# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28344.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF54982.1  [L=63]
Description: spne4 ACF54982.1 GIB00761CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
       0.51   12.7   0.6       0.57   12.6   0.4    1.2  1  PF11391  Protein of unknown function (DUF2798)
        2.2   10.7   0.3        3.3   10.2   0.2    1.3  1  PF07869  Protein of unknown function (DUF1656)
        4.4    9.5   0.1        4.6    9.5   0.1    1.1  1  PF04401  Protein of unknown function (DUF540)
         25    7.1   0.1         38    6.5   0.0    1.3  1  PF04061  ORMDL family
         48    6.4   0.3         65    6.0   0.2    1.2  1  PF07330  Protein of unknown function (DUF1467)
         50    4.5   0.0         56    4.3   0.0    1.0  1  PF08326  Acetyl-CoA carboxylase, central region
         96    5.6   0.2    2.6e+02    4.3   0.1    1.7  1  PF02202  Tachykinin family
      1e+02    5.7   0.0    1.1e+02    5.6   0.0    1.1  1  PF09832  Uncharacterized protein conserved in bacteria (DUF2
    1.3e+02    5.2   0.1    1.5e+02    4.9   0.1    1.0  1  PF08660  Oligosaccharide biosynthesis protein Alg14 like
    1.7e+02    2.9   0.0    1.7e+02    2.8   0.0    1.0  1  PF02028  BCCT family transporter
    1.7e+02    4.4   0.0      2e+02    4.2   0.0    1.1  1  PF08854  Domain of unknown function (DUF1824)
    1.8e+02    4.6   0.4      9e+02    2.4   0.1    2.0  1  PF10581  Synapsin N-terminal
    2.1e+02    5.0   0.7    2.6e+02    4.6   0.5    1.3  1  PF02517  CAAX amino terminal protease family
    2.5e+02    4.4   0.0    3.6e+02    3.8   0.0    1.2  1  PF08263  Leucine rich repeat N-terminal domain
    2.7e+02    3.0   0.1    3.2e+02    2.8   0.0    1.1  1  PF11019  Protein of unknown function (DUF2608)
    3.7e+02    3.4   0.1    5.4e+02    2.8   0.1    1.2  1  PF12468  Type III secretion system leucine rich repeat prote
    4.3e+02    2.9   0.1    3.8e+02    3.1   0.1    1.1  1  PF11028  Protein of unknown function (DUF2723)
    6.2e+02    1.6   0.0    6.1e+02    1.6   0.0    1.0  1  PF06398  Integral peroxisomal membrane peroxin
    6.9e+02    3.1   0.0    8.3e+02    2.9   0.0    1.2  1  PF10360  Protein of unknown function (DUF2433)


Domain and alignment annotation for each model:
>> PF11391  Protein of unknown function (DUF2798)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.6   0.4   0.00011      0.57      25      54 ..      17      43 ..       1      49 [. 0.56

  Alignments for each domain:
  == domain 1    score: 12.6 bits;  conditional E-value: 0.00011
     PF11391 25 gflsrWlkafllAwpvAfpivl.lvaplvrr 54
                ++    l+a+ + ++ A+p+++ +v p++r 
  ACF54982.1 17 TY----LSAWFVNFIAALPLNFlIVEPIARF 43
                44....5555555555555555344455554 PP

>> PF07869  Protein of unknown function (DUF1656)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.2   0.2   0.00063       3.3       9      39 ..      18      48 ..      16      49 .. 0.93

  Alignments for each domain:
  == domain 1    score: 10.2 bits;  conditional E-value: 0.00063
     PF07869  9 yfPplllvallAllltlllrrllarlglyrf 39
                y+++ ++ +++Al l +l++  +ar++l+ f
  ACF54982.1 18 YLSAWFVNFIAALPLNFLIVEPIARFILSSF 48
                99******************99999999865 PP

>> PF04401  Protein of unknown function (DUF540)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   0.1   0.00088       4.6      22      66 ..      16      59 ..       5      62 .. 0.80

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.00088
     PF04401 22 lswlltlawilavllllllflflfsavanliaapF.ldllaekvek 66
                 ++l+  aw++ ++++l l ++++ ++a +i + F  ++  e+ve+
  ACF54982.1 16 NTYLS--AWFVNFIAALPLNFLIVEPIARFILSSFqKPFTGEEVEE 59
                56777..899999999999999999999999999966666677765 PP

>> PF04061  ORMDL family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0073        38      90     109 ..      33      52 ..      27      58 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0073
     PF04061  90 kflllvPivlflisthytky 109
                  fl++ Pi+ f++s++   +
  ACF54982.1  33 NFLIVEPIARFILSSFQKPF 52 
                 7**************98766 PP

>> PF07330  Protein of unknown function (DUF1467)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.2     0.012        65      10      25 ..      18      33 ..       9      37 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.012
     PF07330 10 YfviWwvvlfvvLPfg 25
                Y+  W+v +++ LP++
  ACF54982.1 18 YLSAWFVNFIAALPLN 33
                8889**********96 PP

>> PF08326  Acetyl-CoA carboxylase, central region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.011        56     607     652 ..      16      61 ..      10      61 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.011
                 ---------------------------------------------- CS
     PF08326 607 rtdlnhiFlnfvpelnldpesveealasflervgerlwrLrVtqvE 652
                 +t l+  F+nf++ l l+   ve +++ +l+++++ ++   V +vE
  ACF54982.1  16 NTYLSAWFVNFIAALPLNFLIVEPIARFILSSFQKPFTGEEVEEVE 61 
                 6778888*****************************9999999998 PP

