D PN T++ V++AD       F  S+     L Q+ 
Sbjct: 574 AAMAAFRAGEVDVLVCTTVIEVGVDVPNATVMLVMDADR------FGISQ-----LHQLR 622

Query: 651 GRAGRAEKAGQVLIQSY 667
           GR GR E     L+ S+
Sbjct: 623 GRIGRGEHPSVCLLASW 639


>UVRB_CLOTE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L E F +     R L  D+DT  +      ++ +   GE D+L+G  ++ +
Sbjct: 451 TLTKKMAEDLTEYFKEMNIKTRYLHSDIDTIER----MKIIRELRLGEFDVLVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V LV +L+AD       F  S+R+   L Q+ GRA R  ++  ++
Sbjct: 507 GLDIPEVALVAILDADK----EGFLRSDRS---LIQIIGRAARNSESKVIM 550


>UVRB_CLAMS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 688

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQA----RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + F +A    R L  DVDT R+      LL +   G  D+L+G  ++ +
Sbjct: 456 TLTKKMAEELTDYFAEAGVRVRYLHSDVDTLRRV----ELLSELRAGVYDVLVGINLLRE 511

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 512 GLDLPEVSLVAILDADKEGFL-------RSSTSLIQTIGRAAR 547


>UVRB_CLAM3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 688

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQA----RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + F +A    R L  DVDT R+      LL +   G  D+L+G  ++ +
Sbjct: 456 TLTKKMAEELTDYFAEAGVRVRYLHSDVDTLRRV----ELLSELRAGVYDVLVGINLLRE 511

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 512 GLDLPEVSLVAILDADKEGFL-------RSSTSLIQTIGRAAR 547


>RECG_BORBU RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 6/141 (4%)

Query: 254 IEASRPLELNPEQRQARDAVVSSIGSSQPPF-LLQGITGSGKTEVYLQIIQGALDKGKTA 312
           + +S P EL  +Q+ + D +   + SS+P   LLQG  GSGKT V L      ++ G   
Sbjct: 255 VVSSLPFELTEDQKISIDEIFFDLNSSKPMNRLLQGDVGSGKTLVALLSGLPLIEAGYQV 314

Query: 313 ILLVPEISLTPQMTE---RFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARS 369
             + P   L  Q  +     +A F   + +L   L   +K      +  G + ++VG  +
Sbjct: 315 AFMAPTDLLARQHYDNLSNILAPFNISMTLLTGSLRKKDKEQALESIRNGTSGLIVGTHA 374

Query: 370 AIF--APLKNLGVMIIDEEHE 388
             +     K L  +IIDE+H+
Sbjct: 375 IFYESTEFKRLAYVIIDEQHK 395


>MFD_STAES RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1169

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 61/243 (25%), Positives = 107/243 (44%), Gaps = 28/243 (11%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL P+Q ++ D +   +  ++P   LL G  G GKTEV ++    A+  GK    LVP
Sbjct: 617 PYELTPDQSKSIDEIKGDMERARPMDRLLCGDVGYGKTEVAVRAAFKAVMDGKQVAFLVP 676

Query: 318 EISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAP 374
              L  Q  E  + R  D   ++ ++    +  E  +    ++ G   +VVG    +   
Sbjct: 677 TTILAQQHYETLLERMQDFPVEIQLVSRFRTAKEIRETKEGLKSGYVDIVVGTHKLLGKD 736

Query: 375 L--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAG 432
           +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP   +   + 
Sbjct: 737 IQYKDLGLLIVDEEQRFGVR-------HKERIKTLKKNVDVLTL---TATPIPRTLHMSM 786

Query: 433 KGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLM 492
            GV       +  + + T PE +    + Y+ +  T NF   + EA++  L +  QV  +
Sbjct: 787 LGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQVFYL 834

Query: 493 LNR 495
            N+
Sbjct: 835 YNK 837


>MFD_STAEQ RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1169

 Score = 52.4 bits (124), Expect = 1e-08
 Identities = 61/243 (25%), Positives = 107/243 (44%), Gaps = 28/243 (11%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL P+Q ++ D +   +  ++P   LL G  G GKTEV ++    A+  GK    LVP
Sbjct: 617 PYELTPDQSKSIDEIKGDMERARPMDRLLCGDVGYGKTEVAVRAAFKAVMDGKQVAFLVP 676

Query: 318 EISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAP 374
              L  Q  E  + R  D   ++ ++    +  E  +    ++ G   +VVG    +   
Sbjct: 677 TTILAQQHYETLLERMQDFPVEIQLVSRFRTAKEIRETKEGLKSGYVDIVVGTHKLLGKD 736

Query: 375 L--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAG 432
           +  K+LG++I+DEE     +       H   +  L+   +  TL   +ATP   +   + 
Sbjct: 737 IQYKDLGLLIVDEEQRFGVR-------HKERIKTLKKNVDVLTL---TATPIPRTLHMSM 786

Query: 433 KGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLM 492
            GV       +  + + T PE +    + Y+ +  T NF   + EA++  L +  QV  +
Sbjct: 787 LGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQVFYL 834

Query: 493 LNR 495
            N+
Sbjct: 835 YNK 837


>UVRB_PROAC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 701

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 47/136 (34%), Positives = 68/136 (50%), Gaps = 16/136 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  ++DT ++      LL +   GE D+L+G  ++ +GLD P V+LV 
Sbjct: 471 DYLMEHGIRTRYLHSEIDTLKRI----ELLKELRMGEFDVLVGINLLREGLDLPEVSLVA 526

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYAI-RFAKD 679
           +L+AD       F  SER+   L Q  GRA R    GQV++   Q  +S   AI    + 
Sbjct: 527 ILDADK----EGFLRSERS---LIQTVGRAAR-NVNGQVIMYADQITDSMQVAIDETNRR 578

Query: 680 QDYEGFYAYEMGIRRQ 695
           +D +  Y  E GI  Q
Sbjct: 579 RDIQMAYNKEHGIDPQ 594


>UVRB_DESVV RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           + L  +    R L  D+DT  +    QAL     RGE D+L+G  ++ +GLD P V+LV 
Sbjct: 465 EHLGNMGLSVRYLHSDIDTMERMAIIQALR----RGECDVLVGINLLREGLDIPEVSLVS 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD    L       R+   L Q  GRA R   AG+V++
Sbjct: 521 ILDADKEGFL-------RSTGSLIQTFGRAAR-NAAGRVIL 553



 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 265 EQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQ 324
           +Q +A   +V+++G      +L G+TGSGKT     +I       + A++L P  +L  Q
Sbjct: 17  DQPEAIGQIVANLGQGVRDQVLLGVTGSGKTFTVANVIAAC---NRPALILAPNKTLAAQ 73

Query: 325 MTERFIARFGD 335
           +   F A F D
Sbjct: 74  LYNEFRALFPD 84


>UVRB_DESVH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           + L  +    R L  D+DT  +    QAL     RGE D+L+G  ++ +GLD P V+LV 
Sbjct: 465 EHLGNMGLSVRYLHSDIDTMERMAIIQALR----RGECDVLVGINLLREGLDIPEVSLVS 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD    L       R+   L Q  GRA R   AG+V++
Sbjct: 521 ILDADKEGFL-------RSTGSLIQTFGRAAR-NAAGRVIL 553



 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 265 EQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQ 324
           +Q +A   +V+++G      +L G+TGSGKT     +I       + A++L P  +L  Q
Sbjct: 17  DQPEAIGQIVANLGHGVRDQVLLGVTGSGKTFTVANVIAAC---NRPALILAPNKTLAAQ 73

Query: 325 MTERFIARFGD 335
           +   F A F D
Sbjct: 74  LYNEFRALFPD 84


>MFD_MYXXA RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1201

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 8/151 (5%)

Query: 264 PEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQ-IIQGALDKGKTAILLVPEISL 321
           P+Q +A + V++ +   +P   L+ G  G GKTEV ++   + ALD+ + A+ LVP   L
Sbjct: 658 PDQAKAIEDVLADMQKPEPMDRLVCGDVGYGKTEVAMRAAFKAALDRKQVAV-LVPTTVL 716

Query: 322 TPQMTERFIARFGDKVAILH--SGLSNGEKYDE-WRKVERGDAQVVVGARSAIFAPL--K 376
             Q    F  RF D    +   SGL    +  E  ++ + G   +++G    +   +  K
Sbjct: 717 AQQHFLSFKKRFADYPVTVEVISGLKKAPEVREILKRAKEGKVDILIGTHKLLGGEVAFK 776

Query: 377 NLGVMIIDEEHEAAYKQDSNPRYHAREVAIL 407
            LG+MI+DEE     KQ  + +    ++ +L
Sbjct: 777 ELGLMIVDEEQRFGVKQKESLKKWRSQIDVL 807


>UVRB_PELCD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 51.2 bits (121), Expect = 3e-08
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 12/99 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L EL  + R L  D+DT  +      +L +   G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 465 LGELGIKVRYLHSDIDTVER----MQILRELREGLFDVLVGINLLREGLDIPEVSLVAIL 520

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +AD       F  SER+   L Q  GRA R   AG+V++
Sbjct: 521 DADK----EGFLRSERS---LIQTCGRAAR-NVAGRVIM 551


>UVRB_CHLL2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 684

 Score = 51.2 bits (121), Expect = 3e-08
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 7/107 (6%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L + F +  I    + +  K      +L +   GE D+L+G  ++ +GLD 
Sbjct: 457 TLTKRMSEDLDDYFRKTGIRSRYLHSEIKSLERMQILRELRTGEIDVLVGVNLLREGLDL 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           P V+LV +L+AD    L + RS       L Q+AGRA R  +   VL
Sbjct: 517 PEVSLVAILDADKEGFLRNTRS-------LMQIAGRAARNSEGFVVL 556


>UVRB_BACTN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 50.8 bits (120), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  +EL E      +    +  DVDT  +      ++D   +G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEELTEYLLNNNVRCNYIHSDVDTLERV----KIMDDLRQGVYDVLIGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L   RS       LTQ AGRA R
Sbjct: 507 GLDLPEVSLVAILDADKEGFLRSHRS-------LTQTAGRAAR 542


>UVRB_BACFR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 50.8 bits (120), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  +EL E      +    +  DVDT  +      ++D   +G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEELTEYLLNNNVRCNYIHSDVDTLERV----KIMDDLRQGVYDVLIGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L   RS       LTQ AGRA R
Sbjct: 507 GLDLPEVSLVAILDADKEGFLRSHRS-------LTQTAGRAAR 542


>UVRB_BACFN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 50.8 bits (120), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  +EL E      +    +  DVDT  +      ++D   +G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEELTEYLLNNNVRCNYIHSDVDTLERV----KIMDDLRQGVYDVLIGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L   RS       LTQ AGRA R
Sbjct: 507 GLDLPEVSLVAILDADKEGFLRSHRS-------LTQTAGRAAR 542


>UVRB_LEGPL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  DVDT  +      ++     GE D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYLSEHGIKVRYLHSDVDTVER----MEIIRDLRLGEFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V LV +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 508 GLDMPEVALVAILDADK----EGFLRSERS---LIQTIGRAARNVKGRAIL 551


>UVRB_LEGPH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  DVDT  +      ++     GE D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYLSEHGIKVRYLHSDVDTVER----MEIIRDLRLGEFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V LV +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 508 GLDMPEVALVAILDADK----EGFLRSERS---LIQTIGRAARNVKGRAIL 551


>UVRB_LEGPC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  DVDT  +      ++     GE D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYLSEHGIKVRYLHSDVDTVER----MEIIRDLRLGEFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V LV +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 508 GLDMPEVALVAILDADK----EGFLRSERS---LIQTIGRAARNVKGRAIL 551


>UVRB_LEGPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  DVDT  +      ++     GE D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYLSEHGIKVRYLHSDVDTVER----MEIIRDLRLGEFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V LV +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 508 GLDMPEVALVAILDADK----EGFLRSERS---LIQTIGRAARNVKGRAIL 551


>UVRB_CHLCH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 681

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L + F +A I    + +  K      +L +   G+ D+L+G  ++ +GLD 
Sbjct: 457 TLTKRMSEDLHDFFRKAGIRCRYLHSEIKSLERMQILRELRAGDIDVLVGVNLLREGLDL 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD    L + RS       L Q+AGRA R
Sbjct: 517 PEVSLVAILDADKEGFLRNTRS-------LMQIAGRAAR 548


>RECG_STAAW RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>RECG_STAAS RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>RECG_STAAN RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>RECG_STAAM RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>RECG_STAAC RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>RECG_STAA8 RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 50.4 bits (119), Expect = 5e-08
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  +A FGD   VA+L   +   ++     ++E G    ++G  + I   +
Sbjct: 322 TEILAEQHAESLMALFGDSMNVALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>UVRB_THIDA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LAE   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 468 DYLAEHGVKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDIPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 524 ILDADK----EGFLRSERS---LIQTIGRAAR 548


>UVRB_SHIFL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 49/196 (25%), Positives = 81/196 (41%), Gaps = 29/196 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R      +L    ++   
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNVNGKAILYGDRSTPSM 561

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLS--HKKEEEVFKRAYEVMNILRS 730
           A    + +            RR+     Y    GIT    +KK  ++      +      
Sbjct: 562 AKAIGETE------------RRREKQQKYNEEHGITPQGLNKKVVDILALGQNIAKTKAK 609

Query: 731 GLSETSPILGPTPKPI 746
           G  ++ PI+ P   P+
Sbjct: 610 GRGKSRPIVEPDNVPM 625


>UVRB_SHIF8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 49/196 (25%), Positives = 81/196 (41%), Gaps = 29/196 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R      +L    ++   
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNVNGKAILYGDRSTPSM 561

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLS--HKKEEEVFKRAYEVMNILRS 730
           A    + +            RR+     Y    GIT    +KK  ++      +      
Sbjct: 562 AKAIGETE------------RRREKQQKYNEEHGITPQGLNKKVVDILALGQNIAKTKAK 609

Query: 731 GLSETSPILGPTPKPI 746
           G  ++ PI+ P   P+
Sbjct: 610 GRGKSRPIVEPDNVPM 625


>UVRB_DESVM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 680

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 40/112 (35%), Positives = 58/112 (51%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +    AR L  D+DT  +    QAL     R E D+L+G  ++ +
Sbjct: 454 TLTKRMAEDLTEYFNEMGVAARYLHSDIDTMERMAIIQALR----RKEFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V+LV +L+AD    L       R+   L Q  GRA R    G+VL+
Sbjct: 510 GLDIPEVSLVSILDADKEGFL-------RSAGSLIQTFGRAAR-NVEGRVLM 553



 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 265 EQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQ 324
           +Q +A   +VS+I +     +L G+TGSGKT    Q+I      G+ A++L P  +L  Q
Sbjct: 17  DQPEAIGQIVSNIEAGVTDQVLLGVTGSGKTFTMAQVIARC---GRPALVLAPNKTLAAQ 73

Query: 325 MTERF 329
           +   F
Sbjct: 74  LYNEF 78


>UVRB_CHLPB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 690

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L +   +A +    + +  K      +L +   GE DIL+G  ++ +GLD 
Sbjct: 457 TLTKRMSEDLHDYLRKAGLRTRYLHSEIKSLERMQILRELRTGEIDILVGVNLLREGLDL 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD    L D +S       L Q+AGRA R
Sbjct: 517 PEVSLVAILDADKEGFLRDSKS-------LMQIAGRAAR 548


>MFD_BACSU RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1177

 Score = 50.1 bits (118), Expect = 7e-08
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 16/175 (9%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E++ P +   +Q ++   +   +   +P   LL G  G GKTEV ++    A+  GK   
Sbjct: 617 ESAFPYQETEDQLRSIHEIKKDMERERPMDRLLCGDVGYGKTEVAIRAAFKAIGDGKQVA 676

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
           LLVP   L  Q  E    RF D    + +L    +  E  +  + ++ G   +V+G    
Sbjct: 677 LLVPTTILAQQHYETIKERFQDYPINIGLLSRFRTRKEANETIKGLKNGTVDIVIGTHRL 736

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           +   +  K+LG++IIDEE             H  ++  ++A  +  TL   +ATP
Sbjct: 737 LSKDVVYKDLGLLIIDEEQRFGVT-------HKEKIKQIKANVDVLTL---TATP 781



 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 13/99 (13%)

Query: 560 QKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           ++  DE++ L P A++       T  +   + ++  F  GE+D+L+ T +I  G+D PNV
Sbjct: 846 ERKADEISMLVPDAKVAYAHGKMTENE--LETVMLSFLEGESDVLVSTTIIETGVDIPNV 903

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
             + V +AD           +     L Q+ GR GR+ +
Sbjct: 904 NTLIVFDAD-----------KMGLSQLYQLRGRVGRSNR 931


>UVRB_LACSS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 49.7 bits (117), Expect = 9e-08
 Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L EL  + R L  D+ T  +      ++     G+ D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKELGIKVRYLHSDIKTLERT----EIIRDLRLGKFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD       F  SER+   L Q  GRA R E  GQVL+
Sbjct: 524 ILDADK----EGFLRSERS---LIQTIGRASRNEH-GQVLL 556


>UVRB_YERPY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPG RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_YERP3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLSEHGAKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 520 ILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_THEYD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + +     +A+ L  D+DT  +      +L     G+ D+L+G  ++ +
Sbjct: 457 TITKKMAEDLTDYYTTVGIKAKYLHSDIDTLERV----EILKDLRLGKFDVLIGVNLLRE 512

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV + +AD       F  SER+   L Q AGRA R
Sbjct: 513 GLDLPEVSLVAIFDADK----EGFLRSERS---LIQTAGRASR 548


>UVRB_PASMU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L +   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 458 TLTKKMAEDLTDYLDEHGIRVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 513

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 514 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNLKGKAIL 557


>UVRB_NITEU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 695

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L + F     + R L  D+DT  +      ++     G+ D+L+G  ++ +
Sbjct: 457 TLTKRMAEDLTDYFSDHGIRVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLRE 512

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LVG+L+AD       F  SER+   L Q  GRA R
Sbjct: 513 GLDIPEVSLVGILDADK----EGFLRSERS---LIQTMGRAAR 548


>UVRB_HAMD5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LAE   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LAEQGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  SER+   L Q  GRA R
Sbjct: 522 DADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_FERNB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  + LAE   +  I  + + +         +L +   GE D+++G  ++ +GLD P 
Sbjct: 451 TKKTAEMLAEYLVEFNIRALYLHSELDAIKRVEVLKKLRAGEIDVVVGVNLLREGLDLPE 510

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           V+LV +L+ADT      F  SE T   L Q+ GR  R E  G+V++
Sbjct: 511 VSLVAILDADT----EGFLRSETT---LIQIIGRTARNEN-GKVIM 548


>UVRB_DESDG RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 682

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 40/117 (34%), Positives = 57/117 (48%), Gaps = 19/117 (16%)

Query: 547 CKSRSIR----YYGTGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGR 598
           C+SR+ R       T T++  ++L E        AR L  D+DT  +    QAL     R
Sbjct: 440 CRSRTARDERVLVTTLTKRMAEDLTEYLTSMGVSARYLHSDIDTMERMAIIQALR----R 495

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
            E D+L+G  ++ +GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 496 KEFDVLVGINLLREGLDIPEVSLVAILDADKEGFL-------RSTGSLIQTFGRAAR 545


>UVRB_METTH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 646

 Score = 48.9 bits (115), Expect = 2e-07
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQA----RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L + + +     R L  ++DT  +      ++D   RGE D L+G  ++ +
Sbjct: 450 TLTKRMAEDLTDYYSRVGVKVRYLHSEIDTLERV----EIIDDLRRGEFDCLVGVNLLRE 505

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V LV +L+AD       F  SE +   L Q  GRA R    G+VLI
Sbjct: 506 GLDLPEVALVAILDADK----EGFLRSETS---LIQTIGRAAR-NVNGEVLI 549


>UVRB_MANSM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 48.9 bits (115), Expect = 2e-07
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYLDEHGIRVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDIPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 525 ILDADK----EGFLRSERS---LIQTIGRAARNLKGKAIL 557


>MFD_BORBU RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1125

 Score = 48.9 bits (115), Expect = 2e-07
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 6/145 (4%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
           E+  P +  P+Q +A   +   + S +    LL G  G GKTEV ++    A+   K  I
Sbjct: 576 ESEFPYDETPDQIRAIKEIKEDMMSFKVMDRLLCGDVGFGKTEVAMRAAFKAVMGNKQVI 635

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
           +L P   L  Q    F  RF +   K+ +L   + N  +    ++++ G   +++G    
Sbjct: 636 VLSPTTILAEQHFNTFKKRFKNFPIKIEVLSRFIKNNAESRILKELKSGKIDIIIGTHKI 695

Query: 371 IFAPL--KNLGVMIIDEEHEAAYKQ 393
           +      KNLG++IIDEE     K+
Sbjct: 696 LSKKFTCKNLGLIIIDEEQRFGVKE 720


>UVRB_SHISS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SHIDS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SHIBS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SHIB3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALTY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALTI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALSV RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALPK RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALPC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALPB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALNS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALHS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALG2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALEP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALDC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALCH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALAR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_SALA4 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_KLEP7 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_KLEP3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ESCF3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ENT38 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOUT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOSM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOSE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOLU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOLI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOLC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOL6 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOL5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOK1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOHS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECODH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECOBW RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO8A RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO81 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO7I RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO5E RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO57 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO55 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO45 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO27 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ECO24 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_CITK8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVER----MEIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>RECG_STAES RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 682

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 45/172 (26%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 257 SRPLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILL 315
           S P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+
Sbjct: 256 SLPFELTDAQKVSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALM 315

Query: 316 VPEISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAI-- 371
           VP   L  Q  E  I  FG+   VA+L   +   ++     ++E G    ++G  + I  
Sbjct: 316 VPTEILAEQHAESLIQLFGNTMNVALLTGSVKGKKRRLLLEQLENGTIDCLIGTHALIQD 375

Query: 372 FAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
                N+G++I DE+H          R+   +  ILR +     ++  +ATP
Sbjct: 376 DVVFNNVGLVITDEQH----------RFGVNQRQILREKGAMTNVLFMTATP 417


>RECG_STAAR RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 15/170 (8%)

Query: 259 PLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+VP
Sbjct: 262 PFELTEAQKSSVNEIFRDLKAPIRMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVP 321

Query: 318 EISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL 375
              L  Q  E  IA FGD   VA+L   +   ++     ++E      ++G  + I   +
Sbjct: 322 TEILAEQHAESLIALFGDSMNVALLTGSVKGKKRKILLEQLENRTIDCLIGTHALIQDDV 381

Query: 376 --KNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              N+G++I DE+H          R+   +  +LR +     ++  +ATP
Sbjct: 382 IFHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMTATP 421


>UVRB_PECCP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R  +   +L
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNLRGKAIL 552


>UVRB_ERWCT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLQEHGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R  +   +L
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNLRGKAIL 552


>UVRB_DECAR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 690

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LA+   + R L  D+DT  +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 476 DFLADNGIKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLREGLDIPEVSLVA 531

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 532 ILDADK----EGFLRSERS---LIQTIGRAAR 556


>UVRB_COLP3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           +AR L  DVDT  +      ++  F  G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 471 KARYLHSDVDTVERV----EIIRDFRLGKFDVLVGINLLREGLDMPEVSLVAILDADK-- 524

Query: 632 NLPDFRSSERTFQLLTQVAGRAGR 655
               F  S+R+   L Q  GRA R
Sbjct: 525 --EGFLRSDRS---LIQTIGRAAR 543


>UVRB_AZOSE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 685

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LAE   + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 476 DYLAENGIRVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDIPEVSLVA 531

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 532 ILDADK----EGFLRSERS---LIQTIGRAAR 556


>MFD_BUCAI RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 812

 Score = 48.1 bits (113), Expect = 3e-07
 Identities = 37/144 (25%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD---KVAILH 341
           L+ G  G GKTE+ ++    A+   K   +LVP   L  Q  + F  RF +    + IL 
Sbjct: 290 LICGDVGFGKTEIAMRASFLAVSNKKQVAILVPTTLLAQQHYKNFKIRFSNWPVNINILS 349

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLK--NLGVMIIDEEHEAAYKQDSNPRY 399
              +  E+   ++  + G   +++G    +F  ++  +LG++IIDEEH          R+
Sbjct: 350 RFQTQKEQDLIFKHTKNGRINIIIGTHKLLFKNIEWCSLGLLIIDEEH----------RF 399

Query: 400 HAREVAILRAQYNQATLVLGSATP 423
                 I++  Y+   ++  +ATP
Sbjct: 400 GVSHKEIIKKIYSNIDILTLTATP 423


>UVRB_YERE8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGARVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_VIBF1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 454 TLTKRMAEDLTEYLDEHGVKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 545


>UVRB_SERP5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_PROMH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_PHOLL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_MYCA5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  +EL+    + +I    +    K      +L     G+ D+++G  ++ +G+D 
Sbjct: 453 TTTKKNAEELSLFLQEKKIKSAYIHDRFKIFERNEILKGLRMGKFDVVVGINLLKEGIDL 512

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+L+ VLNAD+   + D RS       L Q+ GRA R
Sbjct: 513 PEVSLICVLNADSTGLMRDTRS-------LIQIVGRAAR 544


>UVRB_HAEIN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L +   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 458 TLTKKMAEDLTDYLDEHGIRVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 513

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 514 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 549


>UVRB_HAEI8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L +   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 458 TLTKKMAEDLTDYLDEHGIRVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 513

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 514 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 549


>UVRB_GEOSL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D   +L  + R L  D+DT ++      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 463 DYYRDLGVRVRYLHSDIDTIQR----MQIIRDLRMGEFDVLVGINLLREGLDIPEVSLVA 518

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 519 ILDADKEGFLRSARS-------LIQTCGRAAR 543


>UVB2_MYCPU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  +EL+    + +I    +    K      +L     G+ D+++G  ++ +G+D 
Sbjct: 453 TTTKKNAEELSLFLQEKKIKSAYIHDRFKIFERNEILKGLRMGKFDVVVGINLLKEGIDL 512

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+L+ VLNAD+   + D RS       L Q+ GRA R
Sbjct: 513 PEVSLICVLNADSTGLMRDTRS-------LIQIVGRAAR 544


>RECG_PASMU RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 693

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 7/115 (6%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMT---ERFIARFGDKVAILH 341
           L+QG  GSGKT V        +D GK   L+ P   L  Q      R+    G +V  L 
Sbjct: 293 LVQGDVGSGKTLVXXXXXXXXIDNGKQVALMAPTEILAEQHATNFRRWFESLGIEVGWLA 352

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIF---APLKNLGVMIIDEEHEAAYKQ 393
             +    +  E  K+  G  Q+VVG   A+F       +L ++I+DE+H     Q
Sbjct: 353 GKVKGKARQTELEKIRTGQVQMVVGTH-ALFQDEVEFSDLALVIVDEQHRFGVHQ 406



 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 13/96 (13%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           ++L ++ P  RI    V    K    Q ++  F + E D+L+ T +I  G+D PN +L+ 
Sbjct: 509 EDLRKILPHLRIGL--VHGRMKPAEKQDIMQAFKQAEIDLLVATTVIEVGVDVPNASLMI 566

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKA 659
           + NA+  L L            L Q+ GR GR   A
Sbjct: 567 IENAE-RLGLSQ----------LHQLRGRVGRGTTA 591


>DBP3_YARLI RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 532

 Score = 47.8 bits (112), Expect = 3e-07
 Identities = 29/71 (40%), Positives = 38/71 (53%), Gaps = 12/71 (16%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           LD+F +GE +ILL T + A+GLD PNV L  V+N    L + D+              GR
Sbjct: 411 LDEFKKGEKNILLATDVAARGLDIPNVKL--VINLTFPLTVEDY----------VHRIGR 458

Query: 653 AGRAEKAGQVL 663
            GRA K GQ +
Sbjct: 459 TGRAGKTGQAI 469


>UVRB_VIBVY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 454 TLTKRMAEDLTEYLHEHDVKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 545


>UVRB_VIBVU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 454 TLTKRMAEDLTEYLHEHDVKVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 545


>UVRB_VIBPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 454 TLTKRMAEDLTEYLHEHDVRVRYLHSDIDTVERV----EIIRDLRLGEFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 545


>UVRB_THEAB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  ++LAE   +  I  + + +         +L +  RG+ ++++G  ++ +GLD P 
Sbjct: 450 TKKTAEKLAEYLIEMGIKALYIHSELDTIERVEVLKKLRRGDVEVVVGVNLLREGLDLPE 509

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+LV +L++DT      F  SE T   L Q+ GR  R
Sbjct: 510 VSLVAILDSDT----EGFLRSETT---LIQIIGRVAR 539


>UVRB_IDILO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++LA+   +     R L  D+DT  +      ++     G+ D+L+G  ++ +
Sbjct: 454 TLTKKMSEDLADYLDEHGIKVRYLHSDIDTVER----MEIIRDLRLGKFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  S+R+   L Q  GRA R
Sbjct: 510 GLDMPEVSLVAILDADK----EGFLRSDRS---LIQTIGRAAR 545


>UVRB_HERA2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 698

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + L  DVDT  +      +L     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 461 DYLKEMGVRTQYLHSDVDTIERID----ILRDLRLGVFDVLVGINLLREGLDLPEVSLVA 516

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD A     F  SE +   L Q+ GRA R
Sbjct: 517 ILDADKA----GFLRSESS---LVQIIGRAAR 541


>UVRB_COXBU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFTEHNVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTMGRAAR 543


>UVRB_COXBR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFTEHNVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTMGRAAR 543


>UVRB_COXBN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFTEHNVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTMGRAAR 543


>UVRB_COXB2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFTEHNVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTMGRAAR 543


>UVRB_CHLPD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 685

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L + F +  I    + +  K      +L +   G+ ++L+G  ++ +GLD 
Sbjct: 457 TLTKRMSEDLDDYFKKVGIRSRYLHSEIKSLERIQILRELRAGDVEVLVGVNLLREGLDL 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD    L + RS       L Q+AGRA R
Sbjct: 517 PEVSLVAILDADKEGFLRNTRS-------LMQIAGRAAR 548


>UVRB_CARHZ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L E F +     R L  D+DT  +      +L     G  D+L+G  ++ +
Sbjct: 451 TLTKKMAEDLTEYFREMGVKVRYLHSDIDTLERV----EILRDLRLGVFDVLVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       +  SER+   L Q  GRA R
Sbjct: 507 GLDLPEVSLVAILDADK----EGYLRSERS---LIQTIGRAAR 542


>UVRB_BORPD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LAE   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DFLAEHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDIPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR 552


>UVRB_AQUAE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  +E+A+   + +I    + +         L+ +   G  D+++G  ++ +GLD 
Sbjct: 455 TTTKRLAEEIADYLTERKIRAKYMHSELDAIERAQLIRELREGSIDVIVGVNLLREGLDL 514

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +++AD    L       R++Q L Q  GRA R
Sbjct: 515 PEVSLVAIMDADKEGFL-------RSYQALIQTIGRAAR 546


>DBP5_ASPFU RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 489

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 584 RKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERT 642
           R      A++DQF RGEA +L+ T ++A+G+D   V++  V+N D   L+ P+    +  
Sbjct: 355 RDPSVRDAIIDQFRRGEAKVLIATNVLARGIDVSTVSM--VINYDIPELHQPNVPGRQAD 412

Query: 643 FQLLTQVAGRAGRAEKAG 660
           FQ      GR GR  + G
Sbjct: 413 FQTYLHRIGRTGRFGRVG 430


>UVRB_SYNY3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 16/116 (13%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L + F +  I    L  ++ + ++    QAL D    GE D+L+G  ++ +
Sbjct: 453 TLTKRMAEDLTDYFSERGIKVQYLHSEIQSIQRIEILQALRD----GEFDVLIGVNLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           GLD P V+LV +++AD       F  +ER+   L Q  GRA R  + GQ ++ + N
Sbjct: 509 GLDLPEVSLVAIMDADK----EGFLRAERS---LIQTIGRAARHIR-GQAILYADN 556


>UVRB_NATTJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R +  ++DT  +      ++     G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLREMGIRVRYMHSEIDTLER----MEIIRDLRLGKFDVLVGINLLREGLDLPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L D RS       L Q  GRA R
Sbjct: 518 ILDADKEGYLRDERS-------LIQTMGRAAR 542


>UVRB_FUSNN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL E + +     + +  D+DT  +    +AL     +GE D+++G  ++ +
Sbjct: 454 TLTKKIAEELTEYYIELGVKVKYMHSDIDTLERIEIIRALR----KGEIDVIIGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV ++ AD    L   RS       L Q  GRA R
Sbjct: 510 GLDIPEVSLVAIMEADKEGFLRSRRS-------LVQTIGRAAR 545


>UVRB_EDWI9 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     GE D L+G  ++ +
Sbjct: 453 TLTKRMAEDLTEYLEEHGVRVRYLHSDIDTVER----MEIIRDLRLGEFDALVGINLLRE 508

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 509 GLDMPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_CLOBM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOBL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOBK RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOBJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOB6 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOB1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D+DT  +      ++    +GE  +L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGVKTRYLHSDIDTIER----MKIIHDLRKGEFHVLVGINLLREGLDIPEVALVT 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LIQTVGRAARNSESKVIM 550


>UVRB_CLOAB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  +   +  D+DT  +      ++     GE D+L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKDLGIKTTYMHSDIDTLER----MKIIKDVRTGEFDVLVGINLLREGLDIPEVALVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SER+   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSERS---LIQTIGRAARNSESRVIM 550


>UVRB_CHRVO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++LA+ + +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 457 TLTKRMAEQLADYYTEHGVKVRYLHSDIDTVERV----EIIRDLRLGMFDVLIGINLLRE 512

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 513 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 548


>UVRB_CAMFF RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 44/143 (30%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 557 TGTQKAYDELA----ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL     EL  + + +  D+D   +      L+    +GE D+L+G  ++ +
Sbjct: 455 TLTKKMSEELTRYYQELGIKVKYMHSDIDAVERN----ELIRGLRKGEFDMLVGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS--YNSQ 670
           GLD P V+LV VL+AD    L       R+   L Q  GRA R      +L  +   NS 
Sbjct: 511 GLDLPEVSLVAVLDADKEGFL-------RSRTSLIQTMGRAARNVNGTVILFANKITNSM 563

Query: 671 HYAIRFAK-DQDYEGFYAYEMGI 692
             AI   +  + Y+G Y  + GI
Sbjct: 564 KEAIDTTEARRKYQGDYNKKYGI 586


>UVRB_BORA1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LAE   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DFLAEHGVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLREGLDIPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR 552


>UVRB_ALISL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LAE   + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 467 LAEHGVKVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 522

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  SER+   L Q  GRA R
Sbjct: 523 DADK----EGFLRSERS---LIQAIGRAAR 545


>RHLB_ACTSZ RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 413

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 38/106 (35%), Positives = 52/106 (49%), Gaps = 16/106 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    ALL QF  GE DIL+ T + A+GL  P+VT   V N D    LPD R   
Sbjct: 287 DVAQKK--RLALLKQFTDGELDILVATDVAARGLHIPDVT--HVFNYD----LPDDRED- 337

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFY 686
                     GR GRA ++G  +  S+  + YA+     ++Y G +
Sbjct: 338 -----YVHRIGRTGRAGESGMSI--SFACEQYAMNLPAIEEYIGHH 376


>RECG_STAEQ RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 682

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 257 SRPLELNPEQRQARDAVVSSIGSS-QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILL 315
           S P EL   Q+ + + +   + +  +   LLQG  GSGKT V    +      G  + L+
Sbjct: 256 SLPFELTDAQKVSVNEIFRDLKAPIRMHRLLQGDVGSGKTIVAAICMYALKTAGYQSALM 315

Query: 316 VPEISLTPQMTERFIARFGD--KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAI-- 371
           VP   L  Q  E  +  FG+   VA+L   +   ++     ++E G    ++G  + I  
Sbjct: 316 VPTEILAEQHAESLMQLFGNTMNVALLTGSVKGKKRRLLLEQLENGTIDCLIGTHALIQD 375

Query: 372 FAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
                N+G++I DE+H          R+   +  ILR +     ++  +ATP
Sbjct: 376 DVVFNNVGLVITDEQH----------RFGVNQRQILREKGAMTNVLFMTATP 417


>DBP5_NEOFI RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 489

 Score = 47.0 bits (110), Expect = 6e-07
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 584 RKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERT 642
           R      A++DQF RGEA +L+ T ++A+G+D   V++  V+N D   L+ P     +  
Sbjct: 355 RDPSVRDAIIDQFRRGEAKVLIATNVLARGIDVSTVSM--VINYDIPELHQPSVPGRQAD 412

Query: 643 FQLLTQVAGRAGRAEKAG 660
           FQ      GR GR  + G
Sbjct: 413 FQTYLHRIGRTGRFGRVG 430


>UVRB_PSEPK RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LA+   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLADHDVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSERS---LIQTIGRAAR 542


>UVRB_PSEPF RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LA+   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLADHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSERS---LIQTIGRAAR 542


>UVRB_PSEF5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D LA+   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLADHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSERS---LIQTIGRAAR 542


>UVRB_PHOPR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 674

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++LAE   +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 454 TLTKRMSEDLAEYLAEHNVKVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLRE 509

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 545


>UVRB_PARUW RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 52/179 (29%), Positives = 79/179 (44%), Gaps = 35/179 (19%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L +L  +A+ L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 468 LNDLNVKAKYLHSDIDTIERV----QIIRDLRLGVFDVLVGINLLREGLDIPEVSLVAIL 523

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKD-----Q 680
           +AD       F  SE +   L Q  GRA R    G+V++       YA +  K      +
Sbjct: 524 DADK----EGFLRSETS---LIQTCGRAAR-NAEGRVIM-------YADKITKSIKRTLE 568

Query: 681 DYEGFYAYEMGIRRQLGYPPYYFTIGIT---------LSH--KKEEEVFKRAYEVMNIL 728
             E   A +M    Q G  P      I+         ++H  K EEE+FK A E  + L
Sbjct: 569 ITESRRALQMRYNEQHGITPRTVKREISVLMESEEDQVTHPTKLEEEIFKAAEEAHHYL 627


>UVRB_METST RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 649

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 16/114 (14%)

Query: 559 TQKAYDELAELF----PQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T+K  ++L + +     +AR L  ++ T  +      ++D+  RG+ D L+G  ++ +GL
Sbjct: 452 TKKMAEDLTDYYIKMNVKARYLHSEISTLERT----EIIDELRRGDFDCLVGVNLLREGL 507

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           D P V LV +L+AD    L       R+   L Q  GRA R    G+V++ + N
Sbjct: 508 DLPEVALVAILDADKEGFL-------RSQTSLIQTIGRAAR-NVNGRVILYADN 553


>UVRB_GLOVI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 680

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  ++    +    QAL     +G+ D+L+G  ++ +
Sbjct: 465 TLTKRMAEDLTEYFQERGVKVRYLHSEIQAIERIEILQALR----QGDFDVLIGVNLLRE 520

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R  + GQV++
Sbjct: 521 GLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAARHVR-GQVIM 564


>UVRB_COXB1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFTEHNVRVRYLHSDIDTVERV----EIIRDLRLGVFDMLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSERS---LIQTMGRAAR 543


>UVRB_CLOPS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 659

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L +L  +A  +  D+DT  +      ++ +   GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 LKDLNVKATYMHSDIDTLER----MKIIRELRLGEVDVLIGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>UVRB_CLOPE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 659

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L +L  +A  +  D+DT  +      ++ +   GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 LKDLNVKATYMHSDIDTLER----MKIIRELRLGEVDVLIGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>UVRB_CLOP1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 659

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L +L  +A  +  D+DT  +      ++ +   GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 LKDLNVKATYMHSDIDTLER----MKIIRELRLGEVDVLIGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>RECG_HAEIN RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 693

 Score = 46.6 bits (109), Expect = 8e-07
 Identities = 39/137 (28%), Positives = 56/137 (40%), Gaps = 7/137 (5%)

Query: 263 NPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLT 322
           N ++R   D     I       L+QG  GSGK           +D GK   L+ P   L 
Sbjct: 271 NAQKRVVSDIEQDLIKDYPMMRLVQGDVGSGKXXXXXXXXXXXIDNGKQVALMAPTEILA 330

Query: 323 PQMT---ERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIF---APLK 376
            Q      R+   FG +V  L   +    +  E  K++ G  Q+VVG   A+F       
Sbjct: 331 EQHANNFRRWFKPFGIEVGWLAGKVKGKSRQAELEKIKTGAVQMVVGTH-ALFQEEVEFS 389

Query: 377 NLGVMIIDEEHEAAYKQ 393
           +L ++IIDE+H     Q
Sbjct: 390 DLALVIIDEQHRFGVHQ 406


>UVRB_THEEB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  +++   +      +L+   +G+ D+L+G  ++ +
Sbjct: 452 TLTKRMAEDLTEYFQERGVRVRYLHSEINAIERI----EILEALRQGDFDVLIGVNLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R  +   +L
Sbjct: 508 GLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAARHVRGQAIL 551


>UVRB_HELHP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDEL----AELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL    AEL  + R +  D+D   +    +AL      GE D+L+G  ++ +
Sbjct: 455 TLTKKMAEELSKYYAELGIKVRYMHSDIDAIERNHLIRALR----LGEFDVLIGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+L+ +++AD       F  SE +   L Q  GRA R
Sbjct: 511 GLDLPEVSLIAIMDADK----EGFLRSETS---LIQTMGRAAR 546


>UVRB_DEHE1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 12/106 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           ++K  D L E+  +   L  +VDT  +      +L     G  D+++G  ++ +GLD P 
Sbjct: 456 SEKLADYLVEMGIKTHYLHSEVDTLERV----EILRDLRLGVYDVIVGINLLREGLDLPE 511

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           V+LV +L+AD    L       R+ Q L Q  GRA R    GQV++
Sbjct: 512 VSLVAILDADKEGYL-------RSEQALIQTMGRAAR-HVDGQVIM 549


>UVRB_CYAP7 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 665

 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L E F +  +    +            L     GE D+L+G  ++ +GLD 
Sbjct: 451 TLTKRMAEDLTEYFQERGVKVQYLHXXXXXXXXXXXLQNLREGEFDVLIGVNLLREGLDL 510

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           P V+LV +L+AD       F  +ER+   L Q  GRA R    GQ ++ + N
Sbjct: 511 PEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR-HIQGQAILYADN 554


>UVRB_THICR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  + L E   +     R L  D+DT  +      ++     GE D+L+G  ++ +
Sbjct: 452 TLTKRMAENLTEYLEEHNVRVRYLHSDIDTVERI----EIIRDLRLGEFDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V+LV +L+AD       F  S+R+   L Q  GRA R   AG+ ++
Sbjct: 508 GLDIPEVSLVAILDADK----EGFLRSDRS---LIQTIGRAAR-NVAGKAIL 551


>UVRB_PSYIN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 14/132 (10%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   +AR L  DV+T  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 464 DYLHEHGIKARYLHSDVNTVERV----EIIRDLRLGIFDVLIGINLLREGLDIPEVSLVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS--YNSQHYAIRFAKD-Q 680
           +L+AD       F  SER+   L Q  GRA R      +L  +    S   AI+  +D +
Sbjct: 520 ILDADK----EGFLRSERS---LIQTMGRAARNLNGKAILYAARITGSMQKAIKVTEDRR 572

Query: 681 DYEGFYAYEMGI 692
           + +  +  E GI
Sbjct: 573 ELQNKFNIENGI 584


>UVRB_NITOC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 687

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 15/101 (14%)

Query: 559 TQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T++  ++L +   Q     R L  D+DT  +      ++     G+ D+L+G  ++ +GL
Sbjct: 454 TKRMAEDLTQYLEQHEVRVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGL 509

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           D P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 510 DIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 543


>UVRB_METS3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 655

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D  A++  + R +  ++DT  +      ++D   RG  D+L+G  ++ +GLD P V+LV 
Sbjct: 461 DYYAKIGVKVRYMHSEIDTLERID----IVDDLRRGTFDVLVGVNLLREGLDLPEVSLVA 516

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD       F  +E +   L Q  GRA R    GQV++
Sbjct: 517 ILDADK----EGFLRNETS---LIQTIGRAAR-NINGQVIM 549


>UVRB_ERWT9 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 674

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L E   + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LTEHGERVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  SER+   L Q  GRA R
Sbjct: 522 DADK----EGFLRSERS---LIQTIGRAAR 544


>UVRB_ENTFA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 665

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + F +     + L  D+ T  +      ++     GE DIL+G  ++ +
Sbjct: 457 TLTKKMAEDLTDYFKELGLKVKYLHSDIKTLERT----EIIRDLRLGEFDILIGINLLRE 512

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           G+D P V+L+ +L+AD       F  SER+   L Q  GRA R
Sbjct: 513 GIDVPEVSLIAILDADK----EGFLRSERS---LVQTMGRAAR 548


>UVRB_BORPE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DFLSEHGVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLREGLDIPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR 552


>UVRB_BORPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DFLSEHGVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGISLLREGLDIPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR 552


>UVRB_BORBR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DFLSEHGVRVRYLHSDIDTVERV----EIIRDLRLGVFDVLVGINLLREGLDIPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR 552


>UVRB_ACTP2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 32/92 (34%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 467 DYLDEHGVRVRYLHSDIDTVERV----EIIHDLRMGMFDVLVGINLLREGLDMPEVSLVA 522

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 523 ILDADK----EGFLRSERS---LIQTIGRAAR 547


>RECG_TREPA RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 686

 Score = 45.8 bits (107), Expect = 1e-06
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQPPF-LLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P EL  +Q++    +   +   +P   L+QG  GSGKT V        +++G    LL P
Sbjct: 268 PFELTVDQKRVITEITQDLEREEPMARLIQGDVGSGKTLVAFFSCLKIIEQGGQVALLAP 327

Query: 318 EISLTPQMTE---RFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAP 374
              L  Q  +   R +A  G ++A L   + +  +      +  G+  +VVG  +     
Sbjct: 328 TELLARQHADTAARLLAPIGIRLAFLTGNVKSEGRAYLLEALVAGEINLVVGTHALFSKS 387

Query: 375 LK--NLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
           ++  +L ++IIDE+H     Q S      RE      Q     +++ SATP
Sbjct: 388 VRYHDLRLVIIDEQHRFGVLQRSALIQKGREG---NPQGKTPHIIMMSATP 435


>UVRB_PSEAE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 45.4 bits (106), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLGDHDVRVRYLHSDIDTVERV----EIIRDLRAGAFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SER+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSERS---LIQTIGRAAR 542


>UVRB_MYCGE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 656

 Score = 45.4 bits (106), Expect = 2e-06
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 7/109 (6%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T K  + L E   + +I    +    K      L++   RGE + L+G  ++ +GLD P 
Sbjct: 458 TIKMAENLTEYLKERKIKVAYIHKDIKALERLLLINDLRRGEYECLVGINLLREGLDVPE 517

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSY 667
           V LV + +AD    +P     ER+   L Q+ GRA R E    V+  ++
Sbjct: 518 VALVCIFDAD----IPGLPRDERS---LIQIIGRAARNEHGRVVMYANH 559


>UVRB_KOSOT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 45.4 bits (106), Expect = 2e-06
 Identities = 47/162 (29%), Positives = 74/162 (45%), Gaps = 17/162 (10%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L EL  +A  L  ++DT  +      +L +   G  D+++G  ++ +GLD P V+LV ++
Sbjct: 463 LNELGIRAEYLHSELDTVERV----EVLKKLREGSVDVVVGVNLLREGLDLPEVSLVAIM 518

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYAIRFAKDQDY 682
           +AD       F  SE T   L Q  GRA R    G+VL+ +    NS   AI     +  
Sbjct: 519 DADK----EGFLRSETT---LIQTIGRAAR-NINGKVLLYADRITNSMKRAIEETNRRRM 570

Query: 683 EG-FYAYEMGIRRQLGYPPYYFTIGITLSHKKEE-EVFKRAY 722
           +   Y  E  I+ +    P Y  I    +  +E+ E+ K  Y
Sbjct: 571 KQLMYNIEHDIKPESIVKPLYENIFEEFADNEEKIEIAKNTY 612


>UVRB_CYAP4 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 665

 Score = 45.4 bits (106), Expect = 2e-06
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 16/116 (13%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F     + R L  ++    +      +L+   +G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEDLTEYFQDRGVRVRYLHSEIGAIERI----EILEDLRKGTFDVLIGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R  + GQ ++ + N
Sbjct: 507 GLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAARHVR-GQAILYADN 554


>UVRB_ACIAD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.4 bits (106), Expect = 2e-06
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L E   +   L  D+DT  +      ++ +   G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 469 LKEYGVKVAYLHSDIDTVERV----KIIHELRTGVYDVLVGINLLREGLDMPEVSLVAIL 524

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SER+   L Q  GRA R  K   +L
Sbjct: 525 DADK----EGFLRSERS---LIQTIGRAARNIKGKAIL 555


>UVRB_TROW8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  +EL +   +A +    L  D+DT  +      LL     G  D+L+G  ++ +
Sbjct: 456 TLTKRMAEELTDFLSEAGVNVSYLHSDIDTLHRV----ELLTSLRMGRIDVLVGINLLRE 511

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  S  +F    Q  GRA R
Sbjct: 512 GLDLPEVSLVAILDADK----EGFLRSTTSF---IQTIGRAAR 547


>UVRB_STRCO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 712

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D   EL  Q R L  DVDT                GE D+L+G  ++ +GLD P V+LV 
Sbjct: 471 DYFVELGIQVRYLHSDVDTXXXXXXXXXXX----AGEYDVLVGINLLREGLDLPEVSLVA 526

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQV 662
           +L+AD    L       R+   L Q  GRA R   +GQV
Sbjct: 527 ILDADKEGFL-------RSGTSLIQTIGRAAR-NVSGQV 557


>UVRB_NEIMB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D  +EL  + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYYSELGIKVRYLHSDIDTVERV----EIIRDLRLGLFDVLVGINLLREGLDIPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 525 ILDADKEGFLRSHRS-------LIQTIGRAAR 549