>> PF02202  Tachykinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1      0.05   2.6e+02       6      10 ..       2       6 ..       2       6 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.05
                HH--- CS
     PF02202  6 qFvGL 10
                +F+GL
  ACF54982.1  2 SFYGL 6 
                7***9 PP

>> PF09832  Uncharacterized protein conserved in bacteria (DUF2059)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.021   1.1e+02      37      59 ..      41      63 .]      23      63 .] 0.81

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.021
     PF09832 37 ikelapiYakhFTeeELkaiiaF 59
                   +++ ++k FT eE++++ +F
  ACF54982.1 41 ARFILSSFQKPFTGEEVEEVEDF 63
                55567899***********9988 PP

>> PF08660  Oligosaccharide biosynthesis protein Alg14 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.028   1.5e+02      97     134 ..       7      44 ..       5      49 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.028
     PF08660  97 ltnGpgtcvpvvlaakllkllallrskivYvEslarvk 134
                 + nG ++    +l+a++++++a+l ++   vE +ar+ 
  ACF54982.1   7 FYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFI 44 
                 67999999999************************975 PP

>> PF02028  BCCT family transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.033   1.7e+02     133     172 ..      19      58 ..      10      61 .. 0.72

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.033
     PF02028 133 lhaWaiYalvglalayfayrkglpltissalypllgerie 172
                 l+aW +  +++l l +++++    + +ss  +p+ ge++e
  ACF54982.1  19 LSAWFVNFIAALPLNFLIVEPIARFILSSFQKPFTGEEVE 58 
                 5677777777777777777777777777777777777665 PP

>> PF08854  Domain of unknown function (DUF1824)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.038     2e+02      96     125 .]       6      35 ..       1      35 [. 0.87

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.038
     PF08854  96 GlgrGvLiscqsddeskesetyGplPLdlf 125
                   ++G+ i+++ + ++   +  + lPL+++
  ACF54982.1   6 LFYNGIAITPNTYLSAWFVNFIAALPLNFL 35 
                 4689************999*********96 PP

>> PF10581  Synapsin N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.17     9e+02      12      18 ..      25      31 ..      24      36 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.17
     PF10581 12 sFvanLP 18
                +F+a LP
  ACF54982.1 25 NFIAALP 31
                8*****9 PP

>> PF02517  CAAX amino terminal protease family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.5     0.049   2.6e+02      18      46 ..       3      31 ..       1      52 [. 0.73

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.049
     PF02517 18 fRgllllllekkasgllaillsailfglv 46
                f gl+++ +  + +++l++++++++ +l 
  ACF54982.1  3 FYGLFYNGIAITPNTYLSAWFVNFIAALP 31
                78888888888889999988888888764 PP

>> PF08263  Leucine rich repeat N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.069   3.6e+02      11      29 ..       7      25 ..       6      26 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.069
     PF08263 11 fKssltddphgaLssWnps 29
                f +++  +p+  Ls W  +
  ACF54982.1  7 FYNGIAITPNTYLSAWFVN 25
                7899999999******875 PP

>> PF11019  Protein of unknown function (DUF2608)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.061   3.2e+02     204     222 ..       2      20 ..       1      28 [. 0.86

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.061
     PF11019 204 nflGihYtkakereeayia 222
                 +f+G++Y++ ++ ++ y++
  ACF54982.1   2 SFYGLFYNGIAITPNTYLS 20 
                 79*********98888776 PP

>> PF12468  Type III secretion system leucine rich repeat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.1       0.1   5.4e+02      18      26 ..      14      22 ..       8      23 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.1
     PF12468 18 tpadYlaiW 26
                tp+ Yl++W
  ACF54982.1 14 TPNTYLSAW 22
                99******* PP

>> PF11028  Protein of unknown function (DUF2723)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1     0.072   3.8e+02      23      49 ..       4      30 ..       1      55 [. 0.81

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.072
     PF11028 23 flllgklfsllpdfgsvAlrvnllsal 49
                + l+++ +++ p++   A+ vn++ al
  ACF54982.1  4 YGLFYNGIAITPNTYLSAWFVNFIAAL 30
                666666677777888889999999887 PP

>> PF06398  Integral peroxisomal membrane peroxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.12   6.1e+02     147     202 ..       3      58 ..       1      62 [. 0.72

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.12
     PF06398 147 fllllltpilllllarlipwrlillvlgwavlltyHpsvskvllrllkyltgeefk 202
                 f++l+   i ++  ++l  w + ++ +  + +l++ p  + +l ++ k  tgee++
  ACF54982.1   3 FYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFILSSFQKPFTGEEVE 58 
                 77777777777777888888777777777778888887777777777777777766 PP

>> PF10360  Protein of unknown function (DUF2433)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.16   8.3e+02       1      13 [.       4      16 ..       4      31 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.16
     PF10360  1 YgvsyNefsvnps 13
                Yg+ yN+ +++p+
  ACF54982.1  4 YGLFYNGIAITPN 16
                9*********986 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (63 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       241  (0.0202317); expected 238.2 (0.02)
Passed bias filter:                      222  (0.0186367); expected 238.2 (0.02)
Passed Vit filter:                        19  (0.00159503); expected 11.9 (0.001)
Passed Fwd filter:                        19  (0.00159503); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              19  [number of targets reported over threshold]
# CPU time: 0.11u 0.04s 00:00:00.15 Elapsed: 00:00:01
# Mc/sec: 1236.46
//