>UVRB_NEIMA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D  +EL  + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYYSELGIKVRYLHSDIDTVERV----EIIRDLRLGLFDVLVGINLLREGLDIPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 525 ILDADKEGFLRSHRS-------LIQTIGRAAR 549


>UVRB_NEIGO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D  +EL  + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYYSELGIKVRYLHSDIDTVERV----EIIRDLRLGLFDVLVGINLLREGLDIPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 525 ILDADKEGFLRSHRS-------LIQTIGRAAR 549


>UVRB_NEIG1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D  +EL  + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYYSELGIKVRYLHSDIDTVERV----EIIRDLRLGLFDVLVGINLLREGLDIPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 525 ILDADKEGFLRSHRS-------LIQTIGRAAR 549


>UVRB_LACPL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + F     + R L  D+ T  +      ++     G+ D+L+G  ++ +
Sbjct: 457 TLTKKMAEDLTDYFKDLGIKVRYLHSDIKTLERT----QIIRDLRLGKFDVLVGINLLRE 512

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           G+D P V+LV +L+AD       F  +ER+   L Q  GRA R E    ++
Sbjct: 513 GIDVPEVSLVAILDADK----EGFLRNERS---LIQTIGRAARNEHGSVIM 556


>UVRB_CLOBB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           + EL  +A  +  D+DT  +      ++     GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 MIELGVKATYMHSDIDTIER----MKIIRDLRLGEYDVLVGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>UVRB_CLOBA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           + EL  +A  +  D+DT  +      ++     GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 MIELGVKATYMHSDIDTIER----MKIIRDLRLGEYDVLVGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>UVRB_CHLTE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 684

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  ++L   F +  +    + +  K      +L +   G+ ++L+G  ++ +GLD 
Sbjct: 459 TLTKRMSEDLHAYFRKLGLRSQYLHSEIKSLERMQILRELRAGDIEVLVGVNLLREGLDL 518

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V LV +L+AD    L D  S       L Q+AGRA R
Sbjct: 519 PEVALVAILDADKEGFLRDATS-------LMQIAGRAAR 550


>RHLB_VIBHB RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 437

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF RGE D+L+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--REKILEQFTRGEVDLLVATDVAARGLHIPQVT--HVFNFDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEDYAINLPPIEEY 374


>UVRB_THET8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 665

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           +AR L  ++D   +    QAL+     G  D L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 466 RARYLHHELDAFER----QALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADK-- 519

Query: 632 NLPDFRSSERTFQLLTQVAGRAGR 655
               F  SER+   L Q  GRA R
Sbjct: 520 --EGFLRSERS---LIQTIGRAAR 538


>UVRB_STRAW RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 713

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D   EL  Q R L  DVDT                GE D+L+G  ++ +GLD P V+LV 
Sbjct: 471 DYFLELGIQVRYLHSDVDTXXXXXXXXXXX----AGEYDVLVGINLLREGLDLPEVSLVA 526

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQV 662
           +L+AD    L       R+   L Q  GRA R   +GQV
Sbjct: 527 ILDADKEGFL-------RSGTSLIQTIGRAAR-NVSGQV 557


>UVRB_RALSO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 696

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 472 TLTKRMAEQLTEFLSENGVKVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLRE 527

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 528 GLDIPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 563


>UVRB_RALEJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 695

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 471 TLTKRMAEQLTEFLSENGVKVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLRE 526

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 527 GLDIPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 562


>UVRB_METMP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 646

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  +EL E   +    AR L  D+DT  +      ++     G+ D L+G  ++ +
Sbjct: 450 TLTKRLAEELTEYLAKRNVKARYLHSDIDTIERT----EIIRNLRLGKFDCLVGINLLRE 505

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V  VG+L+AD    L + +S       L Q  GRA R   +  VL
Sbjct: 506 GLDIPEVGFVGILDADKEGFLRNDKS-------LIQTIGRAARNANSKVVL 549


>UVRB_LEPBL RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + +     Q   L  +V+T  +     A++    +G  D+L+G  ++ +
Sbjct: 451 TLTKKMSEDLTDYYKEIGLQVAYLHSEVETLDRV----AIIRDLRKGIYDVLIGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 507 GLDIPEVSLVAILDADKEGFLRNYKS-------LIQTVGRAAR 542


>UVRB_LEPBJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + +     Q   L  +V+T  +     A++    +G  D+L+G  ++ +
Sbjct: 451 TLTKKMSEDLTDYYKEIGLQVAYLHSEVETLDRV----AIIRDLRKGIYDVLIGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 507 GLDIPEVSLVAILDADKEGFLRNYKS-------LIQTVGRAAR 542


>UVRB_LACAC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 683

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  + R L  D+ T  +      +L     G+ D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKDLGIKVRYLHSDIKTLER----MQILRDLRLGKFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       R ++ L Q  GRA R
Sbjct: 524 ILDADKEGFL-------RAYRPLVQTMGRAAR 548


>UVRB_BORGA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 36/128 (28%), Positives = 65/128 (50%), Gaps = 17/128 (13%)

Query: 557 TGTQKAYDELAE----LFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L E    L  +A+ L  ++DT  +      ++    + E D+++G  ++ +
Sbjct: 451 TLTKKMSEDLTEYLVSLGVRAKYLHSELDTLERV----EVISLLRKSEIDVIVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +L+AD    L       R+   L Q  GRA R   +  ++I  Y++   
Sbjct: 507 GLDIPEVSLVAILDADKVGFL-------RSTTSLIQTIGRAAR--NSNGLVIMYYDTISV 557

Query: 673 AIRFAKDQ 680
           A+R A ++
Sbjct: 558 AMREAIEE 565


>UVRB_BORAP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 58/241 (24%), Positives = 109/241 (45%), Gaps = 27/241 (11%)

Query: 450 TIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECG- 508
           T+P+ + +   DY  +    NF   L  A+++R +K ++   ++N+  + S     E   
Sbjct: 342 TLPQFRGMYNGDYSRKLNLVNFGFRLPAALENRPLKYDEFDALINQVVFVSATPGFEENE 401

Query: 509 ----TVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIP-QVCPNCKSRSIRYYGTGTQKAY 563
               TVD      I  T  +D + +  H  G  +D+  ++      +      T T+K  
Sbjct: 402 KSSVTVDQI----IRPTGLVDPEIITRHSDGQMEDLYIEIQKRVALKERVLITTLTKKMS 457

Query: 564 DELAE----LFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           ++L E    L  +A+ L  ++DT  +      ++    + E D+++G  ++ +GLD P V
Sbjct: 458 EDLTEYLVTLGVKAKYLHSELDTLERV----EVISLLRKSEIDVIVGINLLREGLDIPEV 513

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKD 679
           +LV +L+AD    L       R+   L Q  GRA R   +  ++I  Y+    A+R A +
Sbjct: 514 SLVAILDADKVGFL-------RSATSLIQTIGRAAR--NSNGLVIMYYDKISVAMREAIE 564

Query: 680 Q 680
           +
Sbjct: 565 E 565


>UVRB_ANASP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 665

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  ++++ ++      +L    +G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEDLTEYLQEHGVKVRYLHSEINSIQRI----EILQDLRQGSFDVLVGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +++AD       F  +ER+   L Q  GRA R  + GQ ++ + N    
Sbjct: 507 GLDLPEVSLVAIMDADK----EGFLRAERS---LIQTIGRAARHIR-GQAILYADNMTDS 558

Query: 673 AIRFAKDQD 681
            I+  ++ D
Sbjct: 559 MIKAIEETD 567


>RHLB_ALISL RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 434

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L++F +GE DIL+ T + A+GL  P VT   V N D      D+    
Sbjct: 289 DVPQKK--RERILEEFTKGEVDILVATDVAARGLHIPQVT--HVFNFDLPNEAEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA ++G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGESGNSI--SFACEEYAINLPAIEEY 374


>RECG_BACSU RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 682

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 36/150 (24%), Positives = 60/150 (40%), Gaps = 5/150 (3%)

Query: 263 NPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLT 322
           N + R  R+         +   LLQG  GSGKT             G    L+VP   L 
Sbjct: 259 NAQSRVLREITADMSSPYRMNRLLQGDVGSGKTXXXXXXXXXXXXSGYQGALMVPTEILA 318

Query: 323 PQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAI--FAPLKN 377
            Q  +  ++ F      VA+L S +    + +   ++  G+  ++VG  + I      K 
Sbjct: 319 EQHADSLVSLFEKWDVSVALLTSSVKGKRRKELLERLAAGEIDILVGTHALIQDEVEFKA 378

Query: 378 LGVMIIDEEHEAAYKQDSNPRYHAREVAIL 407
           L ++I DE+H    +Q    R   ++  +L
Sbjct: 379 LSLVITDEQHRFGVEQRKKLRNKGQDPDVL 408


>DED1_MAGGR RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 671

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  DEL++      +    +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 458 TKRNADELSDFLQNQNLPATSIHGDRTQRERERALEMFRTGRCPILVATAVAARGLDIPN 517

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 518 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 547


>DED1_KLULA RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 627

 Score = 44.7 bits (104), Expect = 3e-06
 Identities = 31/102 (30%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++A D L +           +   R +G  +  L  F  G A IL+ T + A+GLD PN
Sbjct: 425 TKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGRATILVATAVAARGLDIPN 484

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 485 VT--HVINFDLPNDIDDY----------VHRIGRTGRAGNTG 514


>UVRB_TREDE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L  L  + + +  +V+T  +      +L     GE D+L+G  ++ +G+D P V+ +G
Sbjct: 461 DYLTGLGLKVKYIHSEVETIERV----EILKGLRAGEFDVLIGINLLREGIDLPEVSFIG 516

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD    L       R+   L Q+ GRA R E    V+
Sbjct: 517 ILDADKIGFL-------RSTTSLIQIVGRAARNENGKVVM 549


>UVRB_SYNJB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 695

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L  F  G  D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q+ G
Sbjct: 512 ILQDFREGAFDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQMIG 564

Query: 652 RAGRAEKAGQVLIQSYNSQHYAIRFAKDQ 680
           RA R  +   V+     +   A   A+ Q
Sbjct: 565 RAARNVRGMVVMYADTMTSSMARAIAETQ 593


>UVRB_PSEU2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLSDHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  S+R+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSDRS---LIQTIGRAAR 542


>UVRB_PSESM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLSDHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  S+R+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSDRS---LIQTIGRAAR 542


>UVRB_PSEHT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L+E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V LV 
Sbjct: 464 DYLSEHNVKVRYLHSDIDTVERV----EIIRDLRAGVFDVLVGINLLREGLDMPEVALVA 519

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       + Q  GRA R
Sbjct: 520 ILDADKEGFLRSARS-------IIQTVGRAAR 544


>UVRB_PSE14 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLSDHGVRVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDMPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  S+R+   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSDRS---LIQTIGRAAR 542


>UVRB_METBU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L E+  + R +  D+DT  +      ++    +G  D+L+G  ++ +GLD P V  V +L
Sbjct: 466 LLEMGIRVRYMHSDIDTLERA----EIIRDLRKGVFDVLVGINLLREGLDIPEVAFVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  SER+   L Q  GRA R
Sbjct: 522 DADK----EGFLRSERS---LIQTMGRASR 544


>UVRB_LEPIN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + + +  +    L  +V+T  + G    ++    +G  D+L+G  ++ +
Sbjct: 451 TLTKKMSEDLTDYYEEIGLKVAYLHSEVETLDRVG----IIRDLRKGIYDVLIGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 507 GLDIPEVSLVAILDADKEGFLRNYKS-------LIQTIGRAAR 542


>UVRB_LEPIC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L + + +  +    L  +V+T  + G    ++    +G  D+L+G  ++ +
Sbjct: 451 TLTKKMSEDLTDYYEEIGLKVAYLHSEVETLDRVG----IIRDLRKGIYDVLIGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 507 GLDIPEVSLVAILDADKEGFLRNYKS-------LIQTIGRAAR 542


>UVRB_GEMAT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 700

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L ++  + R +  D+D   +      ++     GE D+L+G  ++ +GLD P V+LV 
Sbjct: 463 DYLQQMGVRVRYMHSDIDAIER----MEIVRGLRLGEFDVLVGINLLREGLDMPEVSLVA 518

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  S+R+   L Q  GRA R
Sbjct: 519 ILDADQ----EGFLRSDRS---LIQTIGRAAR 543


>UVRB_EUBR3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 33/91 (36%), Positives = 48/91 (52%), Gaps = 13/91 (14%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQAL-LDQFGRGEADILLGTQMIAKGLDFPNVTLVGV 624
           +AEL  + + L  D+DT  +    + L LD F     D+L+G  ++ +GLD P +TLV +
Sbjct: 463 MAELGIRVKYLHSDIDTLERAEIIRDLRLDVF-----DVLVGINLLREGLDIPEITLVAI 517

Query: 625 LNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           L+AD       F  SE +   L Q  GRA R
Sbjct: 518 LDADK----EGFLRSETS---LIQTIGRAAR 541


>UVRB_CLOB8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L EL  +   +  D+DT  +      ++     GE D+L+G  ++ +GLD P V LV +L
Sbjct: 464 LIELGVKTTYMHSDIDTIER----MKIIRDLRLGEYDVLVGINLLREGLDIPEVALVAIL 519

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 520 DADK----EGFLRSETS---LIQTIGRAARNSESKVIM 550


>UVRB_BORBZ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 17/128 (13%)

Query: 557 TGTQKAYDELAE----LFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L E    L  +A+ L  ++DT  +      ++    + E D+++G  ++ +
Sbjct: 451 TLTKKMSEDLTEYLVNLGVRAKYLHSELDTLERV----EVISLLRKSEIDVIVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +L+AD    L       R+   L Q  GRA R   +  ++I  Y+    
Sbjct: 507 GLDIPEVSLVAILDADKVGFL-------RSTTSLIQTIGRAAR--NSNGLVIMYYDKISL 557

Query: 673 AIRFAKDQ 680
           A+R A ++
Sbjct: 558 AMREAIEE 565


>UVRB_BORBU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 17/128 (13%)

Query: 557 TGTQKAYDELAE----LFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  ++L E    L  +A+ L  ++DT  +      ++    + E D+++G  ++ +
Sbjct: 456 TLTKKMSEDLTEYLVNLGVRAKYLHSELDTLERV----EVISLLRKSEIDVIVGINLLRE 511

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           GLD P V+LV +L+AD    L       R+   L Q  GRA R   +  ++I  Y+    
Sbjct: 512 GLDIPEVSLVAILDADKVGFL-------RSTTSLIQTIGRAAR--NSNGLVIMYYDKISL 562

Query: 673 AIRFAKDQ 680
           A+R A ++
Sbjct: 563 AMREAIEE 570


>UVRB_ACAM1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 44.3 bits (103), Expect = 4e-06
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 16/116 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E F +     R L  +++  ++      +L     G  D+L+G  ++ +
Sbjct: 451 TLTKRMAEDLTEYFEERGVRVRYLHSEINAIQRI----EILRDLREGVFDVLIGVNLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           GLD P V+LV +L+AD       F  +ER+   L Q  GRA R  + GQ ++ + N
Sbjct: 507 GLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAARHVR-GQAILYADN 554


>UVRB_THETN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  D++T  +      ++     G+ D+L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKEMGIRVRYLHSDIETIERV----EIIRDLRLGKFDVLIGINLLREGLDIPEVALVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SE +   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSETS---LIQTIGRAAR 542


>UVRB_GEOKA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +   +A I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 543


>UVRB_BURPS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 696

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LA+   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 485 LADHGVKVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDIPEVSLVAIL 540

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  +ER+   L Q  GRA R
Sbjct: 541 DADK----EGFLRAERS---LIQTIGRAAR 563


>UVRB_BURMA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 696

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LA+   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 485 LADHGVKVRYLHSDIDTVERV----EIIRDLRLGTFDVLVGINLLREGLDIPEVSLVAIL 540

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  +ER+   L Q  GRA R
Sbjct: 541 DADK----EGFLRAERS---LIQTIGRAAR 563


>UVRB_BACCA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +   +A I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 543


>RHLB_VIBPA RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 437

 Score = 43.9 bits (102), Expect = 5e-06
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--REKILEQFTKGDVDILVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEEYAINLPAIEEY 374


>UVRB_WOLSU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 16/110 (14%)

Query: 559 TQKAYDEL----AELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T+K  +EL    A+L  + R +  ++D   +      ++     GE D+L+G  ++ +GL
Sbjct: 457 TKKMAEELTKYYADLGIKVRYMHSEIDAIERN----QIIRGLRTGEFDVLVGINLLREGL 512

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           D P V+LV +L+AD       F  SE +   L Q  GRA R    G+VL+
Sbjct: 513 DLPEVSLVAILDADK----EGFLRSETS---LIQTMGRAAR-NLNGRVLL 554


>UVRB_THELT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 656

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  ++L+E   +  I  + + +         +L +  RG+ D ++G  ++ +GLD P 
Sbjct: 450 TKKTAEKLSEYLVEMGIKSLYIHSELDAIERIEVLKKLRRGDVDAVVGINLLREGLDLPE 509

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+LV +L++D       F  SE T   L Q+ GR  R
Sbjct: 510 VSLVAILDSDK----EGFLRSETT---LIQIIGRVAR 539


>UVRB_SYMTH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 659

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L EL  + R +  DV+T  +      ++     G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LKELGVKVRYMHSDVETIER----MQIVRDLRLGVFDVLVGINLLREGLDIPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD       F  +ER+   L Q  GRA R
Sbjct: 522 DADK----EGFLRAERS---LIQTIGRAAR 544


>UVRB_MYCUA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 701

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 32/92 (34%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  +VDT                GE D+L+G  ++ +GLD P V+LV 
Sbjct: 465 DYLLEMGIRVRYLHSEVDTXXXXXXXXXXXX----GEYDVLVGINLLREGLDLPEVSLVA 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 521 ILDADKEGFLRSARS-------LIQTIGRAAR 545


>UVRB_MYCPU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 8/107 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  +EL   F +       + +  K      +L +  +G  D+++G  ++ +G+D 
Sbjct: 450 TTTKRFSEELTRYFQEKGEKVAYIHSDHKTFERNEILRKLRKGVYDLVIGINLLREGIDL 509

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           P V+LV +L+AD         S  R  + L Q+ GRA R   +G+V+
Sbjct: 510 PEVSLVIILDADK-------ESFLRNTKSLIQIVGRASR-NSSGKVI 548


>UVRB_LACCB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L ++  + R L  D+ T  +      ++     G+ D+L+G  ++ +G+D P V+L+ 
Sbjct: 470 DYLKDMGIKVRYLHSDIKTLERT----QIIRDLRLGKFDVLIGINLLREGIDVPEVSLIA 525

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD       F  +ER+   L Q  GRA R E  G+V++
Sbjct: 526 ILDADK----EGFLRAERS---LIQTIGRASRNEH-GKVIM 558


>UVRB_LACC3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L ++  + R L  D+ T  +      ++     G+ D+L+G  ++ +G+D P V+L+ 
Sbjct: 470 DYLKDMGIKVRYLHSDIKTLERT----QIIRDLRLGKFDVLIGINLLREGIDVPEVSLIA 525

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           +L+AD       F  +ER+   L Q  GRA R E  G+V++
Sbjct: 526 ILDADK----EGFLRAERS---LIQTIGRASRNEH-GKVIM 558


>UVRB_CALS8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  + L E       + R +  D+DT  +      ++     G+ D+L+G  ++ +
Sbjct: 451 TLTKKMAESLTEYLKDVGIRVRYMHSDIDTIER----MQIIRDLRLGKFDVLVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SE +   L Q  GRA R
Sbjct: 507 GLDLPEVSLVAILDADK----EGFLRSETS---LIQTIGRAAR 542


>UVRB_BACCR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +      I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMSEDLTDYLKDVGIKVTYLHSEIKTLERIEIIRDLRLGKFDVLVGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           P V+LV +L+AD       F  SER+   L Q  GRA R E  G+V++
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNEN-GRVIM 551


>UVRB_ANATD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFP----QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  + L E       + R +  D+DT  +      ++     G+ D+L+G  ++ +
Sbjct: 451 TLTKKMAESLTEYLKDVGIRVRYMHSDIDTIER----MQIIRDLRLGKFDVLVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SE +   L Q  GRA R
Sbjct: 507 GLDLPEVSLVAILDADK----EGFLRSETS---LIQTIGRAAR 542


>RHLB_VIBSL RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 436

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G+ D+L+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--REKILEQFTKGDVDLLVATDVAARGLHIPQVT--HVFNFDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA ++G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SFACEDYAINLPPIEEY 374


>PRP28_MAGGR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 674

 Score = 43.5 bits (101), Expect = 6e-06
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 555 YGTG--------TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLG 606
           YGTG        T+   D +A+    +    + +   + +   +A L  F  G  ++L+ 
Sbjct: 528 YGTGKLVIVFVNTKSNCDAVAKDLKSSSFSAVTLHGNKTQDQREAALQSFRDGRTNVLVA 587

Query: 607 TQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           T + A+GLD P+V+L  V+N + A           T ++ T   GR GRA K G  +
Sbjct: 588 TDVAARGLDIPDVSL--VINFNMA----------GTIEVYTHRIGRTGRAGKEGMAI 632


>UVRB_XYLFT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L+E   + R L  ++DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LSEQGIRIRYLHSEIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD    L       R+   L Q  GRA R+ +   +L
Sbjct: 522 DADKEGFL-------RSTSSLIQTIGRAARSVRGRAIL 552


>UVRB_XYLFM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L+E   + R L  ++DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LSEQGIRIRYLHSEIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD    L       R+   L Q  GRA R+ +   +L
Sbjct: 522 DADKEGFL-------RSTSSLIQTIGRAARSVRGRAIL 552


>UVRB_XYLFA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L+E   + R L  ++DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LSEQGIRIRYLHSEIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD    L       R+   L Q  GRA R+ +   +L
Sbjct: 522 DADKEGFL-------RSTSSLIQTIGRAARSVRGRAIL 552


>UVRB_XYLF2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 669

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L+E   + R L  ++DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L
Sbjct: 466 LSEQGIRIRYLHSEIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAIL 521

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +AD    L       R+   L Q  GRA R+ +   +L
Sbjct: 522 DADKEGFL-------RSTSSLIQTIGRAARSVRGRAIL 552


>UVRB_TREPS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 11/191 (5%)

Query: 535 GFSKDIPQVCPNCKSRSIRYYG-TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALL 593
           G  +DI Q    C +R+ R    T T+K  ++L + F    I    V +  +      +L
Sbjct: 427 GQIEDICQRVKACSARNERSLVLTLTKKMAEDLTDYFNGLGIRTKYVHSEIETIERVEIL 486

Query: 594 DQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRA 653
                GE ++L+G  ++ +G+D P V  + +L+A    N+  F  S  +   L Q+ GRA
Sbjct: 487 TSLRAGECEVLVGINLLREGIDLPEVAFIAILDA----NIVGFLRSTTS---LIQIIGRA 539

Query: 654 GRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKK 713
            R  +   V+     S   A+R A ++        +M   R  G  P      I     +
Sbjct: 540 ARNARGTVVMYADAISD--AMREAIEETARR-RKIQMAYNRAHGITPRTIKKSIEDILVR 596

Query: 714 EEEVFKRAYEV 724
           E+EV K A  V
Sbjct: 597 EQEVKKDAARV 607


>UVRB_TREPA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 11/191 (5%)

Query: 535 GFSKDIPQVCPNCKSRSIRYYG-TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALL 593
           G  +DI Q    C +R+ R    T T+K  ++L + F    I    V +  +      +L
Sbjct: 427 GQIEDICQRVKACSARNERSLVLTLTKKMAEDLTDYFNGLGIRTKYVHSEIETIERVEIL 486

Query: 594 DQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRA 653
                GE ++L+G  ++ +G+D P V  + +L+A    N+  F  S  +   L Q+ GRA
Sbjct: 487 TSLRAGECEVLVGINLLREGIDLPEVAFIAILDA----NIVGFLRSTTS---LIQIIGRA 539

Query: 654 GRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKK 713
            R  +   V+     S   A+R A ++        +M   R  G  P      I     +
Sbjct: 540 ARNARGTVVMYADAISD--AMREAIEETARR-RKIQMAYNRAHGITPRTIKKSIEDILVR 596

Query: 714 EEEVFKRAYEV 724
           E+EV K A  V
Sbjct: 597 EQEVKKDAARV 607


>UVRB_SYNP6 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++   + R L  ++++  +      +L     G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLSDRGVKVRYLHSEINSIERI----EILQDLRNGDFDVLIGVNLLREGLDLPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       RT + L Q  GRA R
Sbjct: 518 ILDADKEGFL-------RTERSLIQTIGRAAR 542


>UVRB_SYNJA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 695

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L  F  G  D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q+ GR
Sbjct: 513 LQDFREGAFDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQMIGR 565

Query: 653 AGR 655
           A R
Sbjct: 566 AAR 568


>UVRB_SYNE7 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 666

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++   + R L  ++++  +      +L     G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 462 DYLSDRGVKVRYLHSEINSIERI----EILQDLRNGDFDVLIGVNLLREGLDLPEVSLVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       RT + L Q  GRA R
Sbjct: 518 ILDADKEGFL-------RTERSLIQTIGRAAR 542


>UVRB_OCEIH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V+LV +L+AD       F  SER+   L Q  GRA R E 
Sbjct: 494 GKFDVLVGINLLREGLDIPEVSLVSILDADK----EGFLRSERS---LIQTMGRAARNEN 546

Query: 659 AGQVLI 664
            G+V++
Sbjct: 547 -GKVIM 551


>UVRB_CORDI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 681

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  D+DT                GE D+L+G  ++ +GLD P V+LV 
Sbjct: 469 DYLLENGIRVRYLHSDIDTXXXXXXXXXXXX----GEYDVLVGINLLREGLDLPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYAI 674
           +L+AD    L       R+ + L Q  GRA R   +G V++ +    +S  YAI
Sbjct: 525 ILDADKEGFL-------RSTKSLIQTIGRAAR-NVSGTVIMYADKITDSMQYAI 570


>UVRB_BACLD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +   +  I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMSEDLTDYLKEIGIKVTYLHSEIKTLERIEIIRDLRLGKHDVLVGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYA 673
           P V+LV +L+AD       F  SER+   L Q  GRA R    G+V++ +    NS   A
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR-NAEGRVIMYADKITNSMEIA 563

Query: 674 IRFAK 678
           I   K
Sbjct: 564 INETK 568


>UVRB_BACHK RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V+LV +L+AD       F  SER+   L Q  GRA R E 
Sbjct: 494 GKFDVLVGINLLREGLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNEN 546

Query: 659 AGQVLI 664
            G+V++
Sbjct: 547 -GRVIM 551


>UVRB_BACCZ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V+LV +L+AD       F  SER+   L Q  GRA R E 
Sbjct: 494 GKFDVLVGINLLREGLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNEN 546

Query: 659 AGQVLI 664
            G+V++
Sbjct: 547 -GRVIM 551


>UVRB_BACC1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V+LV +L+AD       F  SER+   L Q  GRA R E 
Sbjct: 494 GKFDVLVGINLLREGLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNEN 546

Query: 659 AGQVLI 664
            G+V++
Sbjct: 547 -GRVIM 551


>UVRB_BACAN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V+LV +L+AD       F  SER+   L Q  GRA R E 
Sbjct: 494 GKFDVLVGINLLREGLDIPEVSLVAILDADK----EGFLRSERS---LIQTIGRAARNEN 546

Query: 659 AGQVLI 664
            G+V++
Sbjct: 547 -GRVIM 551


>UVRB_BACA2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +   +  I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKHDVLIGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYA 673
           P V+LV +L+AD       F  SER+   L Q  GRA R    G+V++ +    NS   A
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR-NAEGRVIMYADKITNSMEIA 563

Query: 674 IRFAK 678
           I   K
Sbjct: 564 INETK 568


>DED1_LODEL RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 664

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 546 NCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILL 605
           N  S  +    T T++  D LA+           +   R +   +  L  F  G+A IL+
Sbjct: 428 NANSEGLTIVFTETKRMADNLADFLYDQGFPATAIHGDRSQYEREKALAAFKSGQAPILV 487

Query: 606 GTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
            T + A+GLD PNV+   V+N D   ++ D+              GR GRA   G
Sbjct: 488 ATAVAARGLDIPNVS--HVINYDLPSDIDDY----------VHRIGRTGRAGNVG 530


>DBP2_CHAGB RecName: Full=ATP-dependent RNA helicase DBP2;       
           EC=3.6.1.-;
          Length = 562

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 538 KDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFG 597
           K + ++  + +S++     TGT++  DE+     Q     + +   +++     +LDQF 
Sbjct: 373 KHLEKIMEDKESQNKILIFTGTKRVADEITRFLRQDGWPALSIHGDKQQNERDWVLDQFK 432

Query: 598 RGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDF 636
            G++ I++ T + ++G+D  N+T   VLN D   N  D+
Sbjct: 433 TGKSPIMVATDVASRGIDVRNIT--HVLNYDYPNNSEDY 469


>DBP1_YEAST RecName: Full=ATP-dependent RNA helicase DBP1;       
           EC=3.6.1.-;AltName: Full=DEAD box protein 1;AltName:
           Full=Helicase CA1;
          Length = 617

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D+L +           +   R +   +  L  F    ADIL+ T + A+GLD PN
Sbjct: 420 TKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPN 479

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAI 674
           VT   V+N D   ++ D+              GR GRA   G V    +NS +  I
Sbjct: 480 VT--HVINYDLPSDIDDY----------VHRIGRTGRAGNTG-VATSFFNSNNQNI 522


>DBP1_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP1;       
           EC=3.6.1.-;AltName: Full=DEAD box protein 1;AltName:
           Full=Helicase CA1;
          Length = 617

 Score = 43.1 bits (100), Expect = 8e-06
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D+L +           +   R +   +  L  F    ADIL+ T + A+GLD PN
Sbjct: 420 TKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPN 479

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAI 674
           VT   V+N D   ++ D+              GR GRA   G V    +NS +  I
Sbjct: 480 VT--HVINYDLPSDIDDY----------VHRIGRTGRAGNTG-VATSFFNSNNQNI 522


>UVRB_THEFY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 701

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 12/99 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  + R L  ++DT                G  D+L+G  ++ +GLD P V+LV 
Sbjct: 472 DYLTDLGIRVRYLHSEIDTXXXXXXXXXXXX----GVFDVLVGINLLREGLDLPEVSLVA 527

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQV 662
           +L+AD       F  SER+   L Q  GRA R   +GQV
Sbjct: 528 ILDADK----EGFLRSERS---LIQTIGRAAR-HVSGQV 558


>UVRB_STRZT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVSKEED 612


>UVRB_NATPD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 683

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E    A +    +  + DT  +      L+     GE  +L+G  ++ +
Sbjct: 463 TLTKRMAEDLTEYLENAGVDVAYMHDETDTLER----HELVRSLRLGEIQVLVGINLLRE 518

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V+LV +L+AD       F  SE T   L Q  GRA R  +   VL
Sbjct: 519 GLDIPEVSLVAILDADQ----EGFLRSETT---LVQTMGRAARNVEGSVVL 562


>UVRB_METCA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +     R L  DVDT  +      ++     G+ D+L+G  ++ +
Sbjct: 447 TLTKRMAEDLTEYLMEHDVAVRYLHSDVDTVERV----EIIRDLRLGKFDVLVGINLLRE 502

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 503 GLDIPEVSLVAILDADKEGFL-------RSAVSLIQTIGRAAR 538


>UVRB_HALMA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 686

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   ++ +    +  + DT  +      L+     G+ D+L+G  ++ +
Sbjct: 465 TLTKRMAEDLTEYLEESGVNVAYMHDETDTLER----HELIRSLRLGDIDVLVGINLLRE 520

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SE T   L Q  GRA R
Sbjct: 521 GLDIPEVSLVAILDADQ----EGFLRSETT---LVQTMGRAAR 556


>UVRB_DEHSC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           ++K  D L E+  +   L  +VDT                G  D+++G  ++ +GLD P 
Sbjct: 456 SEKLADYLVEMGVKTHYLHSEVDTXXXXXXXXXXXX----GVYDVIVGINLLREGLDLPE 511

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           V+LV +L+AD    L       R+ Q L Q  GRA R    GQV++
Sbjct: 512 VSLVAILDADKEGYL-------RSEQALIQTMGRAAR-HVDGQVIM 549


>UVRB_CYTH3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 42/162 (25%), Positives = 67/162 (41%), Gaps = 22/162 (13%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  +EL +      +    + +  K      +L +   G  D+L+G  ++ +GLD 
Sbjct: 451 TLTKRMAEELTKFLDGVGVRTRYIHSEVKTLDRVEILRELRLGVFDVLVGVNLLREGLDL 510

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRF 676
           P V+LV +++AD    L + RS       L Q  GRA R            NS    I +
Sbjct: 511 PEVSLVAIMDADKEGFLRNVRS-------LVQTIGRAAR------------NSNGKVIMY 551

Query: 677 AKDQDYEGFYAYEMGIRR---QLGYPPYYFTIGITLSHKKEE 715
           A         A +   RR   QL Y   +    IT++  K+E
Sbjct: 552 ADKITASMQQAIDETSRRRATQLAYNELHGITPITVNKSKDE 593


>UVRB_CLONN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L  +  +   L   +DT ++      ++    +G+ D+L+G  ++ +GLD P V LV 
Sbjct: 462 DYLKSMGIKTEYLHSSIDTIKR----MEIIRDLRKGKFDVLVGINLLREGLDIPEVALVA 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           +L+AD       F  SE +   L Q  GRA R  ++  ++
Sbjct: 518 ILDADK----EGFLRSETS---LVQTIGRAARNSESKVIM 550


>UVRB_CHLAB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 656

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  +++A    +  I    + +  +      +L     G  D+L+G  ++ +GLD P 
Sbjct: 451 TKKLAEDIAAFLSELDIAAAYLHSGIETAERTRILSDLRLGNIDVLIGVNLLREGLDLPE 510

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 511 VSLVAILDADKEGFL-------RSTSSLIQFCGRAAR 540


>UVRB_AYWBP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 50/211 (23%), Positives = 86/211 (40%), Gaps = 15/211 (7%)

Query: 450 TIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSS-----FVMC 504
           TIP+++ + F D+  +N   NF   L  A+ +R +K  +    +N+  Y S     + + 
Sbjct: 345 TIPQIKGMYFGDFSRKNNLVNFGFRLPSALDNRPLKFNEFQEKMNKVIYLSATPGDYELT 404

Query: 505 RECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKAYD 564
           ++   V+        L   ++ +  N        +I     N +   I    T T    +
Sbjct: 405 KKIPIVEQIIRPTFVLDPEIEVRPTNNQMDDLYFEIKHQTKNNQRILIT---TLTINMSE 461

Query: 565 ELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGV 624
           +L        I    + +  K      +L     G+ D L+G  ++ +GLD P V LV +
Sbjct: 462 DLTTYLKNLGIKVAYLHSEIKSLQRLEILKDLRLGKYDCLVGVNLLREGLDLPEVALVAI 521

Query: 625 LNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           L+AD       F  +ER+   L Q  GRA R
Sbjct: 522 LDADK----QGFLRNERS---LIQTIGRAAR 545


>RHLB_VIBCM RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 438

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--RERILEQFTQGDVDILVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     + Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEEYAINLPAIESY 374


>RHLB_VIBCH RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 438

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--RERILEQFTQGDVDILVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     + Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEEYAINLPAIESY 374


>RHLB_VIBC3 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 438

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--RERILEQFTQGDVDILVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     + Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEEYAINLPAIESY 374


>RHLB_MANSM RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 417

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 36/106 (33%), Positives = 51/106 (48%), Gaps = 16/106 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G  DIL+ T + A+GL  P+VT   V N D    LPD R   
Sbjct: 285 DVAQKK--RLSLLKQFTDGALDILVATDVAARGLHIPDVT--HVFNYD----LPDDRED- 335

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFY 686
                     GR GRA ++G  +  S+  + YA+     ++Y G +
Sbjct: 336 -----YVHRIGRTGRAGESGVSI--SFACEEYAMNLPAIEEYIGHH 374


>DED1_EMENI RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 668

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L+E     R     +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 455 TKRMADALSEFLINQRFPATAIHGDRTQRERERALEMFRSGRYPILVATAVAARGLDIPN 514

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 515 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 544


>DED1_ASPOR RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 675

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 457 TKRMADSLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPN 516

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 517 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 546


>DED1_ASPNC RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 678

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 458 TKRMADSLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPN 517

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 518 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 547


>DBP5_ASPTN RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 487

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERTFQLLTQV 649
           A++DQF  G A +L+ T ++A+G+D   V++  V+N D   L+LP  +  +  FQ     
Sbjct: 363 AVIDQFRAGAAKVLITTNVLARGIDVSTVSM--VINYDIPELHLPPNQPRQADFQTYLHR 420

Query: 650 AGRAGRAEKAG 660
            GR GR  + G
Sbjct: 421 IGRTGRFGRVG 431


>DBP1_CANGA RecName: Full=ATP-dependent RNA helicase DBP1;       
           EC=3.6.1.-;
          Length = 604

 Score = 42.7 bits (99), Expect = 1e-05
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 13/111 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D+L +           +   R +   +  L  F  G A+IL+ T + A+GLD PN
Sbjct: 404 TKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVAARGLDIPN 463

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNS 669
           VT   V+N D   ++ D+              GR GRA   G V    +NS
Sbjct: 464 VT--NVINYDLPTDIDDY----------VHRIGRTGRAGNVG-VATSFFNS 501


>UVRB_STRZP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRZJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRR6 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRPS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRPN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRPJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRPI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRP7 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRP4 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_STRP2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHY 672
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++     + + Q  
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVIMYADTVTQSMQRA 568

Query: 673 AIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEE 716
               A+ +  +  Y  E GI  Q         I +T +  KEE+
Sbjct: 569 IDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEED 612


>UVRB_MYCTU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 698

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  +VDT                G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 465 DYLLEMGIRVRYLHSEVDTXXXXXXXXXXXX----GDYDVLVGINLLREGLDLPEVSLVA 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 521 ILDADKEGFLRSSRS-------LIQTIGRAAR 545


>UVRB_MYCPN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T K  + L +   +  I    +    K      LL    +GE + L+G  ++ +GLD P 
Sbjct: 459 TIKMAENLTDFLKERNIKVAYIHKDIKALERLILLTDLRKGEYECLVGINLLREGLDVPE 518

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+LV + +AD    +P     ER+   L Q+ GRA R
Sbjct: 519 VSLVAIFDAD----IPGLPRDERS---LIQIIGRAAR 548


>UVRB_MYCLE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 698

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  +VDT                G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 465 DYLLEMGIRVRYLHSEVDTXXXXXXXXXXXX----GDYDVLVGINLLREGLDLPEVSLVA 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 521 ILDADKEGFLRSARS-------LIQTIGRAAR 545


>UVRB_MYCBO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 698

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  +VDT                G+ D+L+G  ++ +GLD P V+LV 
Sbjct: 465 DYLLEMGIRVRYLHSEVDTXXXXXXXXXXXX----GDYDVLVGINLLREGLDLPEVSLVA 520

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L   RS       L Q  GRA R
Sbjct: 521 ILDADKEGFLRSSRS-------LIQTIGRAAR 545


>UVRB_METAC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V  +G+L+AD    L D +S       L Q+ GRA R   
Sbjct: 514 GKFDVLVGINLLREGLDIPEVGFIGILDADKEGFLRDSKS-------LIQIIGRAARNSS 566

Query: 659 AGQVL 663
           +  VL
Sbjct: 567 SKVVL 571


>UVRB_LISMO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A +    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 452 TLTKKMSEDLTNYLKEAGVKVQYLHSEVKTLERIEIIRDLRLGVYDVIVGINLLREGIDL 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           P V+LV +L+AD       F  SER+   L Q  GRA R E  G+V++
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTMGRAARNEN-GRVIM 551


>UVRB_LISMF RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A +    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 452 TLTKKMSEDLTNYLKEAGVKVQYLHSEVKTLERIEIIRDLRLGVYDVIVGINLLREGIDL 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           P V+LV +L+AD       F  SER+   L Q  GRA R E  G+V++
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTMGRAARNEN-GRVIM 551


>UVRB_LISIN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A +    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 452 TLTKKMSEDLTNYLKEAGVKVQYLHSEVKTLERIEIIRDLRLGVYDVIVGINLLREGIDL 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           P V+LV +L+AD       F  SER+   L Q  GRA R E  G+V++
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTMGRAARNEN-GRVIM 551


>UVRB_HELPY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 35/112 (31%), Positives = 58/112 (51%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + + +    AR +  ++D   +    ++L  +    E DIL+G  ++ +
Sbjct: 455 TLTKKMAEELCKYYAEWGLKARYMHSEIDAIERNHIIRSLRLK----EFDILIGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V+LV +++AD       F  SE +   L Q  GRA R    G+VL+
Sbjct: 511 GLDLPEVSLVAIMDADK----EGFLRSETS---LIQTMGRAAR-NANGKVLL 554


>UVRB_HAEDU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 675

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  D+DT  +      ++     G  D+L+G  ++ +GLD P V LV 
Sbjct: 467 DYLDEHGVRVRYLHSDIDTVERV----EIIHDLRIGMFDVLVGINLLREGLDMPEVALVA 522

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SE +   L Q  GRA R
Sbjct: 523 ILDADK----EGFLRSESS---LIQTIGRAAR 547


>UVRB_CHLAD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  +   L  D+DT  +      +L     G  D+++G  ++ +GLD P V+LV 
Sbjct: 460 DYLKEMGVRTMYLHADIDTIERV----EILRDLRLGVYDVVVGINLLREGLDLPEVSLVA 515

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       R+   L Q+ GRA R
Sbjct: 516 ILDADKEGYL-------RSETSLIQIIGRAAR 540


>UVRB_BIFLI RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 703

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 13/117 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   +   L  DVDT                G+ D+++G  ++ +GLD P V+LV 
Sbjct: 469 DYLLERGIKVEYLHSDVDTXXXXXXXXXXXX----GKIDVIVGINLLREGLDLPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQ 680
           +L+AD    L  +RS       L Q  GRA R      V+I   +    A+R A D+
Sbjct: 525 ILDADKEGFLRSYRS-------LIQTIGRAAR--NVSGVVIMYADETTEAMRQAIDE 572


>DED1_SCLS1 RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 678

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 64/304 (21%), Positives = 113/304 (37%), Gaps = 46/304 (15%)

Query: 369 SAIFAPLKNLGVMIIDEEHEAAYKQDSNPR--YHAREVAILRAQYNQATLVLGSATPSLE 426
           S I AP + L   I DE  + AY+    P   Y   ++     Q  +   +L +    L 
Sbjct: 274 SLILAPTRELVSQIFDESRKFAYRSWVRPCVVYGGADIGSQLRQMERGCDLLVATPGRLV 333

Query: 427 SRARAGKGVYQHLRL-----TQRANPLATIPEVQ-VIDFRDYIG--QNETSNFTPPLLEA 478
                G+   Q+++        R   +   P+++ +++  D  G    +T  F+      
Sbjct: 334 DLIERGRISLQNIKYLVLDEADRMLDMGFEPQIRRIVEGEDMPGVQNRQTLMFSATFPRD 393

Query: 479 IQ--DRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGF 536
           IQ   R   K+ V L + R G +S  + ++   V+      + L +      ++ H  G 
Sbjct: 394 IQMLARDFLKDYVFLSVGRVGSTSENITQKVEYVEDIDKRSVLLDI------LHTHGAGL 447

Query: 537 SKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQF 596
           +    +                T++  D L++           +   R +   +  L+ F
Sbjct: 448 TLIFVE----------------TKRMADSLSDFLINQNFPATSIHGDRTQRERERALEMF 491

Query: 597 GRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRA 656
             G   IL+ T + A+GLD PNVT   V+N D   ++ D+              GR GRA
Sbjct: 492 RNGRCPILVATAVAARGLDIPNVT--HVVNYDLPTDIDDY----------VHRIGRTGRA 539

Query: 657 EKAG 660
              G
Sbjct: 540 GNTG 543


>DED1_NEOFI RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 676

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 461 TKRMADALSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPN 520

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 521 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 550


>DED1_CANGA RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 617

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D+L +           +   R +   +  L  F  G A+IL+ T + A+GLD PN
Sbjct: 411 TKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRANILVATAVAARGLDIPN 470

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 471 VT--HVINYDLPSDVDDY----------VHRIGRTGRAGNTG 500


>DED1_ASPFU RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 674

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 459 TKRMADALSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPN 518

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 519 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 548


>DED1_AJECN RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 694

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 72/305 (23%), Positives = 120/305 (39%), Gaps = 51/305 (16%)

Query: 371 IFAPLKNLGVMIIDEEHEAAYKQDSNPR--YHAREVAILRAQYNQATLVLGSATPS---- 424
           I  P + L   I DE  +  Y+   +PR  Y   E+     Q +Q   VL  ATP     
Sbjct: 291 ILGPTRELVSQIYDEARKFCYRTALHPRVVYGGAEMGNQLRQLDQGCNVL-VATPGRLVD 349

Query: 425 LESRARAGKGVYQHLRLTQ--RANPLATIPEVQVI----DFRDYIGQNETSNFT---PPL 475
           +  R R      Q+L L +  R   +   P+++ I    D  D     +T  F+   PP 
Sbjct: 350 MMERGRISLAHIQYLVLDEADRMLDMGFEPQIRRIVQGSDMPDK-HMRQTLMFSATFPPD 408

Query: 476 LEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCG 535
           ++ + +  +K + + L + R G +S  + +     ++  + D +L               
Sbjct: 409 IQKLAEEFLK-DHIFLSVGRVGSTSENITQRIVECESDKDKDSALL-------------- 453

Query: 536 FSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQ 595
              DI  +C +    ++ +  T  Q   D L++     R+    +   R +   +  L+ 
Sbjct: 454 ---DI--LCSDSTGLTLVFVETKRQA--DMLSDFLLDHRLPATAIHGDRTQRERERALEL 506

Query: 596 FGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           F  G   IL+ T + A+GLD PNVT   V+N D    + D+              GR GR
Sbjct: 507 FRTGRCPILVATAVAARGLDIPNVT--HVINYDLPNEIDDY----------VHRIGRTGR 554

Query: 656 AEKAG 660
           A   G
Sbjct: 555 AGNTG 559


>DBP5_ASPNC RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 482

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERTFQLLTQV 649
           A++DQF  G A +L+ T ++A+G+D   V++  V+N D   ++ P  R  +  FQ     
Sbjct: 359 AVIDQFRAGHAKVLITTNVLARGIDVSTVSM--VINYDIPEIHQPGARQRQADFQTYLHR 416

Query: 650 AGRAGRAEKAG 660
            GR GR  + G
Sbjct: 417 IGRTGRFGRVG 427


>UVRB_XANOR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 688

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 487 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 542

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 543 FL-------RSTGSLIQTIGRAARNLRGKAIL 567


>UVRB_XANOP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_XANOM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_XANCP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_XANCB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_XANC8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_XANAC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 673

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           + R L  D+DT  +      ++     G+ D+L+G  ++ +GLD P V+LV +L+AD   
Sbjct: 472 RVRYLHSDIDTVERV----EIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEG 527

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            L       R+   L Q  GRA R  +   +L
Sbjct: 528 FL-------RSTGSLIQTIGRAARNLRGKAIL 552


>UVRB_SYNPX RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_SYNPW RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_STAHJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 454 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVVVGINLLREGIDI 513

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R EK G+V++ +    +S  YA
Sbjct: 514 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNEK-GEVIMYADKITDSMQYA 565

Query: 674 I 674
           +
Sbjct: 566 L 566


>UVRB_RHOBA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 708

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 7/105 (6%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  ++LA  F +  +    + +         LL +   G+ D L+G  ++ +GLD P 
Sbjct: 460 TKRLAEDLATYFQEQGVKCRWLHSELNAFERVDLLQELRAGQFDCLVGVNLLREGLDLPE 519

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           V+LV +L+AD       F  SE +   L Q  GRA R   +  +L
Sbjct: 520 VSLVAILDADK----EGFLRSETS---LIQTIGRAARNANSRVIL 557


>UVRB_PROMP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_PROM0 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_HALSA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 689

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQARI----LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +A +    +  + DT  +      L+     GE D+L+G  ++ +
Sbjct: 465 TLTKRMAEDLTEYLEEAGVAVEYMHDETDTLER----HELVRGLRLGEYDVLVGINLLRE 520

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD       F  SE +   L Q  GRA R
Sbjct: 521 GLDIPEVSLVAILDADQ----QGFLRSETS---LVQTMGRAAR 556


>UVRB_CHLTR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LAEL   A  L   ++T  +      +L     G  D+L+G  ++ +G+D P V+LV +L
Sbjct: 469 LAELGIAATYLHSGIETAERT----QILTDLRLGNIDVLIGVNLLREGIDLPEVSLVAIL 524

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD    L       R+   L Q  GRA R
Sbjct: 525 DADKEGFL-------RSSASLIQFCGRAAR 547


>UVRB_CHLTA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           LAEL   A  L   ++T  +      +L     G  D+L+G  ++ +G+D P V+LV +L
Sbjct: 469 LAELGIAATYLHSGIETAERT----QILTDLRLGNIDVLIGVNLLREGIDLPEVSLVAIL 524

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD    L       R+   L Q  GRA R
Sbjct: 525 DADKEGFL-------RSSASLIQFCGRAAR 547


>UVRB_CHLCV RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 656

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  +++A    +  I    + +  +      +L     G  D+L+G  ++ +GLD P 
Sbjct: 451 TKKLAEDIAAFLSELDIAAAYLHSGIETAERTRILADLRLGNIDVLIGVNLLREGLDLPE 510

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 511 VSLVAILDADKEGFL-------RSTSSLIQFCGRAAR 540



 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 54/226 (23%), Positives = 99/226 (43%), Gaps = 38/226 (16%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           ELN  Q    + ++   G   P   ++  TG  + +  L+ I+  L K +  IL+   IS
Sbjct: 395 ELNESQGHIVEQIIRPTGIPDPIPEIRPATG--QVDDLLEEIRKRLSKSQEKILV---IS 449

Query: 321 LTPQMTE---RFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGA---RSAIFAP 374
           +T ++ E    F++      A LHSG+   E+      +  G+  V++G    R  +  P
Sbjct: 450 ITKKLAEDIAAFLSELDIAAAYLHSGIETAERTRILADLRLGNIDVLIGVNLLREGLDLP 509

Query: 375 LKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKG 434
             +L V I+D + E   +  S         ++++     A  V G      + + R+   
Sbjct: 510 EVSL-VAILDADKEGFLRSTS---------SLIQFCGRAARNVEGKVIFYADQKTRS--- 556

Query: 435 VYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTP-PLLEAI 479
           + Q L+ T+R        ++Q+    DY   N+ +N TP P+++AI
Sbjct: 557 IEQTLKETERRR------QIQL----DY---NKANNITPKPIIKAI 589


>RH25_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 25;   
                EC=3.6.1.-;
          Length = 594

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 12/114 (10%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           +AE+  Q R+   ++ + + + +   + D+F +    IL+ + + A+G+D+P+VTLV   
Sbjct: 400 VAEILSQLRLNIREIHSRKSQSARTKVSDEFRKSRGLILVSSDVSARGVDYPDVTLV--- 456

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKD 679
                + +P  R      Q      GR GR  K GQ L+     + Y +   KD
Sbjct: 457 ---IQVGVPADR------QQYIHRLGRTGRKGKEGQGLLLLAPWEKYFLSSIKD 501


>PRP28_SCHPO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 662

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 12/81 (14%)

Query: 583 TRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERT 642
           ++ +   +  ++Q     ADIL+ T +  +G+D PNV+L  VLN + A ++ D+      
Sbjct: 549 SKSQEQRERAIEQLRNKTADILVATDIAGRGIDIPNVSL--VLNYNMAKSIEDY------ 600

Query: 643 FQLLTQVAGRAGRAEKAGQVL 663
               T   GR GRA K+G  +
Sbjct: 601 ----THRIGRTGRAGKSGTAI 617


>DED1_NEUCR RecName: Full=ATP-dependent RNA helicase ded-1;       
           EC=3.6.1.-;
          Length = 688

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++           +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 462 TKRMADSLSDFLINQNFPATSIHGDRTQRERERALEMFRNGRCPILVATAVAARGLDIPN 521

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 522 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 551


>DED1_COCIM RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 659

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 32/113 (28%), Positives = 47/113 (41%), Gaps = 19/113 (16%)

Query: 555 YGTG-------TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGT 607
           +GTG       T++  D L+E           +   R +   +  L+ F  G   IL+ T
Sbjct: 434 HGTGLTLIFVETKRMADSLSEFLINQNFPATAIHGDRTQRERERALEYFRNGRCPILVAT 493

Query: 608 QMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
            + A+GLD PNVT   V+N D   ++ D+              GR GRA   G
Sbjct: 494 AVAARGLDIPNVT--HVVNYDLPTDIDDY----------VHRIGRTGRAGNTG 534


>DED1_ASPTN RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 674

 Score = 42.0 bits (97), Expect = 2e-05
 Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F  G   IL+ T + A GLD PN
Sbjct: 457 TKRMADSLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAASGLDIPN 516

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 517 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 546


>UVRB_STRU0 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 44/166 (26%), Positives = 70/166 (42%), Gaps = 16/166 (9%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI----QSYNSQHYAIRFAKD 679
           +L+AD       F  +ER    L Q  GRA R    G+V++     + + Q      A+ 
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR-NSQGRVIMYADKMTESMQKAIDETARR 575

Query: 680 QDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVM 725
           +  +  Y  E GI  Q         I IT     E E     Y VM
Sbjct: 576 RQIQMAYNEEHGIVPQTIKKEIRDLISITKGTNTEVEEESLDYSVM 621


>UVRB_STRTD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 473 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 528

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHYAIRFAKD 679
           +L+AD       F  +ER    L Q  GRA R    G V++     + + Q      A+ 
Sbjct: 529 ILDADK----EGFLRNERG---LIQTIGRAAR-NSDGHVIMYADKITESMQKAMDETARR 580

Query: 680 QDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMN 726
           ++ +  Y  E GI  Q         I IT +++ E       Y  MN
Sbjct: 581 REIQMAYNKEHGITPQTIKKEIRDLISITKTNEAEVAEDTVNYSAMN 627


>UVRB_STRT2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 473 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 528

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHYAIRFAKD 679
           +L+AD       F  +ER    L Q  GRA R    G V++     + + Q      A+ 
Sbjct: 529 ILDADK----EGFLRNERG---LIQTIGRAAR-NSDGHVIMYADKITESMQKAMDETARR 580

Query: 680 QDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMN 726
           ++ +  Y  E GI  Q         I IT +++ E       Y  MN
Sbjct: 581 REIQMAYNKEHGITPQTIKKEIRDLISITKTNEAEVAEDTVNYSAMN 627


>UVRB_STRT1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 473 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 528

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQ----SYNSQHYAIRFAKD 679
           +L+AD       F  +ER    L Q  GRA R    G V++     + + Q      A+ 
Sbjct: 529 ILDADK----EGFLRNERG---LIQTIGRAAR-NSDGHVIMYADKITESMQKAMDETARR 580

Query: 680 QDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKRAYEVMN 726
           ++ +  Y  E GI  Q         I IT +++ E       Y  MN
Sbjct: 581 REIQMAYNKEHGITPQTIKKEIRDLISITKTNEAEVAEDTVNYSAMN 627


>UVRB_STAAW RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_STAAS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_STAAR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_STAAN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_STAAM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_STAAC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 456 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 515

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD    L   RS       L Q  GRA R +K G+V++   +  +S  YA
Sbjct: 516 PEVSLVVILDADKEGFLRSNRS-------LIQTIGRAARNDK-GEVIMYADKMTDSMKYA 567

Query: 674 I 674
           I
Sbjct: 568 I 568


>UVRB_CHLPN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVL 625
           L+EL   A  L   ++T  +      +L     G  D+L+G  ++ +GLD P V+LV +L
Sbjct: 462 LSELEIPAAYLHSGIETAERT----QILTDLRSGVIDVLIGVNLLREGLDLPEVSLVAIL 517

Query: 626 NADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +AD    L       R+   L Q  GRA R
Sbjct: 518 DADKEGFL-------RSTSSLIQFCGRAAR 540


>UVRB_BIFLO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 703

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   +   L  DVDT                G+ D+++G  ++ +GLD P V+LV 
Sbjct: 469 DYLLERGIKVEYLHSDVDTXXXXXXXXXXXX----GKIDVIVGINLLREGLDLPEVSLVA 524

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L  +RS       L Q  GRA R
Sbjct: 525 ILDADKEGFLRSYRS-------LIQTIGRAAR 549


>UVRB_BACSU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;AltName: Full=Protein dinA;
          Length = 661

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L +   +  I    + +  K      ++     G+ D+L+G  ++ +GLD 
Sbjct: 452 TLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDI 511

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD       F  SER+   L Q  GRA R
Sbjct: 512 PEVSLVAILDADK----EGFLRSERS---LIQTIGRAAR 543


>UVRB_ANAPZ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 653

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           + + E+  +   L  DV T  +      ++ Q   GE D+L+G  ++ +GLD P   LV 
Sbjct: 462 EHMREIGIKVAYLHSDVKTLERMD----IIAQLRTGEIDVLIGVNLLREGLDIPECALVC 517

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  SE +   L Q  GRA R
Sbjct: 518 ILDADK----EGFLRSETS---LVQTIGRAAR 542


>RHLB_VIBVY RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 435

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G  D+L+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--REKILEQFTQGSVDLLVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEDYAINLPAIEEY 374


>RHLB_VIBVU RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 435

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L+QF +G  D+L+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVPQKK--REKILEQFTQGSVDLLVATDVAARGLHIPQVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SFACEDYAINLPAIEEY 374


>RHLB_VIBFM RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 432

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L++F +G  DIL+ T + A+GL  P VT   V N D      D+    
Sbjct: 289 DVPQKK--RERILEEFTQGNVDILVATDVAARGLHIPQVT--HVFNFDLPNEAEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGNSI--SFACEEYAINLPAIEEY 374


>RHLB_VIBF1 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 432

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK   + +L++F +G  DIL+ T + A+GL  P VT   V N D      D+    
Sbjct: 289 DVPQKK--RERILEEFTQGNVDILVATDVAARGLHIPQVT--HVFNFDLPNEAEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA  +G  +  S+  + YAI     ++Y
Sbjct: 341 ------VHRIGRTGRAGASGNSI--SFACEEYAINLPAIEEY 374


>RHLB_SHIF8 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     ++Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIENYIG 376


>RHLB_PHOPR RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 437

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 33/109 (30%), Positives = 52/109 (47%), Gaps = 16/109 (14%)

Query: 574 RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNL 633
           R+  ++ D  +KK     +L+QF +G+ DIL+ T + A+GL  P VT   V N D   + 
Sbjct: 282 RVGLLNGDVPQKK--RVRILEQFTQGDIDILVATDVAARGLHIPQVT--HVYNYDLPDDA 337

Query: 634 PDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
            D+              GR GRA ++G  +  S+  + YAI     + Y
Sbjct: 338 EDY----------VHRIGRTGRAGESGSSI--SFACEEYAINLPAIETY 374


>RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
                EC=3.6.1.-;
          Length = 602

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 36/122 (29%), Positives = 56/122 (45%), Gaps = 19/122 (15%)

Query: 557 TGTQKAYDELAELFPQA---RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKG 613
           T T++  D LA    ++   + L  D+   +++ +    L  F  G  +IL+ T + A+G
Sbjct: 335 TQTKREADRLAYAMGRSYACQALHGDISQNQRERT----LSGFRDGRFNILVATDVAARG 390

Query: 614 LDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYA 673
           LD PNV LV          LP+      T +L    +GR  RA K G  ++   N Q  A
Sbjct: 391 LDIPNVDLV------IHYELPN------TSELFVHRSGRTARAGKKGSAILIYTNDQARA 438

Query: 674 IR 675
           +R
Sbjct: 439 VR 440


>DED1_USTMA RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 672

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++   +++I    +   R +   +  L+ F  G+  I++ T + A+GLD PN
Sbjct: 459 TKRMADMLSDFLLRSKIGATSIHGDRTQRERERALELFRSGKTPIMVATAVAARGLDIPN 518

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 519 VT--HVVNYDLPSDVDDY----------VHRIGRTGRAGNVG 548


>DED1_PHANO RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 696

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 69/305 (22%), Positives = 115/305 (37%), Gaps = 48/305 (15%)

Query: 369 SAIFAPLKNLGVMIIDEEHEAAYKQDSNPR--YHAREVAILRAQYNQATLVLGSATPS-- 424
           S I AP + L   I DE  + AY+    P   Y   ++     Q  +   +L  ATP   
Sbjct: 289 SLILAPTRELVSQIFDEARKFAYRSWVRPCVVYGGADIGSQLRQIERGCDLL-VATPGRL 347

Query: 425 --LESRARAGKGVYQHLRLTQ--RANPLATIPEVQ-VIDFRDY--IGQNETSNFTPPLLE 477
             L  R R      ++L L +  R   +   P+++ +++  D       +T  F+     
Sbjct: 348 VDLIERGRISLASIKYLVLDEADRMLDMGFEPQIRRIVEGEDMPPTAGRQTLMFSATFPR 407

Query: 478 AIQ--DRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCG 535
            IQ   R   KE + L + R G +S  + ++   V+      + L +      ++ H  G
Sbjct: 408 DIQMLARDFLKEYIFLSVGRVGSTSENITQKIEYVEDADKRSVLLDI------LHTHGAG 461

Query: 536 FSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQ 595
            S    +                T++  D L++           +   R +   +  L+ 
Sbjct: 462 LSLIFVE----------------TKRMADSLSDFLINQGFPATSIHGDRTQREREKALEM 505

Query: 596 FGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           F  G   IL+ T + A+GLD PNVT   V+N D   ++ D+              GR GR
Sbjct: 506 FRSGRCPILVATAVAARGLDIPNVT--HVVNYDLPTDIDDY----------VHRIGRTGR 553

Query: 656 AEKAG 660
           A   G
Sbjct: 554 AGNTG 558


>DBP3_PICGU RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 534

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           LD F RG++++LL T + A+GLD PNV +  V+N    L + D+              GR
Sbjct: 413 LDSFKRGDSNLLLATDVAARGLDIPNVKV--VINLTFPLTVEDY----------VHRIGR 460

Query: 653 AGRAEKAG 660
            GRA + G
Sbjct: 461 TGRAGQTG 468


>DBP2_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-2;       
           EC=3.6.1.-;
          Length = 562

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  D++     Q     + +   +++     +LDQF  G++ I++ T + ++G+D 
Sbjct: 388 TGTKRVADDITRFLRQDGWPALSIHGDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDV 447

Query: 617 PNVTLVGVLNADTALNLPDF 636
            N+T   VLN D   N  D+
Sbjct: 448 RNIT--HVLNYDYPNNSEDY 465


>UVRB_STAES RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D ++G  ++ +G+D 
Sbjct: 454 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDAIVGINLLREGIDI 513

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYA 673
           P V+LV +L+AD       F  S+R+   L Q  GRA R +K G+V++ +    +S  YA
Sbjct: 514 PEVSLVVILDADK----EGFLRSDRS---LIQTIGRAARNDK-GEVIMYADKITDSMQYA 565

Query: 674 I 674
           I
Sbjct: 566 I 566


>UVRB_STAEQ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D ++G  ++ +G+D 
Sbjct: 454 TLTKKMSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDAIVGINLLREGIDI 513

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS---YNSQHYA 673
           P V+LV +L+AD       F  S+R+   L Q  GRA R +K G+V++ +    +S  YA
Sbjct: 514 PEVSLVVILDADK----EGFLRSDRS---LIQTIGRAARNDK-GEVIMYADKITDSMQYA 565

Query: 674 I 674
           I
Sbjct: 566 I 566


>UVRB_HELAH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 26/139 (18%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + + +     R +  ++D   +    ++L  +    E D+L+G  ++ +
Sbjct: 455 TLTKKMAEELCKYYAEWGLKVRYMHSEIDAIERNHIIRSLRLK----EFDVLIGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR---------AEKAGQVL 663
           GLD P V+LV +++AD       F  SE +   L Q  GRA R         A+K  Q +
Sbjct: 511 GLDLPEVSLVAIMDADK----EGFLRSETS---LIQTMGRAARNANGKVLLYAKKITQSM 563

Query: 664 IQSYNSQHYAIRFAKDQDY 682
            +++ +  Y  R AK +++
Sbjct: 564 QKAFETTTY--RRAKQEEF 580


>UVRB_BACHD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + R L  +V T  +      ++ Q   G  ++L+G  ++ +GLD P V+LV 
Sbjct: 463 DYLKEVGIKVRYLHSEVKTLERI----EIIRQLRLGTFNVLVGINLLREGLDIPEVSLVA 518

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER+   L Q  GRA R
Sbjct: 519 ILDADK----EGFLRAERS---LIQTIGRAAR 543


>RHLB_SALTY RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALTI RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALSV RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALPK RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALPC RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALPB RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALNS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALHS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALG2 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALEP RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALDC RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALCH RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALAR RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_SALA4 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIESYIG 376


>RHLB_ERWT9 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 430

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 35/104 (33%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD F +G+ DIL+ T + A+GL  P VT   V N D    LPD R   
Sbjct: 289 DVAQKK--RLRILDDFTKGDVDILVATDVAARGLHIPAVT--HVFNYD----LPDDRED- 339

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA   G  +  S   + YA+     ++Y G
Sbjct: 340 -----YVHRIGRTGRAGANGHSI--SLACEEYALNLPAIEEYIG 376


>MFD_MYCTU RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1234

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 23/145 (15%)

Query: 288 GITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVA---ILHSGL 344
           G  G GKTE+ ++    A+  GK   +LVP    T  + ++ +  FG++++   +   GL
Sbjct: 676 GDVGYGKTEIAVRAAFKAVQDGKQVAVLVP----TTLLADQHLQTFGERMSGFPVTIKGL 731

Query: 345 SNGEKYDEWRKV----ERGDAQVVVGARSAIFAPL--KNLGVMIIDEEHEAAYKQDSNPR 398
           S      E R V      G   +V+G    +   +  K+LG++++DEE     +      
Sbjct: 732 SRFTDAAESRAVIDGLADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVE------ 785

Query: 399 YHAREVAILRAQYNQATLVLGSATP 423
            H   +  LR   +  T+   SATP
Sbjct: 786 -HKEHIKSLRTHVDVLTM---SATP 806


>MFD_MYCBO RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 1234

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 23/145 (15%)

Query: 288 GITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVA---ILHSGL 344
           G  G GKTE+ ++    A+  GK   +LVP    T  + ++ +  FG++++   +   GL
Sbjct: 676 GDVGYGKTEIAVRAAFKAVQDGKQVAVLVP----TTLLADQHLQTFGERMSGFPVTIKGL 731

Query: 345 SNGEKYDEWRKV----ERGDAQVVVGARSAIFAPL--KNLGVMIIDEEHEAAYKQDSNPR 398
           S      E R V      G   +V+G    +   +  K+LG++++DEE     +      
Sbjct: 732 SRFTDAAESRAVIDGLADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVE------ 785

Query: 399 YHAREVAILRAQYNQATLVLGSATP 423
            H   +  LR   +  T+   SATP
Sbjct: 786 -HKEHIKSLRTHVDVLTM---SATP 806


>DED1_SCHPO RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;AltName: Full=Multicopy suppressor of
           overexpressed cyr1 protein 2;
          Length = 636

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 12/105 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L +    +      +   R +   +  L+ F  G   I++ T + ++GLD PN
Sbjct: 439 TKRMADTLTDYLLNSNFPATSIHGDRTQRERERALELFRSGRTSIMVATAVASRGLDIPN 498

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           VT   V+N D   ++ D+              GR GRA   GQ +
Sbjct: 499 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTGQAV 531


>DED1_CHAGB RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 688

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++           +   R +   +  L+ F  G+  IL+ T + A+GLD PN
Sbjct: 465 TKRMADSLSDFLINQNFPATSIHGDRTQRERERALELFRNGKCPILVATAVAARGLDIPN 524

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 525 VT--HVINYDLPTDVDDY----------VHRIGRTGRAGNTG 554


>DBP5_EMENI RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 477

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERTFQLLTQVA 650
           ++DQF  G A +L+ T ++A+G+D   V++  V+N D   L+ P  R  +  FQ      
Sbjct: 355 IIDQFRAGHAKVLITTNVLARGIDVSTVSM--VINYDIPELHQPPNRPRQADFQTYLHRI 412

Query: 651 GRAGRAEKAG 660
           GR GR  + G
Sbjct: 413 GRTGRFGRVG 422


>DBP5_ASPOR RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 487

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRSSERTFQLLTQV 649
           A++DQF  G+A +L+ T ++A+G+D   V++  V+N D   L+ P     +  FQ     
Sbjct: 363 AVIDQFRAGQAKVLITTNVLARGIDVSTVSM--VINYDIPELHQPGAPERQADFQTYLHR 420

Query: 650 AGRAGRAEKAG 660
            GR GR  + G
Sbjct: 421 IGRTGRFGRVG 431


>DBP2_GIBZE RecName: Full=ATP-dependent RNA helicase DBP2;       
           EC=3.6.1.-;
          Length = 555

 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 538 KDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFG 597
           K + +V  N +++ + +   GT++  DE+     Q     + +   +++     +LDQF 
Sbjct: 371 KHMEKVMENKENKILIF--VGTKRVADEITRFLRQDGWPALSIHGDKQQNERDWVLDQFK 428

Query: 598 RGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDF 636
            G++ I++ T + ++G+D  N+T   VLN D   N  D+
Sbjct: 429 TGKSPIMVATDVASRGIDVRNIT--HVLNYDYPNNSEDY 465


>UVRB_SYNS3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  ++R+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVAILDADK----EGFLRAQRS---LIQTIGRAAR 542


>UVRB_PROMM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_PROMA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 677

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_PROM3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  +ER+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADK----EGFLRAERS---LIQTIGRAAR 542


>UVRB_LACLS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 692

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 8/110 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L   F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 458 TLTKKMSEDLTAYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 517

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS 666
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++ S
Sbjct: 518 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVILYS 559


>UVRB_LACLM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 692

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 8/110 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L   F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 458 TLTKKMSEDLTAYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 517

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS 666
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++ S
Sbjct: 518 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVILYS 559


>UVRB_LACLA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 692

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 8/110 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L   F +  I    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 458 TLTKKMSEDLTAYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 517

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQS 666
           P V+LV +L+AD       F  +ER    L Q  GRA R    G V++ S
Sbjct: 518 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR-NSEGHVILYS 559


>UVRB_LACBA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  +   L  D+ T  +      ++     G+ D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKDLGIKVAYLHSDIKTLERT----EIMRDLRLGKYDVLVGINLLREGIDIPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER+   L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERS---LIQTIGRAAR 548


>UVRB_HELPJ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 37/139 (26%), Positives = 67/139 (48%), Gaps = 26/139 (18%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + + +     R +  ++D   +    ++L  +    E D+L+G  ++ +
Sbjct: 455 TLTKKMAEELCKYYAEWGLKVRYMHSEIDAIERNHIIRSLRLK----EFDVLIGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR---------AEKAGQVL 663
           GLD P V+LV +++AD       F  SE +   L Q  GRA R         A+K  Q +
Sbjct: 511 GLDLPEVSLVAIMDADK----EGFLRSETS---LIQTMGRAARNANGKVLLYAKKTTQSM 563

Query: 664 IQSYNSQHYAIRFAKDQDY 682
            +++    Y  R AK +++
Sbjct: 564 QKAFEITSY--RRAKQEEF 580


>UVRB_HELPH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 658

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL + + +     R +  ++D   +    ++L  +    E DIL+G  ++ +
Sbjct: 455 TLTKKMAEELCKYYAEWGLKVRYMHSEIDAIERNHIIRSLRLK----EFDILIGINLLRE 510

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P V+LV +++AD       F  SE +   L Q  GRA R    G+VL+
Sbjct: 511 GLDLPEVSLVAIMDADK----EGFLRSETS---LIQTMGRAAR-NANGKVLL 554


>RHLB_SHISS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_SHIFL RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_SHIDS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_SHIBS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_SHIB3 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_KLEP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGNSI--SLACEEYALNLPAIETYIG 376


>RHLB_HAES1 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 419

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G  DIL+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 287 DVMQKK--RLSLLKQFTDGTLDILVATDVAARGLHIPDVT--HVFNYDLPDDCEDY---- 338

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S+  + YAI     ++Y G
Sbjct: 339 ------VHRIGRTGRAGESG--ISISFACEEYAINLPAIEEYIG 374


>RHLB_ESCF3 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ENTS8 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOUT RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOSM RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOSE RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOLU RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOLI RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOLC RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOL6 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOL5 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOK1 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOHS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECODH RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECOBW RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO8A RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO81 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO7I RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO5E RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO55 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO45 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO27 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_ECO24 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>PRP5_PHANO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5;         EC=3.6.1.-;
          Length = 1184

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 560 QKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           + A D L++LF         +   + +      +++F +G  +IL+ T + A+GLD P +
Sbjct: 808 ETAEDLLSKLFKAKYFAVNTIHGAKDQTDRNEAINEFKQGLLNILIATSVAARGLDVPGL 867

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG--QVLIQSYNSQHYAIRFA 677
            L  V N D   +L D+              GR GRA   G    LI++   + +A+   
Sbjct: 868 AL--VYNFDCPTHLEDY----------VHRCGRTGRAGNKGLAVTLIENPGQERFAVHIV 915

Query: 678 K 678
           K
Sbjct: 916 K 916


>DED1_ASHGO RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 623

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L +      +    +   R +   +  L  F  G A++L+ T + A+GLD PN
Sbjct: 411 TKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRANVLVATAVAARGLDIPN 470

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 471 VT--HVINYDLPSDIDDY----------VHRIGRTGRAGNTG 500


>DBP5_ASPCL RecName: Full=ATP-dependent RNA helicase dbp5;       
           EC=3.6.1.-;
          Length = 487

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 580 VDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD-TALNLPDFRS 638
           +D T++      ++D+F  GEA +L+ T ++A+G+D   V++  V+N D   L+ P    
Sbjct: 355 IDVTKR----DEIIDKFRSGEAKVLITTNVLARGIDVSTVSM--VINYDIPELHRPGVPE 408

Query: 639 SERTFQLLTQVAGRAGRAEKAG 660
            +  FQ      GR GR  + G
Sbjct: 409 RQADFQTYLHRIGRTGRFGRVG 430


>DBP2_MAGGR RecName: Full=ATP-dependent RNA helicase DBP2;       
           EC=3.6.1.-;
          Length = 548

 Score = 40.8 bits (94), Expect = 4e-05
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 558 GTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFP 617
           GT++  DE+     Q     + +   +++     +LDQF  G++ I++ T + ++G+D  
Sbjct: 382 GTKRVADEITRFLRQDGWPALSIHGDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDVR 441

Query: 618 NVTLVGVLNADTALNLPDF 636
           N+T   VLN D   N  D+
Sbjct: 442 NIT--HVLNYDYPNNSEDY 458


>UVRB_STRMU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 23/114 (20%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFA 677
           +L+AD       F  +ER    L Q  GRA R            NSQ + I +A
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR------------NSQGHVIMYA 558


>UVRB_MYCMS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T +  ++L     +  I    + +  K      +L+   +G  D+++G  ++ +GLD 
Sbjct: 462 TLTIRMSEDLTAFLQEKNIKVAYLHSELKTLERSEILNDLRKGVYDVVVGVNLLREGLDL 521

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD    L ++RS       L Q  GR  R
Sbjct: 522 PEVSLVCILDADKQGFLRNYRS-------LIQTIGRVAR 553


>UVRB_METMA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 670

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G+ D+L+G  ++ +GLD P V  +G+L+AD    L + +S       L Q+ GRA R   
Sbjct: 514 GKFDVLVGINLLREGLDIPEVGFIGILDADKEGFLRNSKS-------LIQIIGRAARNSS 566

Query: 659 AGQVL 663
           +  VL
Sbjct: 567 SRVVL 571


>UVRB_CAMHC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 29/101 (28%), Positives = 50/101 (49%), Gaps = 15/101 (14%)

Query: 559 TQKAYDELA----ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T+K  +EL+    EL  + + +  D+D   +      L+     G+ D+L+G  ++ +GL
Sbjct: 457 TKKMAEELSKYYLELGLKVKYMHSDIDAIERN----ELIRGLRTGDFDMLIGINLLREGL 512

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           D P V+L+ +++AD    L       R+   L Q  GRA R
Sbjct: 513 DLPEVSLIAIMDADKEGFL-------RSRTSLIQTMGRAAR 546


>RHLB_HAES2 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 419

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G  D+L+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 287 DVMQKK--RLSLLKQFTDGTLDVLVATDVAARGLHIPDVT--HVFNYDLPDDCEDY---- 338

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S+  + YAI     ++Y G
Sbjct: 339 ------VHRIGRTGRAGESG--ISISFACEEYAINLPAIEEYIG 374


>RHLB_HAEIN RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 415

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 35/104 (33%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G+ DIL+ T + A+GL   +VT   V N D    LPD R   
Sbjct: 288 DVAQKK--RLSLLKQFTDGDLDILVATDVAARGLHISDVT--HVFNYD----LPDDRED- 338

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S+  + YA+     ++Y G
Sbjct: 339 -----YVHRIGRTGRAGESGVSI--SFACEEYAMNLPAIEEYIG 375


>RHLB_HAEIG RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 415

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 35/104 (33%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G+ DIL+ T + A+GL   +VT   V N D    LPD R   
Sbjct: 288 DVAQKK--RLSLLKQFTDGDLDILVATDVAARGLHISDVT--HVFNYD----LPDDRED- 338

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S+  + YA+     ++Y G
Sbjct: 339 -----YVHRIGRTGRAGESGVSI--SFACEEYAMNLPAIEEYIG 375


>RHLB_HAEIE RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 415

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 35/104 (33%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G+ DIL+ T + A+GL   +VT   V N D    LPD R   
Sbjct: 288 DVAQKK--RLSLLKQFTDGDLDILVATDVAARGLHISDVT--HVFNYD----LPDDRED- 338

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S+  + YA+     ++Y G
Sbjct: 339 -----YVHRIGRTGRAGESGVSI--SFACEEYAMNLPAIEEYIG 375


>RHLB_CITK8 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIEAYIG 376


>RECG_SYNY3 RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 831

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 13/111 (11%)

Query: 585 KKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQ 644
           K    +A L  F   + +I++ T +I  G+D PN T++ + NA+       F  S+    
Sbjct: 661 KSAEKEAALTAFREKQTEIIVSTTVIEVGVDVPNATVMVIENAER------FGLSQ---- 710

Query: 645 LLTQVAGRAGRAEKAGQVLIQSYNSQHYAIR--FAKDQDYEGFYAYEMGIR 693
            L Q+ GR GR       L+ + +  + A +     +Q  +GF+  EM +R
Sbjct: 711 -LHQLRGRVGRGSHQSYCLLVTNSKSNDARQRLGVMEQSQDGFFIAEMDLR 760


>DED1_YARLI RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 618

 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L ++          +   R +   +  L+ F  G   IL+ T + A+GLD PN
Sbjct: 427 TKRGADYLCDVLQSEDFPATSIHGDRSQRDRERALEMFRDGTTPILVATAVAARGLDIPN 486

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 487 VT--HVVNYDLPTDIDDY----------VHRIGRTGRAGNTG 516


>UVRB_STRSV RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  +    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGVKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD       F  +ER    L Q  GRA R
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRGC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L + F +  +    + +  K      ++     G  D+L+G  ++ +G+D 
Sbjct: 457 TLTKKMAEDLTDYFKEMGVKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV 516

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P V+LV +L+AD       F  +ER    L Q  GRA R
Sbjct: 517 PEVSLVAILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_MYCMO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 659

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  +EL   F + +     + +         +L +  +G  D ++G  ++ +G+D P 
Sbjct: 456 TKKVSEELTRYFQEKKEKVAYIHSDYTTFERNEILRKLRKGVYDTVIGINLLREGIDLPE 515

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYN 668
           V+L+ VL+A    N   F  S+++   L Q+ GRA R    G+V+  + N
Sbjct: 516 VSLIMVLDA----NKESFFRSKKS---LIQIVGRAAR-NVNGRVIFYANN 557


>UVRB_LEIXX RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 688

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 33/103 (32%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 557 TGTQKAYDELAELFPQA----RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  +EL +   +A    R L  DVD                 G  D+L+G  ++ +
Sbjct: 456 TLTKKMAEELTDFLAEAGVKVRYLHADVDXXXXXXXXXXXXS----GVFDVLVGINLLRE 511

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 512 GLDLPEVSLVAILDADKEGFL-------RSSTSLIQTIGRAAR 547


>PRP28_NEUCR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp-28;         EC=3.6.1.-;
          Length = 728

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 12/78 (15%)

Query: 583 TRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERT 642
           ++ +   +A L     G+ DIL+ T +  +G+D P+V+L  V+N + A N+  +      
Sbjct: 599 SKTQEQREAALASLRNGQTDILVATDLAGRGIDVPDVSL--VVNFNMATNIESY------ 650

Query: 643 FQLLTQVAGRAGRAEKAG 660
               T   GR GRA K+G
Sbjct: 651 ----THRIGRTGRAGKSG 664


>DED1_ASPCL RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 681

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++     R     +   R +   +  L+ F      IL+ T + A+GLD PN
Sbjct: 460 TKRMADALSDFLINQRFPATAIHGDRTQRERERALEMFRSARCPILVATAVAARGLDIPN 519

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 520 VT--HVINYDLPTDIDDY----------VHRIGRTGRAGNTG 549


>UVRB_ZYMMO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 740

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQA----RILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T++  ++L E   +A    R +  DV+T  +      L+     G  D+L+G  ++ +
Sbjct: 483 TLTKRMAEDLTEYMYEAGLKVRYMHSDVETIERI----ELIRDLRLGVYDVLIGINLLRE 538

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P   LV VL+AD       F  SE +   L Q  GRA R  +   +L
Sbjct: 539 GLDIPECGLVAVLDADK----EGFLRSETS---LIQTIGRAARNAEGRVIL 582


>UVRB_STRS7 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRS2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPZ RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPG RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPD RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRPB RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRP8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRP6 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRP3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRP1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STREM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRE4 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRA5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRA3 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STRA1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_PROMT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  ++R+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADK----EGFLRAQRS---LIQTIGRAAR 542


>UVRB_PROM1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 678

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD       F  ++R+   L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADK----EGFLRAQRS---LIQTIGRAAR 542


>UVRB_MICLC RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 709

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   +   L  DVDT               +G  D+L+G  ++ +GLD P V+LV 
Sbjct: 471 DYLLEAGVKVEYLHSDVDTXXXXXXXXXXX----KGTFDVLVGINLLREGLDLPEVSLVA 526

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       R+   L Q  GRA R
Sbjct: 527 ILDADKEGFL-------RSTTSLIQTIGRAAR 551


>UVRB_BACSK RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G  D+L+G  ++ +G+D P V+LV +L+AD       F  +ER+   L Q  GRA R   
Sbjct: 494 GTFDVLIGINLLREGIDIPEVSLVAILDADK----EGFLRAERS---LIQTIGRAAR-NA 545

Query: 659 AGQVLIQSYNSQH 671
            G+V++ +    H
Sbjct: 546 NGRVIMYADKMTH 558


>RHLB_ECO57 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD+F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA   G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGANGHSI--SLACEEYALNLPAIETYIG 376


>DED1_BOTFB RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 683

 Score = 39.7 bits (91), Expect = 9e-05
 Identities = 63/304 (20%), Positives = 112/304 (36%), Gaps = 46/304 (15%)

Query: 369 SAIFAPLKNLGVMIIDEEHEAAYKQDSNPR--YHAREVAILRAQYNQATLVLGSATPSLE 426
           S I AP + L   I DE  + AY+    P   Y   ++     Q  +   +L +    L 
Sbjct: 274 SLILAPTRELVSQIYDESRKFAYRSWVRPCVVYGGADIGSQLRQMERGCDLLVATPGRLV 333

Query: 427 SRARAGKGVYQHLRL-----TQRANPLATIPEVQ-VIDFRDYIG--QNETSNFTPPLLEA 478
                G+   Q+++        R   +   P+++ +++  D  G    +T  F+      
Sbjct: 334 DLIERGRISLQNIKYLVLDEADRMLDMGFEPQIRRIVEGEDMPGVQNRQTLMFSATFPRD 393

Query: 479 IQ--DRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGF 536
           IQ   R   K+ V L + R G +S  + ++   V+      + L +      ++ H  G 
Sbjct: 394 IQMLARDFLKDYVFLSVGRVGSTSENITQKVEYVEDIDKRSVLLDI------LHTHGAGL 447

Query: 537 SKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQF 596
           +    +                T++  D L++           +   R +   +  L+ F
Sbjct: 448 TLIFVE----------------TKRMADSLSDFLINQNFPATSIHGDRTQRERERALEMF 491

Query: 597 GRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRA 656
             G   IL+ T + A+GLD PNV    V+N D   ++ D+              GR GRA
Sbjct: 492 RNGRCPILVATAVAARGLDIPNVK--HVVNYDLPTDIDDY----------VHRIGRTGRA 539

Query: 657 EKAG 660
              G
Sbjct: 540 GNTG 543


>UVRB_STRPF RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 663

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E+  + + +  D+ T  +      ++     G  D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKEMGVKVKYMHSDIKTLERT----EIIRDLRLGIFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD       F  +ER    L Q  GRA R
Sbjct: 524 ILDADK----EGFLRNERG---LIQTIGRAAR 548


>UVRB_STAS1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 660

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  ++L     +A I    + +  K      ++     G  D+++G  ++ +G+D 
Sbjct: 453 TLTKKMSEDLTIYLKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDI 512

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI---QSYNSQHYA 673
           P V+LV +L+AD       F  S+R+   L Q  GRA R  + G+V++   +  +S  YA
Sbjct: 513 PEVSLVVILDADK----EGFLRSQRS---LVQTIGRAARNSR-GEVIMYGDKITDSMRYA 564

Query: 674 I 674
           +
Sbjct: 565 L 565


>UVRB_RICAE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query: 557 TGTQKAYDELA----ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T TQK  ++L     EL  +   L  +V T  +      +L    +G  D+L+G  ++ +
Sbjct: 452 TLTQKMAEDLTAYLQELKYKTSYLHSNVHTLERI----EILRDLRQGTIDVLVGINLLRE 507

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           GLD P   LV +L+AD       F  SE +   L Q  GRA R   AG+V++
Sbjct: 508 GLDIPECGLVAILDADK----EGFLRSEVS---LIQTIGRAAR-NSAGRVIL 551


>UVRB_PROM4 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 679

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           GE D+L+G  ++ +GLD P V+LV +L+AD    L   RS       L Q  GRA R
Sbjct: 493 GEYDVLVGVNLLREGLDLPEVSLVVILDADKEGFLRAKRS-------LIQTIGRAAR 542


>UVRB_MYCPE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 7/97 (7%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T +  +EL E      I    +    K      +L+   +G  D+++G  ++ +GLD P 
Sbjct: 459 TIRLAEELTEYLRNKNIKVAYLHNELKTIERFKILNNLRKGIYDVVIGINLLREGLDVPE 518

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           V+ V +L+AD     P F  S+++   L Q+ GRA R
Sbjct: 519 VSKVLILDADK----PGFFRSDKS---LIQIIGRASR 548


>UVRB_MICAN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 667

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G  D+L+G  ++ +GLD P V+LV +L+AD    L   RS       L Q  GRA R  +
Sbjct: 493 GVFDVLIGVNLLREGLDLPEVSLVAILDADKEGFLRATRS-------LIQTIGRAARHIR 545

Query: 659 AGQVLIQSYN 668
            GQ ++   N
Sbjct: 546 -GQAILYGDN 554


>UVRB_FRATT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 668

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 15/111 (13%)

Query: 557 TGTQKAYDELAELFPQ----ARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAK 612
           T T+K  + L E   +     R L  D+DT  +      ++     G  D+L+G  ++ +
Sbjct: 451 TLTKKMVENLTEYLSEHGVNVRYLHSDIDTVERV----QIIHDLRHGVFDVLVGINLLRE 506

Query: 613 GLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           GLD P V ++ + +AD       F  SE++   L Q  GR  R +    +L
Sbjct: 507 GLDMPEVGVLLIFDADK----EGFLRSEKS---LIQTIGRVARNQNGRAIL 550


>ROK1_NEOFI RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 738

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 14/108 (12%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           YD  AE    +RI  +  D +   G    ++  F +GE  IL+ T ++A+G+DF  +   
Sbjct: 528 YDIPAEAGGSSRIAVLHSDLS--DGQRSEIMKNFRKGEIWILVTTDLLARGVDFRGIN-- 583

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
           GV+N D    +P+      +  +     GR GRA + G + +  Y  +
Sbjct: 584 GVVNYD----IPN------SAAVYVHRVGRTGRAGREGGIAVTYYTKE 621


>ROK1_ASPFU RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 739

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 14/108 (12%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           YD  AE    +RI  +  D +   G    ++  F +GE  IL+ T ++A+G+DF  +   
Sbjct: 529 YDIPAEAGGSSRIAVLHSDLS--DGQRSEIMKNFRKGEIWILVTTDLLARGVDFRGIN-- 584

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
           GV+N D    +P+      +  +     GR GRA + G + +  Y  +
Sbjct: 585 GVVNYD----IPN------SAAVYVHRVGRTGRAGREGGIAVTYYTKE 622


>RHLB_SERP5 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +LD F +G  DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILDDFTKGNLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_PHOLL RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L++F  G  DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEEFSNGNIDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA ++G  +  S   + YA+     +DY
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIEDY 374


>RHLB_KLEP7 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L++F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEEFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLPAIETYIG 376


>RHLB_AERHH RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 429

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G  DIL+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 289 DVPQKK--RMKILEDFTKGTVDILVATDVAARGLHIPDVT--HVFNYDLPDDAEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA K+G  +  S   + YA      ++Y
Sbjct: 341 ------VHRIGRTGRAGKSGHSI--SLACEDYAFNLPAIEEY 374


>RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
              EC=3.6.1.-;AltName: Full=Protein EMBRYO DEFECTIVE
           1138;
          Length = 748

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 12/83 (14%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L+ F +G+  +L+ T + ++GLD PNV LV          LP   +   TF      +GR
Sbjct: 393 LNAFRQGKFTVLVATDVASRGLDIPNVDLV------IHYELP---NDPETF---VHRSGR 440

Query: 653 AGRAEKAGQVLIQSYNSQHYAIR 675
            GRA K G  ++   +SQ   +R
Sbjct: 441 TGRAGKEGSAILMHTSSQKRTVR 463


>PRP28_ASPOR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 803

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G+ D+L+ T +  +G+D P+V+LV 
Sbjct: 656 DAIAREIKQWGFSSVTLHGSKTQEQREAALASVRNGQTDVLVATDLAGRGIDVPDVSLVI 715

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
             N  T            T +  T   GR GRA K+G
Sbjct: 716 NFNMAT------------TIESYTHRIGRTGRAGKSG 740


>DDX47_DICDI RecName: Full=Probable ATP-dependent RNA helicase
           ddx47;         EC=3.6.1.-;AltName: Full=DEAD box protein
           47;
          Length = 546

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 15/107 (14%)

Query: 586 KGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQL 645
           +G   A L++F +G   IL+ T + A+GLD P+V L  V+N D   N  ++         
Sbjct: 394 QGKRLASLNKFKQGTKSILVATDVAARGLDIPSVDL--VINYDVPTNSKEY--------- 442

Query: 646 LTQVAGRAGRAEKAGQ--VLIQSYNSQHY-AIRFAKDQDYEGFYAYE 689
                GR  RA  +G+   ++  Y+ + Y  I F   +  + F   E
Sbjct: 443 -VHRVGRTARAGNSGRAITIVTQYDVEMYQRIEFVLKKKLDSFPCQE 488


>DBP5_CHAGB RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 479

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 577 RMDVD---TTRKKGSHQ-----ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD 628
           RM+ D    +   G+H+     ALLD F  G + +L+ T ++A+G+D  +V++  V+N D
Sbjct: 331 RMEADGHKVSALHGAHEGQNRDALLDDFRSGRSKVLITTNVLARGIDVSSVSM--VINYD 388

Query: 629 TALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
             +  P     E   +      GR GR  + G  +   Y+ + Y
Sbjct: 389 IPMKGPG--DKEPDMETYLHRIGRTGRFGRVGVSISFVYDRKSY 430


>DBP3_GIBZE RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 581

 Score = 39.3 bits (90), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 12/71 (16%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L+ F  G+  +L+ T + A+GLD P V L  V+N    L + D+              GR
Sbjct: 460 LEAFKSGQTPVLVATDVAARGLDIPEVKL--VINVTFPLTIEDY----------VHRIGR 507

Query: 653 AGRAEKAGQVL 663
            GRA K GQ +
Sbjct: 508 TGRAGKTGQAI 518


>UVRB_ONYPE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 672

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L     G+ D L+G  ++ +GLD P V LV +L+AD       F  +ER+   L Q  G
Sbjct: 489 ILKDLRLGKYDCLVGVNLLREGLDLPEVALVAILDADK----QGFLRNERS---LIQTIG 541

Query: 652 RAGR 655
           RA R
Sbjct: 542 RAAR 545


>UVRB_CAMJR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 16/110 (14%)

Query: 559 TQKAYDELA----ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T+K  +EL     EL  + + +  D+D   +    + L      G  D+L+G  ++ +GL
Sbjct: 455 TKKLAEELTRYYLELGIKVKYMHSDIDAIERNEIIRGLRS----GAFDMLIGINLLREGL 510

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           D P V+L+ +++AD    L       R+   L Q  GRA R    G+VL+
Sbjct: 511 DLPEVSLIAIMDADKEGFL-------RSTTSLIQTMGRAAR-NVNGKVLL 552


>UVRB_CAMJE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 657

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 16/110 (14%)

Query: 559 TQKAYDELA----ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGL 614
           T+K  +EL     EL  + + +  D+D   +    + L      G  D+L+G  ++ +GL
Sbjct: 455 TKKLAEELTRYYLELGIKVKYMHSDIDAIERNEIIRGLRS----GAFDMLIGINLLREGL 510

Query: 615 DFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           D P V+L+ +++AD    L       R+   L Q  GRA R    G+VL+
Sbjct: 511 DLPEVSLIAIMDADKEGFL-------RSTTSLIQTMGRAAR-NVNGKVLL 552


>UVRB_ANAMM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 651

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  + L E   +  I    + +  K      ++     G  D+L+G  ++ +GLD 
Sbjct: 451 TLTKKMAENLTEYMREMGIKVAYLHSDVKTLERIEIISDLRLGVIDVLVGVNLMREGLDI 510

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P   LVG+L+AD    L       R+   L Q  GRA R
Sbjct: 511 PECALVGILDADKEGFL-------RSTTSLIQTIGRAAR 542


>UVRB_ANAMF RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 651

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T+K  + L E   +  I    + +  K      ++     G  D+L+G  ++ +GLD 
Sbjct: 451 TLTKKMAENLTEYMREMGIKVAYLHSDVKTLERIEIISDLRLGVIDVLVGVNLMREGLDI 510

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           P   LVG+L+AD    L       R+   L Q  GRA R
Sbjct: 511 PECALVGILDADKEGFL-------RSTTSLIQTIGRAAR 542


>SPB4_DEBHA RecName: Full=ATP-dependent rRNA helicase SPB4;       
           EC=3.6.1.-;
          Length = 614

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 23/97 (23%)

Query: 593 LDQFGRGEA----DILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQ 648
           L  F  G++     +LL T + A+G+D P+V LV  L+  T  ++   RS          
Sbjct: 323 LQNFSEGDSMLHKHVLLTTDVAARGIDIPDVDLVIQLDPPTDPDVFFHRS---------- 372

Query: 649 VAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGF 685
             GR GRA K GQ ++   N+       ++++DY  F
Sbjct: 373 --GRTGRANKVGQAIVMLNNN-------SREEDYVNF 400


>RHLB_ENT38 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 421

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F RG+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTRGDLDILVATDVAARGLHIPAVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA  +G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGASGHSI--SLACEEYALNLTAIETYIG 376


>RHLB_AERS4 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 429

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G  DIL+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 289 DVPQKK--RMKILEDFTKGTLDILVATDVAARGLHIPDVT--HVFNYDLPDDAEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA K+G  +  S   + YA      ++Y
Sbjct: 341 ------VHRIGRTGRAGKSGHSI--SLACEDYAFNLPAIEEY 374


>RECG_ECOLI RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 693

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 33/115 (28%), Positives = 44/115 (38%), Gaps = 7/115 (6%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERF---IARFGDKVAILH 341
           L+QG  GSGKT             GK   L+ P   L  Q    F    A  G +V  L 
Sbjct: 293 LVQGDVGSGKTXXXXXXXXXXXXHGKQVALMAPTELLAEQHANNFRNWFAPLGIEVGWLA 352

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIF---APLKNLGVMIIDEEHEAAYKQ 393
                  +  +   +  G  Q++VG   AIF        L ++IIDE+H     Q
Sbjct: 353 GKQKGKARLAQQEAIASGQVQMIVGTH-AIFQEQVQFNGLALVIIDEQHRFGVHQ 406


>PRP28_COCIM RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 817

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+L  
Sbjct: 666 DAVARDIKQMGYSSVTLHGSKTQEQREAALASVRNGNTDVLVATDLAGRGIDVPDVSL-- 723

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           V+N + A N+  +          T   GR GRA K+G
Sbjct: 724 VVNFNMATNIESY----------THRIGRTGRAGKSG 750


>I4A3A_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-A;   
                EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3 A;
          Length = 415

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 290 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 349

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 350 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGGKGVAINFVK 386

Query: 679 DQD 681
           + D
Sbjct: 387 NDD 389


>DCL2_ASPOR RecName: Full=Dicer-like protein 2;Includes:  RecName:
           Full=Endoribonuclease dcl2;         
           EC=3.1.26.-;Includes:  RecName: Full=ATP-dependent
           helicase dcl2;
          Length = 1377

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 290 TGSGKTEVYLQIIQGALDKG---KTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSN 346
           TG+GKT++ L  I   L+ G   K    L P ++L  Q  E   +      A   +GL  
Sbjct: 38  TGTGKTQIALLRIAHQLEGGGPRKLTWFLTPTVALCLQQYEVIRSHLPAVRACTITGLDK 97

Query: 347 GEKYDE---WRKVERGDAQVVVGARSAIFAPLKN-------LGVMIIDEEHEAAYKQDSN 396
            E++     W ++ + D QVVV   + +F  L +       LG++I DE H    +  +N
Sbjct: 98  VERWKSQYIWDELLK-DKQVVVSTHAVLFEALTHGFVRISQLGLLIFDEAHHCMRRHPAN 156


>DBP5_CANGA RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 504

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           Y +L     Q  IL  D+ T  +      L+D F  G + +L+ T ++A+G+D P+V++V
Sbjct: 369 YGKLKHEGHQVSILHSDLRTDER----DRLIDDFREGRSKVLITTNVLARGIDIPSVSMV 424

Query: 623 GVLNADTALN-LPDF 636
              +  T  N +PD+
Sbjct: 425 VNYDLPTLPNGMPDY 439


>DBP2_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 572

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 25/107 (23%), Positives = 49/107 (45%), Gaps = 12/107 (11%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  D++     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 403 TGTKRVADDITRFLRQDGWPALSIHGDKQQNERDWVLNEFKTGKSPIMVATDVASRGIDV 462

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            N+T   V N D   N  D+              GR GRA + G  +
Sbjct: 463 RNIT--HVFNYDYPNNSEDY----------IHRIGRTGRAGQKGTAI 497


>DBP2_BOTFB RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 514

 Score = 38.9 bits (89), Expect = 2e-04
 Identities = 25/107 (23%), Positives = 49/107 (45%), Gaps = 12/107 (11%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  D++     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 356 TGTKRVADDITRFLRQDGWPALSIHGDKQQNERDWVLNEFKTGKSPIMVATDVASRGIDV 415

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            N+T   V N D   N  D+              GR GRA + G  +
Sbjct: 416 RNIT--HVFNYDYPNNSEDY----------IHRIGRTGRAGQKGTAI 450


>UVRB_RICRS RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  D+L+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDVLVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVLI 664
           RA R   AG+V++
Sbjct: 540 RAAR-NSAGRVIL 551


>UVRB_RICRO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  D+L+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDVLVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVLI 664
           RA R   AG+V++
Sbjct: 540 RAAR-NSAGRVIL 551


>UVRB_RICPU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  D+L+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDVLVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVLI 664
           RA R   AG+V++
Sbjct: 540 RAAR-NSAGRVIL 551


>UVRB_RICCN RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  D+L+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDVLVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVLI 664
           RA R   AG+V++
Sbjct: 540 RAAR-NSAGRVIL 551


>UVRB_LEPBP RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 7/58 (12%)

Query: 598 RGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +G  D ++G  ++ +GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 492 KGVYDCIVGINLLREGLDIPEVSLVAILDADKEGFLRNYKS-------LVQTIGRAAR 542


>UVRB_LEPBA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 664

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 7/58 (12%)

Query: 598 RGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +G  D ++G  ++ +GLD P V+LV +L+AD    L +++S       L Q  GRA R
Sbjct: 492 KGVYDCIVGINLLREGLDIPEVSLVAILDADKEGFLRNYKS-------LVQTIGRAAR 542


>UVRB_LACJO RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  + R L  D+ T                G+ D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKDLGIKVRYLHSDIKTXXXXXXXXXXXX----GKFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       R+ + L Q  GRA R
Sbjct: 524 ILDADKEGFL-------RSTRPLVQTIGRAAR 548


>UVRB_LACGA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 671

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L +L  + R L  D+ T                G+ D+L+G  ++ +G+D P V+LV 
Sbjct: 468 DYLKDLGIKVRYLHSDIKTXXXXXXXXXXXX----GKFDVLIGINLLREGIDVPEVSLVA 523

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           +L+AD    L       R+ + L Q  GRA R
Sbjct: 524 ILDADKEGFL-------RSTRPLVQTIGRAAR 548


>UVRB_BEUC1 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 698

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 12/99 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L E   + R L  +VDT                G  D+L+G  ++ +GLD P V+LV 
Sbjct: 471 DYLLERGVRVRYLHSEVDTXXXXXXXXXXXT----GVFDVLVGINLLREGLDLPEVSLVA 526

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQV 662
           +L+AD    L       R+   L Q  GRA R   +GQV
Sbjct: 527 ILDADKEGFL-------RSGTSLIQTIGRAAR-NVSGQV 557


>RRP3_CHAGB RecName: Full=ATP-dependent rRNA helicase RRP3;       
           EC=3.6.1.-;
          Length = 493

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 23/104 (22%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L++F  G  DIL+ T + A+GLD PNV        D  LNL D     +T+        R
Sbjct: 348 LNKFRAGSRDILVATDVAARGLDIPNV--------DCVLNL-DLPGDSKTY------VHR 392

Query: 653 AGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQL 696
            GR  +AG+          +AI F    D E +   E  +  +L
Sbjct: 393 VGRTARAGR--------SGHAISFVTQYDLELWLRIEAALGTKL 428


>ROK1_ASPNC RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 729

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 12/84 (14%)

Query: 587 GSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLL 646
           G    ++ QF +GE  IL+ T ++A+G+DF  +   GV+N D    +P+      +  + 
Sbjct: 543 GQRSEIMKQFRKGEIWILVTTDLLARGVDFRGIN--GVVNYD----IPN------SAAVY 590

Query: 647 TQVAGRAGRAEKAGQVLIQSYNSQ 670
               GR GRA + G + +  Y  +
Sbjct: 591 VHRVGRTGRAGREGGIAVTYYTKE 614


>RHLB_YERPY RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPS RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPP RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPN RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPE RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPB RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERPA RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RHLB_YERP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 428

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L+ F +G+ DIL+ T + A+GL  P VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEDFTKGDLDILVATDVAARGLHIPLVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGESGHSI--SLACEEYALNLPAIETYTG 376


>RH47A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47A; 
                  EC=3.6.1.-;
          Length = 573

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 29/132 (21%)

Query: 586 KGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQL 645
           K +   +L +F  GE  +L+  ++ A+GLD P   L  V+N D   +   +         
Sbjct: 467 KLARSTVLKKFKDGEFRVLVTNELSARGLDVPECDL--VINLDLPTDSTHY--------- 515

Query: 646 LTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYP--PYYF 703
               AGR GR  + G V+     ++ + +R                +R+QL  P  P  F
Sbjct: 516 -AHRAGRTGRLGRKGTVVTICEETETFVVR---------------KMRKQLAVPIKPCEF 559

Query: 704 TIGITLSHKKEE 715
           T G  L HK+E+
Sbjct: 560 TEGKLLVHKEED 571


>RH31_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 31;   
                EC=3.6.1.-;
          Length = 547

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 12/121 (9%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T K    +AEL  + ++   ++ + + +     +  +F   +  IL+ + + A+G+D+PN
Sbjct: 346 TAKVTSLVAELLSELKLNVREIHSRKPQSYRTRISKEFKESKGLILVSSDVSARGVDYPN 405

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           VTLV  +   T          E+    L    GR GR    G  ++     + Y +R  K
Sbjct: 406 VTLVVQMGVPT--------DREQYIHRL----GRTGRRGNEGSGILLLAPWEEYFLRSIK 453

Query: 679 D 679
           D
Sbjct: 454 D 454


>PRP28_GIBZE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 721

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 23/104 (22%)

Query: 583 TRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERT 642
           ++ +   +A L     G   +L+ T +  +G+D P+V+L  V+N + A N+  +      
Sbjct: 594 SKTQEQREAALGSVRAGHTQVLVATDLAGRGIDVPDVSL--VVNFNMATNIESY------ 645

Query: 643 FQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFY 686
               T   GR GRA K+G            AI F   +D+E  Y
Sbjct: 646 ----THRIGRTGRAGKSG-----------VAITFLGPEDHETMY 674


>IF4A3_XENTR RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 415

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 290 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 349

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 350 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 386

Query: 679 DQD 681
           + D
Sbjct: 387 NDD 389


>IF4A3_TAEGU RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 410

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 285 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 344

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 345 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 381

Query: 679 DQD 681
           + D
Sbjct: 382 NDD 384


>IF4A3_SALSA RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 406

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 281 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 340

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 341 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 377

Query: 679 DQD 681
           + D
Sbjct: 378 NDD 380


>IF4A3_RAT RecName: Full=Eukaryotic initiation factor 4A-III;       
            EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>IF4A3_PIG RecName: Full=Eukaryotic initiation factor 4A-III;       
            EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>IF4A3_MOUSE RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>IF4A3_MACFA RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>IF4A3_HUMAN RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>IF4A3_CHICK RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 412

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 287 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 346

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 347 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 383

Query: 679 DQD 681
           + D
Sbjct: 384 NDD 386


>IF4A3_BOVIN RecName: Full=Eukaryotic initiation factor 4A-III;     
              EC=3.6.1.-;AltName: Full=Eukaryotic translation
           initiation factor 4A isoform 3;
          Length = 411

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 286 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 345

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 346 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 382

Query: 679 DQD 681
           + D
Sbjct: 383 NDD 385


>I4A3B_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-B;   
                Short=XeIF-4AIII;         EC=3.6.1.-;AltName:
           Full=Eukaryotic translation initiation factor 4A isoform
           3-B;
          Length = 414

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L E   +A      +     +   ++++ +F  G + +L+ T + A+GLD P 
Sbjct: 289 TKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQ 348

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  ++N D    LP+ R      +L     GR+GR           Y  +  AI F K
Sbjct: 349 VSL--IINYD----LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVK 385

Query: 679 DQD 681
           + D
Sbjct: 386 NDD 388


>DED1_PICGU RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 637

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  D LA+           +   R +   +  L  F  G A IL+ T + A+GLD 
Sbjct: 433 TETKRMADNLADFLYDQGFPATAIHGDRSQYEREKALAAFKSGTAPILVATAVAARGLDI 492

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           PNV+   V+N D   ++ D+              GR GRA   G
Sbjct: 493 PNVS--HVVNYDLPGDIDDY----------VHRIGRTGRAGNVG 524


>DED1_GIBZE RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 675

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L++           +   R +   +  L+ F  G   IL+ T + A+GLD P+
Sbjct: 454 TKRMADSLSDFLINQNFPATSIHGDRTQRERERALEFFRNGRCPILVATAVAARGLDIPH 513

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+N D   ++ D+              GR GRA   G
Sbjct: 514 VT--HVINYDLPTDVDDY----------VHRIGRTGRAGNTG 543


>DED1_DEBHA RecName: Full=ATP-dependent RNA helicase DED1;       
           EC=3.6.1.-;
          Length = 630

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           T T++  D LA+           +   R +   +  L  F  G A IL+ T + A+GLD 
Sbjct: 420 TETKRMADNLADFLYDQGFPATAIHGDRSQYEREKALAAFKTGTAPILVATAVAARGLDI 479

Query: 617 PNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           PNV+   ++N D   ++ D+              GR GRA   G
Sbjct: 480 PNVS--HIVNYDLPSDIDDY----------VHRIGRTGRAGNIG 511


>DED1_CRYNE RecName: Full=ATP-dependent RNA helicase ded1;       
           EC=3.6.1.-;
          Length = 637

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T++  D L +     R     +   R +   +A L  F  G A IL+ T + A+GLD PN
Sbjct: 431 TKRMADTLCDFLCSRRHNATSIHGDRTQREREAALYAFKSGRAPILVATAVAARGLDIPN 490

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           VT   V+  D   ++ ++          T   GR GRA   G
Sbjct: 491 VT--HVILYDLPNDVAEY----------THRIGRTGRAGNVG 520


>DBP5_PICST RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 500

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           L+D F  G + +L+ T ++A+G+D  +V++  V+N D    LP  +             G
Sbjct: 390 LIDDFREGRSKVLITTNVLARGIDIASVSM--VVNYD----LPTDKDGNADPSTYLHRIG 443

Query: 652 RAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
           R GR  + G  +   Y+ + Y I   K +DY G
Sbjct: 444 RTGRFGRVGVSISFIYDKRSYEI-LMKIKDYFG 475


>UVRB_WOLTR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 645

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 560 QKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           +K  + ++EL  +   L  D+    +      L  +    E D+L+G  ++ +GLD P  
Sbjct: 458 EKLAEHMSELNMKVSYLHSDISALERIDIVYKLRSK----EIDVLIGVNLLREGLDIPEC 513

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
            LV +L+AD       F  SE +   L Q  GRA R  ++  +L
Sbjct: 514 GLVAILDADK----EGFLRSETS---LIQTIGRAARNAESRAIL 550


>UVRB_CHLMU RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 676

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L     G  D+L+G  ++ +G+D P V+LV +L+AD    L       R+   L Q  G
Sbjct: 499 ILTDLRLGTIDVLIGVNLLREGIDLPEVSLVAILDADKEGFL-------RSSASLIQFCG 551

Query: 652 RAGR 655
           RA R
Sbjct: 552 RAAR 555


>UVRB_ARTCA RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 704

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G  D+L+G  ++ +GLD P V+LV +L+AD    L       R+   L Q  GRA R   
Sbjct: 502 GTFDVLVGINLLREGLDLPEVSLVSILDADKEGFL-------RSSTSLIQTIGRAAR-NV 553

Query: 659 AGQV 662
           +GQV
Sbjct: 554 SGQV 557


>ROK1_ASPOR RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 725

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 14/108 (12%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           YD   E    +RI  +  D +   G    ++  F +GE  IL+ T ++A+G+DF  +   
Sbjct: 514 YDIPPEAGGSSRIAVLHSDLS--DGQRSEIMKNFRKGEIWILVTTDLLARGIDFRGIN-- 569

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
           GV+N D    +P+      +  +     GR GRA + G V +  Y  +
Sbjct: 570 GVVNYD----IPN------SAAVYVHRVGRTGRAGREGGVAVTYYTKE 607


>RHLB_PROMH RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 432

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L+ F +G  DIL+ T + A+GL  P+VT   V N D   +  D+              G
Sbjct: 298 ILEDFTQGNIDILVATDVAARGLHIPSVT--HVFNYDLPDDCEDY----------VHRIG 345

Query: 652 RAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
           R GRA K+G  +  S   + YA+     + Y
Sbjct: 346 RTGRAGKSGNSI--SLACEEYALNLPAIETY 374


>RHLB_HAMD5 RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 422

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 12/69 (17%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +LD F +G  DIL+ T + A+GL  P VT   V N D   N+ D+              G
Sbjct: 298 ILDDFSKGYLDILVATDVAARGLHIPKVT--HVFNYDLPENVEDY----------IHRIG 345

Query: 652 RAGRAEKAG 660
           R GRA + G
Sbjct: 346 RTGRAGEKG 354


>RECG_ECO57 RecName: Full=ATP-dependent DNA helicase recG;       
           EC=3.6.1.-;
          Length = 693

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 33/115 (28%), Positives = 44/115 (38%), Gaps = 7/115 (6%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARF---GDKVAILH 341
           L+QG  GSGKT             GK   L+ P   L  Q    F   F   G +V  L 
Sbjct: 293 LVQGDVGSGKTXXXXXXXXXXXXHGKQVALMAPTELLAEQHANNFRNWFEPLGIEVGWLA 352

Query: 342 SGLSNGEKYDEWRKVERGDAQVVVGARSAIF---APLKNLGVMIIDEEHEAAYKQ 393
                  +  +   +  G  Q++VG   AIF        L ++IIDE+H     Q
Sbjct: 353 GKQKGKARLSQQEAIASGQVQMIVGTH-AIFQEQVQFNGLALVIIDEQHRFGVHQ 406


>PRP28_ASPTN RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 783

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+LV 
Sbjct: 636 DAIAREIKQWGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSLVV 695

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
             N  T++            +  T   GR GRA K+G
Sbjct: 696 NFNMATSI------------ESYTHRIGRTGRAGKSG 720


>PRP28_ASPNC RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 810

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+LV 
Sbjct: 662 DAIAREIKQWGFSSVTLHGSKTQDQREAALASVRNGTTDVLVATDLAGRGIDVPDVSLVV 721

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
             N  T++            +  T   GR GRA K+G
Sbjct: 722 NFNMATSI------------ESYTHRIGRTGRAGKSG 746


>MFD_BUCBP RecName: Full=Transcription-repair-coupling factor;      
             Short=TRCF;         EC=3.6.1.-;AltName:
           Full=ATP-dependent helicase mfd;
          Length = 697

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           P  L P+Q  A ++V+S +  S P   L+ G  G GKTEV ++    A+   K   +LVP
Sbjct: 151 PFTLTPDQDSAINSVLSDMYKSTPMDRLVCGDVGFGKTEVAMRATFLAVCNQKQVAILVP 210

Query: 318 EISLTPQMTERFIARF 333
              L  Q    F  RF
Sbjct: 211 TTLLAQQHFNNFTLRF 226


>DBP5_PHANO RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 471

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           ++DQF  GEA +L+ T ++A+G+D  +VT+  V+N D    + D R ++    L     G
Sbjct: 345 VIDQFRSGEAKVLITTNVLARGIDVESVTM--VINYDVP-TMADGREADPETYL--HRIG 399

Query: 652 RAGRAEKAGQVL 663
           R GR  + G  L
Sbjct: 400 RTGRFGRVGVAL 411


>DBP3_CRYNE RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 605

 Score = 38.1 bits (87), Expect = 3e-04
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L+ F  G+ ++L+ T + A+GLD P+V L  V+N    L   DF              GR
Sbjct: 482 LEAFKTGQQNVLVATDVAARGLDIPDVGL--VINVTFPLTTEDF----------VHRCGR 529

Query: 653 AGRAEKAGQVL 663
            GRA K G+ +
Sbjct: 530 TGRAGKTGKAV 540


>UVRB_RICAH RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILQDLRQGTIDILVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSEGRVIL 551


>UVRB_ARTS2 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 693

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G  D+L+G  ++ +GLD P V+LV +L+AD    L       R+   L Q  GRA R   
Sbjct: 502 GVFDVLVGINLLREGLDLPEVSLVSILDADKEGFL-------RSSTSLIQTIGRAAR-NV 553

Query: 659 AGQV 662
           +GQV
Sbjct: 554 SGQV 557


>UVRB_ARTAT RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 699

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G  D+L+G  ++ +GLD P V+LV +L+AD    L       R+   L Q  GRA R   
Sbjct: 502 GVFDVLVGINLLREGLDLPEVSLVSILDADKEGFL-------RSSTSLIQTIGRAAR-NV 553

Query: 659 AGQV 662
           +GQV
Sbjct: 554 SGQV 557


>ROK1_COCIM RecName: Full=ATP-dependent RNA helicase ROK1;       
           EC=3.6.1.-;
          Length = 730

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 14/108 (12%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           YD  AE    +RI  +  + +  K S   ++  F +GE  +L+ T ++A+G+DF  +   
Sbjct: 522 YDIPAEAGGSSRIAVLHSELSDSKRSD--VMAGFRKGEIWVLITTDLLARGVDFRGIN-- 577

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
           GV+N D    +P+  +S           GR GRA + G V +  Y  +
Sbjct: 578 GVVNYD----IPNSSAS------YVHRVGRTGRAGREGGVAVTFYTKE 615


>ROK1_ASPCL RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 738

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 14/108 (12%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           YD   E    +RI  +  D +   G    ++  F +GE  IL+ T ++A+G+DF  +   
Sbjct: 527 YDIPTEAGGSSRIAVLHSDLS--DGQRSEIMKNFRKGEIWILVTTDLLARGVDFRGIN-- 582

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
           GV+N D    +P+      +  +     GR GRA + G + +  Y  +
Sbjct: 583 GVVNYD----IPN------SAAVYVHRVGRTGRAGREGGIAVTYYTKE 620


>RHLB_PECCP RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 430

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L++F +G  DIL+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEEFTQGNLDILVATDVAARGLHIPSVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGQSGFSI--SLACEEYALNLPAIETYIG 376


>RHLB_PASMU RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 423

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK    +LL QF  G  DIL+ T + A+GL   +V+   V N D    LPD R   
Sbjct: 287 DVAQKK--RLSLLKQFTEGHLDILVATDVAARGLHISDVS--HVFNYD----LPDDRED- 337

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDY 682
                     GR GRA ++G  +  S+  + YA+     ++Y
Sbjct: 338 -----YVHRIGRTGRAGESGVSI--SFACEEYAMNLPAIEEY 372


>RHLB_ERWCT RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 430

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 581 DTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSE 640
           D  +KK     +L++F +G  DIL+ T + A+GL  P+VT   V N D   +  D+    
Sbjct: 289 DVAQKK--RLRILEEFTQGSIDILVATDVAARGLHIPSVT--HVFNYDLPDDCEDY---- 340

Query: 641 RTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
                     GR GRA ++G  +  S   + YA+     + Y G
Sbjct: 341 ------VHRIGRTGRAGQSGFSI--SLACEEYALNLPAIETYIG 376


>PRP28_EMENI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 782

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+LV 
Sbjct: 635 DAIAREIKQWGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSLVI 694

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
             N  T++            +  T   GR GRA K+G
Sbjct: 695 NFNMATSI------------ESYTHRIGRTGRAGKSG 719


>PRP28_CANAL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 581

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 30/122 (24%), Positives = 50/122 (40%), Gaps = 23/122 (18%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D L++      I  + +  ++ +   +  +  F   E+++L+ T + A+G+D PNVTL  
Sbjct: 455 DSLSQELSSNDINNVVIHGSKSQDMREQAITNFRNHESEVLIATDVAARGIDIPNVTL-- 512

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYE 683
           V+N              + F       GR GRA   G+           +  F  DQD E
Sbjct: 513 VINYQMV----------KKFDEYIHRIGRTGRAGNLGE-----------SFTFISDQDTE 551

Query: 684 GF 685
            F
Sbjct: 552 IF 553


>PRP28_ASPCL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 798

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 12/78 (15%)

Query: 583 TRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERT 642
           ++ +   +A L     G  D+L+ T +  +G+D P+V+LV   N  T++           
Sbjct: 669 SKTQDQREAALASVRNGSTDVLVATDLAGRGIDVPDVSLVVNFNMATSI----------- 717

Query: 643 FQLLTQVAGRAGRAEKAG 660
            +  T   GR GRA K+G
Sbjct: 718 -ESYTHRIGRTGRAGKSG 734


>DCL2_EMENI RecName: Full=Dicer-like protein 2;Includes:  RecName:
           Full=Endoribonuclease dcl2;         
           EC=3.1.26.-;Includes:  RecName: Full=ATP-dependent
           helicase dcl2;
          Length = 1429

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 61/240 (25%), Positives = 92/240 (38%), Gaps = 29/240 (12%)

Query: 256 ASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDK--GKTAI 313
           AS P E + E R     +     S +   ++   TGSGKT++ L  I   L+   GK   
Sbjct: 2   ASIPEERSAEHRARSYQLEMFEASLKGNIIVVMGTGSGKTQIALLRIIHELENSDGKLIW 61

Query: 314 LLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDA-----QVVVGAR 368
            L P + L  Q   R I++     A+    L   +K + W +    DA     QV+V   
Sbjct: 62  FLAPTVPLCLQQ-HRVISQHIP--AVKSRTLLGSDKVELWTEQAVWDAVLEGLQVIVSTP 118

Query: 369 SAI-------FAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLG-S 420
           + +       F  +  LG++I DE H    K  +N         I+R  Y+ A    G  
Sbjct: 119 AVLHDAMTHGFVRISRLGLLIFDEAHHCIRKHPTN--------MIMRNFYHPALQEYGPG 170

Query: 421 ATPS-LESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSN--FTPPLLE 477
           A P  L   A AG        +    N + T P+    +  +Y    E     +TP + E
Sbjct: 171 AVPRILGLTASAGSSREGLQTIEMNLNSVCTTPQAHRQELLEYTHMPELRRVLYTPLMKE 230


>DBP5_YEAST RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;AltName: Full=DEAD box protein 5;AltName:
           Full=Helicase CA5/6;
          Length = 482

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           Y +L     +  IL  D+ T  +      L+D F  G + +L+ T ++A+G+D P V++ 
Sbjct: 347 YGKLKSEGHEVSILHGDLQTQER----DRLIDDFREGRSKVLITTNVLARGIDIPTVSM- 401

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
            V+N D    LP   + +          GR GR  + G
Sbjct: 402 -VVNYD----LPTLANGQADPATYIHRIGRTGRFGRKG 434


>DBP5_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;AltName: Full=DEAD box protein 5;AltName:
           Full=Helicase CA5/6;
          Length = 482

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           Y +L     +  IL  D+ T  +      L+D F  G + +L+ T ++A+G+D P V++ 
Sbjct: 347 YGKLKSEGHEVSILHGDLQTQER----DRLIDDFREGRSKVLITTNVLARGIDIPTVSM- 401

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
            V+N D    LP   + +          GR GR  + G
Sbjct: 402 -VVNYD----LPTLANGQADPATYIHRIGRTGRFGRKG 434


>DBP5_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-5;       
           EC=3.6.1.-;
          Length = 483

 Score = 37.7 bits (86), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 588 SHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLT 647
           S   LLD+F  G + +L+ T ++A+G+D  +V++  V+N D  +  P  R  +    L  
Sbjct: 352 SRDVLLDEFRSGRSKVLITTNVLARGIDVSSVSM--VINYDIPMKGPGEREPDAETYL-- 407

Query: 648 QVAGRAGRAEKAG 660
              GR GR  + G
Sbjct: 408 HRIGRTGRFGRVG 420


>UVRB_RICPR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +G+D P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRNLRQGTIDILVGINLLREGIDIPECGLVAILDADK----EGFLRSETS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSRGKVIL 551


>SPB42_CANAL RecName: Full=ATP-dependent rRNA helicase SPB42;       
            EC=3.6.1.-;
          Length = 631

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 23/97 (23%)

Query: 593 LDQFGRGEAD----ILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQ 648
           LD F +G+ +    IL+ T + A+G+D P+V LV  ++  T  N            +   
Sbjct: 329 LDNFTQGDINLYKHILMTTDVAARGIDIPDVDLVIQIDPPTDPN------------VFLH 376

Query: 649 VAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGF 685
             GR GRA K G+ ++   ++        +++DY GF
Sbjct: 377 RCGRTGRANKVGRAIVMLNDN-------CQEEDYIGF 406


>SPB41_CANAL RecName: Full=ATP-dependent rRNA helicase SPB41;       
            EC=3.6.1.-;
          Length = 631

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 23/97 (23%)

Query: 593 LDQFGRGEAD----ILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQ 648
           LD F +G+ +    IL+ T + A+G+D P+V LV  ++  T  N            +   
Sbjct: 329 LDNFTQGDINLYKHILMTTDVAARGIDIPDVDLVIQIDPPTDPN------------VFLH 376

Query: 649 VAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGF 685
             GR GRA K G+ ++   ++        +++DY GF
Sbjct: 377 RCGRTGRANKVGRAIVMLNDN-------CQEEDYIGF 406


>RHLB_SODGM RecName: Full=ATP-dependent RNA helicase rhlB;       
           EC=3.6.1.-;
          Length = 415

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 14/93 (15%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L++F +G  DIL+ T + A+GL  P+VT   V N D   +  D+              G
Sbjct: 298 ILEKFTQGALDILVATDVAARGLHIPSVT--HVFNYDLPDDCEDY----------VHRIG 345

Query: 652 RAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEG 684
           R GRA ++G  +  S   + YA+     + Y G
Sbjct: 346 RTGRAGESGCSI--SLACEEYALNLTAIESYIG 376


>PRP28_NEOFI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 796

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+L  
Sbjct: 648 DAIAREIKQMGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSL-- 705

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           V+N + A ++  +          T   GR GRA K+G
Sbjct: 706 VVNFNMANSIESY----------THRIGRTGRAGKSG 732


>PRP28_DEBHA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 580

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 27/102 (26%), Positives = 53/102 (51%), Gaps = 13/102 (12%)

Query: 560 QKAYDELA-ELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           +KA +ELA EL  +       +  ++ + + +  +D F  G+  IL+ T + A+G+D PN
Sbjct: 446 KKACEELAYELSRKGFSDNTVIHGSKSQEARERAIDSFREGKDKILIATDVAARGIDIPN 505

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           V+LV            +++ +++  + + ++ GR GRA   G
Sbjct: 506 VSLV-----------VNYQMTKKFDEYIHRI-GRTGRAGNKG 535


>PRP28_ASPFU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28;         EC=3.6.1.-;
          Length = 796

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 564 DELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVG 623
           D +A    Q     + +  ++ +   +A L     G  D+L+ T +  +G+D P+V+L  
Sbjct: 648 DAIAREIKQMGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSL-- 705

Query: 624 VLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
           V+N + A ++  +          T   GR GRA K+G
Sbjct: 706 VVNFNMANSIESY----------THRIGRTGRAGKSG 732


>MS116_SCHPO RecName: Full=ATP-dependent RNA helicase mss116,
           mitochondrial;         EC=3.6.1.-;Flags: Precursor;
          Length = 535

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 12/75 (16%)

Query: 590 QALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQV 649
           +++ + F + ++ IL  T ++A+G+DFPN+T V  +   +  N  D+             
Sbjct: 333 RSITESFRKCQSGILFATDVVARGMDFPNITQVVQITGPS--NTDDY----------IHR 380

Query: 650 AGRAGRAEKAGQVLI 664
            GR GRA K G+  +
Sbjct: 381 IGRTGRAGKTGEAYL 395


>DDX23_PONAB RecName: Full=Probable ATP-dependent RNA helicase
           DDX23;         EC=3.6.1.-;AltName: Full=DEAD box protein
           23;
          Length = 820

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 38/142 (26%), Positives = 54/142 (38%), Gaps = 34/142 (23%)

Query: 586 KGSHQA--LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTF 643
           KG  Q    L     G  DIL+ T +  +G+D  +V++  V+N D A N+ D+       
Sbjct: 698 KGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSM--VVNYDMAKNIEDY------- 748

Query: 644 QLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQ-------- 695
                  GR GRA K+G            AI F   +D   FY  +  I           
Sbjct: 749 ---IHRIGRTGRAGKSG-----------VAITFLTKEDSAVFYELKQAILESPVSSCPPE 794

Query: 696 -LGYPPYYFTIGITLSHKKEEE 716
              +P      G  L+ K+ EE
Sbjct: 795 LANHPDAQHKPGTILTKKRREE 816


>DDX23_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
           DDX23;         EC=3.6.1.-;AltName: Full=DEAD box protein
           23;AltName: Full=100 kDa U5 snRNP-specific protein;
          Length = 820

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 38/142 (26%), Positives = 54/142 (38%), Gaps = 34/142 (23%)

Query: 586 KGSHQA--LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTF 643
           KG  Q    L     G  DIL+ T +  +G+D  +V++  V+N D A N+ D+       
Sbjct: 698 KGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSM--VVNYDMAKNIEDY------- 748

Query: 644 QLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQ-------- 695
                  GR GRA K+G            AI F   +D   FY  +  I           
Sbjct: 749 ---IHRIGRTGRAGKSG-----------VAITFLTKEDSAVFYELKQAILESPVSSCPPE 794

Query: 696 -LGYPPYYFTIGITLSHKKEEE 716
              +P      G  L+ K+ EE
Sbjct: 795 LANHPDAQHKPGTILTKKRREE 816


>DBP3_SCHPO RecName: Full=ATP-dependent RNA helicase dbp3;       
           EC=3.6.1.-;
          Length = 578

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 19/118 (16%)

Query: 586 KGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQL 645
           +G+    L+ F  G+  +L+ T + A+GLD P V L  V+N    L + D+         
Sbjct: 452 QGARLQALNDFKSGKCPVLVATDVAARGLDIPKVQL--VINVTFPLTIEDY--------- 500

Query: 646 LTQVAGRAGRAEKAGQVL--IQSYNSQH-----YAIRFAKDQDYEGFYAYEMGIRRQL 696
                GR GRA   G  +      +  H       +R AK    EG + +   ++ +L
Sbjct: 501 -VHRIGRTGRANTKGTAITFFTPQDKSHAGELVNVLRQAKQDIPEGLFKFGTAVKPKL 557


>DBP3_LODEL RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 535

 Score = 37.4 bits (85), Expect = 5e-04
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 12/68 (17%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L  F  GE ++LL T + A+GLD PNV    V+N    L + D+              GR
Sbjct: 417 LQSFKSGECNLLLATDVAARGLDIPNVKY--VINLTFPLTIEDY----------VHRLGR 464

Query: 653 AGRAEKAG 660
            GRA + G
Sbjct: 465 TGRAGQTG 472


>UVRB_RICTY RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 662

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +G+D P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGNIDILVGINLLREGIDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSRGKVIL 551


>UVRB_RICM5 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDILVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSEGRVIL 551


>UVRB_RICFE RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDILVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSEGRVIL 551


>UVRB_RICBR RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDILVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSEGRVIL 551


>UVRB_RICB8 RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 661

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 592 LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAG 651
           +L    +G  DIL+G  ++ +GLD P   LV +L+AD       F  SE +   L Q  G
Sbjct: 487 ILRDLRQGTIDILVGINLLREGLDIPECGLVAILDADK----EGFLRSEVS---LIQTIG 539

Query: 652 RAGRAEKAGQVL 663
           RA R  +   +L
Sbjct: 540 RAARNSEGRVIL 551


>UVRB_RENSM RecName: Full=UvrABC system protein B;       
           Short=Protein uvrB;AltName: Full=Excinuclease ABC
           subunit B;
          Length = 693

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGR 655
           G  D+L+G  ++ +GLD P V+LV +L+AD    L       R+   L Q  GRA R
Sbjct: 502 GVFDVLVGINLLREGLDLPEVSLVSILDADKEGFL-------RSATSLIQTIGRAAR 551


>RRP3_BOTFB RecName: Full=ATP-dependent rRNA helicase rrp3;       
           EC=3.6.1.-;
          Length = 486

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 24/115 (20%)

Query: 586 KGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQL 645
           + S    L++F  G  +IL+ T + A+GLD P+V        D  LN  D     +T+  
Sbjct: 336 QSSRLGALNKFRAGSREILVATDVAARGLDIPSV--------DVVLNY-DVPQDSKTY-- 384

Query: 646 LTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGI-RRQLGYP 699
                GR  RA K+G           +AI      D E F   E  + ++Q+ YP
Sbjct: 385 -IHRVGRTARAGKSG-----------HAISVVTQYDLEIFMRIEAALGKKQVEYP 427


>RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52A; 
                  EC=3.6.1.-;
          Length = 602

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 12/88 (13%)

Query: 584 RKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTF 643
           R +   ++ L  F  G   I++ T + ++GLD PNV    V+N D   ++ D+       
Sbjct: 385 RTQQERESALRSFKTGLTPIMVATDVASRGLDVPNV--AHVINYDLPKSIEDY------- 435

Query: 644 QLLTQVAGRAGRAEKAGQVLIQSYNSQH 671
                  GR GRA KAG        S H
Sbjct: 436 ---VHRIGRTGRAGKAGSATAFFTESDH 460


>DEAD_BUCBP RecName: Full=Cold-shock DEAD box protein A homolog;    
               EC=3.6.1.-;AltName: Full=ATP-dependent RNA helicase
           deaD homolog;
          Length = 602

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 19/132 (14%)

Query: 275 SSIGSSQPPFLLQGI-------TGSGKTEVY-LQIIQGA-LDKGKTAIL-LVPEISLTPQ 324
           S I ++  P+L++G        TGSGKT  + L ++    LD     IL L P   L  Q
Sbjct: 30  SPIQAACIPYLIKGKDVLGMAQTGSGKTAAFALPLLHNIKLDVRVPQILVLTPTRELAVQ 89

Query: 325 MTERFIARFGDKVAILHS-GLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLK------- 376
           + E F + F  K+  +H   L  G++YD   K  R   Q++VG    +   LK       
Sbjct: 90  VAEAF-SNFSKKLIGVHVLALYGGQRYDLQLKSLRKGPQIIVGTPGRLLDHLKRRTLSLS 148

Query: 377 NLGVMIIDEEHE 388
           NL  +++DE  E
Sbjct: 149 NLHSLVLDEADE 160


>DDX4_RANLE RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
                  EC=3.6.1.-;AltName: Full=DEAD box protein
           4;AltName: Full=Vasa homolog;
          Length = 724

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  D +A    Q ++    +   R++   +  L  F  G+  +++ T + A+GLD  N
Sbjct: 547 TKKKADFIATFLCQEKVPSTSIHGDREQKERETALRDFRTGQCPVIVATSVAARGLDIEN 606

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVL 663
           V+   V+N D   ++ ++              GR GR    G+ +
Sbjct: 607 VSY--VINFDIPDDIDEY----------VHRIGRTGRCGNTGRAI 639


>DCL4_ARATH RecName: Full=Dicer-like protein 4;         EC=3.1.26.-;
          Length = 1589

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 46/186 (24%), Positives = 77/186 (41%), Gaps = 22/186 (11%)

Query: 290 TGSGKTEVYLQIIQ--GAL---DKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGL 344
           TG GKT + + +I   G L    K    I L P ++L  Q  +        KVAI   G 
Sbjct: 146 TGCGKTHIAVMLIYELGHLVLSPKKSVCIFLAPTVALVEQQAKVIADSVNFKVAIHCGGK 205

Query: 345 SNGEKYDEW-RKVERGDA-----QVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPR 398
              + + EW R++   +      Q+++      F  ++ + ++I DE H A  +Q SN  
Sbjct: 206 RIVKSHSEWEREIAANEVLVMTPQILLHNLQHCFIKMECISLLIFDECHHA--QQQSNHP 263

Query: 399 YHAREVAILRAQYNQ--------ATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLAT 450
           Y        +++  Q        A+ V+G   P L+S      G +Q   L++  N L  
Sbjct: 264 YAEIMKVFYKSESLQRPRIFGMTASPVVGKDGPPLDSFTYF-SGSFQSENLSKSINSLEN 322

Query: 451 IPEVQV 456
           +   +V
Sbjct: 323 LLNAKV 328


>DCL2_MAGGR RecName: Full=Dicer-like protein 2;Includes:  RecName:
           Full=Endoribonuclease DCL2;         
           EC=3.1.26.-;Includes:  RecName: Full=ATP-dependent
           helicase DCL2;
          Length = 1485

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 32/129 (24%), Positives = 56/129 (43%), Gaps = 18/129 (13%)

Query: 279 SSQPPFLLQGITGSGKTEVYLQIIQGALDK---GKTAILLVPEISLTPQMTERFIARFGD 335
           S Q   ++   TGSGKT+V +  I+  L++    K    L P ++L  Q  E   ++   
Sbjct: 76  SMQQNIIVSMDTGSGKTQVAVLRIRAELERTPPEKRVWFLAPTVALCAQQYEVIRSQIKV 135

Query: 336 KVAILHSGLSNGEKYDEWRKVERGDA------------QVVVGARSAIFAPLKNLGVMII 383
             +I+ +G  N    D W  V+  DA             ++  A S  F  + ++ ++++
Sbjct: 136 ANSIVMTGDDN---VDSWSDVQTWDAVLANVRVVVCTYMILFEALSHAFVTMDSISLLVM 192

Query: 384 DEEHEAAYK 392
           DE H    K
Sbjct: 193 DEAHNCTGK 201


>DCL22_ASPNC RecName: Full=Dicer-like protein 2-2;Includes:
           RecName: Full=Endoribonuclease dcl2-2;         
           EC=3.1.26.-;Includes:  RecName: Full=ATP-dependent
           helicase dcl2-2;
          Length = 1362

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 290 TGSGKTEVYLQIIQGALDKG---KTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSN 346
           TG+GKT+V +  I   +DKG   K   LL P ++L+ Q   ++   F      L SG  +
Sbjct: 45  TGTGKTQVAILRILADIDKGNSDKFVWLLCPTVALSEQQYIQYATVF------LPSGAED 98

Query: 347 GEKYD---EWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEH 387
              +D      K+     QV+  A S  F  L  + ++I DE H
Sbjct: 99  KAIWDNALSGIKIAVSTYQVLYDALSHGFVKLSQMSLLIFDEAH 142


>DBP5_MAGGR RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 504

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 12/92 (13%)

Query: 577 RMDVDTTRKKGSHQA--------LLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNAD 628
           RM+ D  +    H A        LLD F  G++ +L+ T ++A+G+D  +V++  V+N D
Sbjct: 355 RMEADGHKVSALHGAFQGQERDQLLDDFRSGKSKVLITTNVLARGIDVSSVSM--VINYD 412

Query: 629 TALNLPDFRSSERTFQLLTQVAGRAGRAEKAG 660
             +  P  +S +    L     GR GR  + G
Sbjct: 413 IPMKGPGDQSPDAETYL--HRIGRTGRFGRVG 442


>DBP5_CRYNE RecName: Full=ATP-dependent RNA helicase DBP5;       
           EC=3.6.1.-;
          Length = 546

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 591 ALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQV- 649
           A+LD F  GE  +L+ T +IA+G+D P V +  V+N D    +PD         + T + 
Sbjct: 429 AILDGFRNGETKVLITTNVIARGIDIPAVNM--VVNYD----VPDLGPGGNGPDIETYIH 482

Query: 650 -AGRAGRAEKAGQVLIQSYN 668
             GR GR  + G  +I +++
Sbjct: 483 RIGRTGRFGRKGCSVIFTHD 502


>DBP4_ASPCL RecName: Full=ATP-dependent RNA helicase dbp4;       
           EC=3.6.1.-;
          Length = 823

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 21/77 (27%), Positives = 39/77 (50%)

Query: 546 NCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILL 605
           N KS+++ ++ +G Q  +   +    Q  I  M +   +K+G    ++  F + +  +L 
Sbjct: 291 NLKSKTMVFFSSGKQVRFVYESFRHMQPGIPLMHLHGRQKQGGRLDIMTNFSQAKHCVLF 350

Query: 606 GTQMIAKGLDFPNVTLV 622
            T + A+GLDFP V  V
Sbjct: 351 STDVAARGLDFPAVDWV 367


>DBP3_PICST RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 526

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDF 636
           L+ F +GE+ +LL T + A+GLD PNV +  V+N    L + D+
Sbjct: 405 LNSFKKGESSLLLATDVAARGLDIPNVKV--VINLTFPLTVEDY 446


>DBP2_ASPFU RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 547

 Score = 37.0 bits (84), Expect = 6e-04
 Identities = 22/99 (22%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 538 KDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFG 597
           K + ++  N  ++ + +  TGT++  DE+     Q     + +   +++     +L++F 
Sbjct: 358 KHLEKIMENRSNKCLIF--TGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFK 415

Query: 598 RGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDF 636
            G++ I++ T + ++G+D  ++T   VLN D   N  D+
Sbjct: 416 TGKSPIMVATDVASRGIDVRDIT--HVLNYDYPNNSEDY 452


>SKI2_YEAST RecName: Full=Antiviral helicase SKI2;       
           EC=3.6.1.-;AltName: Full=Superkiller protein 2;
          Length = 1287

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 596 FGRGEADILLGTQMIAKGLDFPNVTLV-GVLNADTALNLPDFRSSERTFQLLTQVAGRAG 654
           F +G   +L  T+  A GL+ P  T++   +       L +    E      TQ+AGRAG
Sbjct: 711 FSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGE-----FTQMAGRAG 765

Query: 655 R--AEKAGQVLIQSYNS 669
           R   +  G V++ +YNS
Sbjct: 766 RRGLDSTGTVIVMAYNS 782


>ROK1_EMENI RecName: Full=ATP-dependent RNA helicase rok1;       
           EC=3.6.1.-;
          Length = 742

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query: 563 YDELAELFPQARI--LRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVT 620
           YD   E    ARI  L  D+  T++      ++  F +GE  IL+ T ++A+G+DF  + 
Sbjct: 526 YDIPPEAGGSARIAVLHSDLSDTQRSD----IMKGFRKGEIWILVTTDLLARGVDFRGIN 581

Query: 621 LVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
             GV+N D   N P          +     GR GRA + G V +  Y  +
Sbjct: 582 --GVVNYDIP-NSP---------AVYVHRVGRTGRAGREGGVAVTYYTKE 619


>RH47B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47B; 
                  EC=3.6.1.-;
          Length = 573

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 29/132 (21%)

Query: 586 KGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQL 645
           K +   +L +F  GE  +L+  ++ A+GLD P   L  V+N D   +   +         
Sbjct: 467 KLARSTVLKKFKDGEFRVLVTNELSARGLDVPECDL--VINLDLPTDSTHY--------- 515

Query: 646 LTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYP--PYYF 703
               AGR GR  + G V+     ++ + +R                +R+QL  P  P  F
Sbjct: 516 -AHRAGRTGRLGRKGTVVTICEETETFVVR---------------KMRKQLAVPIKPCEF 559

Query: 704 TIGITLSHKKEE 715
           T G  L H +E+
Sbjct: 560 TEGKLLVHNEED 571


>RH26_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 26;   
                EC=3.6.1.-;
          Length = 536

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 15/57 (26%), Positives = 36/57 (63%)

Query: 566 LAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
           +AE+  Q ++   ++ + + + +   + D+F + +  IL+ + + A+G+D+P+VTLV
Sbjct: 342 VAEVLSQLKLNIREIHSRKSQSARTKVSDEFRKSKGLILVSSDVSARGVDYPDVTLV 398


>PRP5_YEAST RecName: Full=Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5;         EC=3.6.1.-;
          Length = 849

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 12/71 (16%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L++F R +  ILL T+++++GL+ P V+LV + NA             +TF       GR
Sbjct: 568 LEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNA------------VKTFAQYVHTTGR 615

Query: 653 AGRAEKAGQVL 663
             R  ++G  +
Sbjct: 616 TARGSRSGTAI 626


>PRP5_YEAS7 RecName: Full=Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5;         EC=3.6.1.-;
          Length = 849

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 12/71 (16%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGR 652
           L++F R +  ILL T+++++GL+ P V+LV + NA             +TF       GR
Sbjct: 568 LEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNA------------VKTFAQYVHTTGR 615

Query: 653 AGRAEKAGQVL 663
             R  ++G  +
Sbjct: 616 TARGSRSGTAI 626


>PRP28_CRYNE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 738

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query: 560 QKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNV 619
           +K  D + +   QA +  + + + + +   +A L     GE  +L+ T +  +G+D P+V
Sbjct: 594 KKTADMVVKYVQQAGMSGVTLHSGKSQEQREAALQALRDGEISVLVATDLAGRGIDVPDV 653

Query: 620 TLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKD 679
           +LV            +++ S+ T +      GR GRA K G            AI F  +
Sbjct: 654 SLV-----------INWQMSD-TIEKYVHRIGRTGRAGKTG-----------VAITFLTN 690

Query: 680 QDYEGFYAYEMGIRR 694
            D E  Y   + + +
Sbjct: 691 DDDEVMYDLRIEVEK 705


>PRP28_CANGA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28;         EC=3.6.1.-;
          Length = 582

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 12/78 (15%)

Query: 583 TRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERT 642
           ++ +   ++ + +   G A++L+ T + A+GLD P+V LV            +F+ S++ 
Sbjct: 464 SKSQSQRESAIQKLKSGTANVLIATNVAARGLDIPDVALV-----------VNFQMSKKF 512

Query: 643 FQLLTQVAGRAGRAEKAG 660
              + ++ GR GRA K G
Sbjct: 513 DDYIHRI-GRTGRAGKTG 529


>MS116_PHANO RecName: Full=ATP-dependent RNA helicase MSS116,
           mitochondrial;         EC=3.6.1.-;Flags: Precursor;
          Length = 550

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 14/115 (12%)

Query: 558 GTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFP 617
           G    YD      PQ R+  +    ++   +      QF    + IL  + ++ +G+DFP
Sbjct: 343 GVGLLYDLYKHALPQFRVFELHSRMSQPMRTRTTA--QFKEATSGILFASDVVGRGMDFP 400

Query: 618 NVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHY 672
           NV LV        L LP       T Q + +V GR  RA K G+ ++  +  + +
Sbjct: 401 NVGLV------VQLGLP-----SSTEQYVHRV-GRTARAGKDGRAVLVLFEKEAF 443


>IF4A_DICDI RecName: Full=Eukaryotic initiation factor 4A;       
           Short=eIF-4A;         EC=3.6.1.-;AltName:
           Full=ATP-dependent RNA helicase eIF4A;
          Length = 405

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 17/132 (12%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           T+K  D+L E    A      +     +   + ++  F  GE  +L+ T ++A+G+D   
Sbjct: 280 TKKKVDQLTEQMRDANFTVASMHGDMVQKEREEIIKSFRSGENRVLITTDILARGIDVQQ 339

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAK 678
           V+L  V+N D  ++  ++              GR+GR  + G  +    NS    +R   
Sbjct: 340 VSL--VINYDLPIDRENY----------IHRIGRSGRFGRKGVAINFVKNSDIRILR--- 384

Query: 679 DQDYEGFYAYEM 690
             D E FY+ ++
Sbjct: 385 --DIEQFYSTQI 394


>DBP4_ASHGO RecName: Full=ATP-dependent RNA helicase DBP4;       
           EC=3.6.1.-;
          Length = 763

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 12/102 (11%)

Query: 572 QARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTAL 631
           Q  I  M +   +K+ +    LD+F R +   L  T ++A+G+DFP+V    V+  D   
Sbjct: 313 QPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVARGIDFPSVD--WVIQTDCPE 370

Query: 632 NLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYA 673
           ++  +             AGR+ R  K G+ L+     + YA
Sbjct: 371 DVDTY----------IHRAGRSARYGKTGKSLLMLTPQEKYA 402


>DBP3_VANPO RecName: Full=ATP-dependent RNA helicase DBP3;       
           EC=3.6.1.-;
          Length = 530

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 593 LDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDF 636
           LD+F  G + ILL T + A+GLD PNV    V+N    L + D+
Sbjct: 409 LDEFKTGRSSILLATDVAARGLDIPNVKT--VINLTFPLTVEDY 450


>DBP2_NEOFI RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 545

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  DE+     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 373 TGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDV 432

Query: 617 PNVTLVGVLNADTALNLPDF 636
            ++T   VLN D   N  D+
Sbjct: 433 RDIT--HVLNYDYPNNSEDY 450


>DBP2_ASPOR RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 554

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  DE+     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 384 TGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDV 443

Query: 617 PNVTLVGVLNADTALNLPDF 636
            ++T   VLN D   N  D+
Sbjct: 444 RDIT--HVLNYDYPNNSEDY 461


>DBP2_ASPNC RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 565

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  DE+     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 391 TGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDV 450

Query: 617 PNVTLVGVLNADTALNLPDF 636
            ++T   VLN D   N  D+
Sbjct: 451 RDIT--HVLNYDYPNNSEDY 468


>DBP2_ASPCL RecName: Full=ATP-dependent RNA helicase dbp2;       
           EC=3.6.1.-;
          Length = 549

 Score = 36.6 bits (83), Expect = 8e-04
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 557 TGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDF 616
           TGT++  DE+     Q     + +   +++     +L++F  G++ I++ T + ++G+D 
Sbjct: 379 TGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKAGKSPIMVATDVASRGIDV 438

Query: 617 PNVTLVGVLNADTALNLPDF 636
            ++T   VLN D   N  D+
Sbjct: 439 RDIT--HVLNYDYPNNSEDY 456


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,263,583,957
Number of extensions: 376207320
Number of successful extensions: 1100606
Number of sequences better than 1.0e-03: 30247
Number of HSP's gapped: 1057866
Number of HSP's successfully gapped: 46208
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)